% % This file was created by the TYPO3 extension % bib % --- Timezone: CEST % Creation date: 2022-05-23 % Creation time: 01-46-05 % --- Number of references % 1269 % @Article { KossertLMPRR2022, subid = {2702}, title = {High precision measurement of the 151Sm beta decay by means of a metallic magnetic calorimeter}, journal = {Applied Radiation and Isotopes}, year = {2022}, month = {7}, volume = {185}, number2 = {20FUN04: PrimA-LTD: Towards new primary activity standardisation methods based on low-temperature detectors}, pages = {110237}, keywords = {Sm-151, 151Sm, Metallic magnetic calorimeter, Beta minus decay, Kurie plot, Beta spectrum shapes}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2022.110237}, stag_bib_extends_levelofaccess = {NA}, author = {Kossert, K. and Loidl, M. and Mougeot, X. and Paulsen, M. and Ranitzsch, P. and Rodrigues, M.} } @Article { RubenVogtRGDKMKKSBBMPFCRVSH2022, subid = {2751}, title = {PV Module Energy Rating Standard IEC 61853-3 Intercomparison and Best Practice Guidelines for Implementation and Validation}, journal = {IEEE Journal of Photovoltaics}, year = {2022}, month = {5}, volume = {12}, number = {3}, number2 = {19ENG01: Metro-PV: Metrology for emerging PV applications}, pages = {844-852}, keywords = {Standards, Meteorology, IEC Standards, Temperature measurement, Power measurement, Photovoltaic systems, Mathematical models}, web_url = {https://www.techrxiv.org/articles/preprint/PV_module_energy_rating_standard_IEC_61853-3_intercomparison_and_best_practice_guidelines_for_implementation_and_validation/19635333/1}, misc2 = {EMPIR 2019: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2021.3135258}, stag_bib_extends_levelofaccess = {NA}, author = {Ruben Vogt, M. and Riechelmann, S. and Gracia-Amillo, A.M. and Driesse, A. and Kokka, A. and Maham, K. and K{\"a}rh{\"a}, P. and Kenny, R. and Schinke, C. and Bothe, K. and Blakesley, J. and Music, E. and Plag, F. and Friesen, G. and Corbellini, G. and Riedel-Lyngskar, N. and Valckenborg, R. and Schweiger, M. and Herrmann, W.} } @Article { BriantKCLBWRMPCESTHPKKDZWMSNB2022, subid = {2714}, title = {Photonic and Optomechanical Thermometry}, journal = {Optics}, year = {2022}, month = {4}, day = {29}, volume = {3}, number = {2}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {159-176}, keywords = {thermometry; photonic; optomechanic; temperature sensors; photonic integrated circuit}, web_url = {https://doi.org/10.3390/opt3020017}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2673-3269}, DOI = {10.3390/opt3020017}, stag_bib_extends_levelofaccess = {NA}, author = {Briant, T. and Krenek, S. and Cupertino, A. and Loubar, F. and Braive, R. and Weituschat, L. and Ramos, D. and Martin, M.J. and Postigo, P.A. and Casas, A. and Eisermann, R. and Schmid, D. and Tabandeh, S. and Hahtela, O. and Pourjamal, S. and Kozlova, O. and Kroker, S. and Dickmann, W. and Zimmermann, L. and Winzer, G. and Martel, T. and Steeneken, P.G. and Norte, R.A. and Briaudeau, S.} } @Article { KhabipovGKDZ2022, subid = {2708}, title = {Superconducting microwave resonators with non-centrosymmetric nonlinearity}, journal = {Superconductor Science and Technology}, year = {2022}, month = {4}, day = {22}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, keywords = {coplanar waveguide resonators, rf-SQUID, three wave mixing, parametric amplification, superconductivity}, web_url = {https://arxiv.org/abs/2204.10133}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0953-2048, 1361-6668}, DOI = {10.1088/1361-6668/ac6989}, stag_bib_extends_levelofaccess = {NA}, author = {Khabipov, M. and Gaydamachenko, V. and Kissling, C. and Dolata, R. and Zorin, A.B.} } @Article { RubinSZHFABKLZA2022, subid = {2709}, title = {Thermodynamic effects in a gas modulated Invar-based dual Fabry–P{\'e}rot cavity refractometer}, journal = {Metrologia}, year = {2022}, month = {4}, day = {14}, volume = {59}, number = {3}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {035003}, keywords = {quantumpascal, GAMOR, optical pressure standard, gas refractometry, pV-work, Invar-based}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac5ef9}, stag_bib_extends_levelofaccess = {NA}, author = {Rubin, T. and Silander, I. and Zakrisson, J. and Hao, M. and Forss{\'e}n, C. and Asbahr, P. and Bernien, M. and Kussicke, A. and Liu, K. and Zelan, M. and Axner, O.} } @Article { ZibordiKMTCDG2022, subid = {2594}, title = {Assessment of OLCI-A and OLCI-B radiometric data products across European seas}, journal = {Remote Sensing of Environment}, year = {2022}, month = {4}, volume = {272}, number2 = {19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system}, pages = {112911}, keywords = {Ocean and Land Colour Instruments, Radiometry, AeroNET-OC, Copernicus Sentinel-3}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0034-4257}, DOI = {10.1016/j.rse.2022.112911}, stag_bib_extends_levelofaccess = {NA}, author = {Zibordi, G. and Kwiatkowska, E. and M{\'e}lin, F. and Talone, M. and Cazzaniga, I. and Dessailly, D. and Gossn, J.I.} } @Article { KranzerSBHPLLP2022, subid = {2662}, title = {Response of diamond detectors in ultra-high dose-per-pulse electron beams for dosimetry at FLASH radiotherapy}, journal = {Physics in Medicine \& Biology}, year = {2022}, month = {3}, day = {21}, volume = {67}, number = {7}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {075002}, keywords = {dosimetry, FLASH radiotherapy, ultra-high dose-per-pulse, microDiamond}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac594e}, stag_bib_extends_levelofaccess = {NA}, author = {Kranzer, R. and Sch{\"u}ller, A. and Bourgouin, A. and Hackel, T. and Poppinga, D. and Lapp, M. and Looe, H.K. and Poppe, B.} } @Article { Kok2022, subid = {2674}, title = {The digital transformation and novel calibration approaches}, journal = {tm - Technisches Messen}, year = {2022}, month = {3}, day = {17}, volume = {89}, number = {4}, number2 = {18NET05: MATHMET: Support for a European Metrology Network for mathematics and statistics}, pages = {214-223}, keywords = {Digital transformation, digitalization, calibration, artificial intelligence, virtual instrument, digital twin, new SI, self-X-solution, metrology network}, web_url = {https://doi.org/10.1515/teme-2021-0136\&\#10;https://www.degruyter.com/document/doi/10.1515/teme-2021-0136/html}, misc2 = {EMPIR 2018: Support for Networks}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2196-7113, 0171-8096}, DOI = {10.1515/teme-2021-0136}, stag_bib_extends_levelofaccess = {NA}, author = {Kok, G.} } @Article { BourgouinKMKSK2022, subid = {2663}, title = {Characterization of the PTB ultra-high pulse dose rate reference electron beam}, journal = {Physics in Medicine \& Biology}, year = {2022}, month = {3}, day = {15}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {Ultra-High Dose Rate, Dosimetry for FLASH, Monte Carlo, Diamond detector,electron beams}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac5de8}, stag_bib_extends_levelofaccess = {NA}, author = {Bourgouin, A. and Knyziak, A. and Marinelli, M. and Kranzer, R. and Sch{\"u}ller, A. and Kapsch, R-P.} } @Article { KronerABBBCPSSUW2022, subid = {2643}, title = {Evaluation of the measurement performance of water meters depending on water quality}, journal = {Water Supply}, year = {2022}, month = {3}, day = {14}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {cold water meters, test regime, water quality, water meter accuracy}, misc2 = {EMPIR 2017: Industry}, publisher = {IWA Publishing}, language = {30}, ISSN = {1606-9749, 1607-0798}, DOI = {10.2166/ws.2022.133}, stag_bib_extends_levelofaccess = {NA}, author = {Kroner, C. and Akselli, B. and Benkova, M. and Borchling, A. and B{\"u}ker, O. and Christoffersen, N. and Pavlas, J. and Schumann, D. and Seypka, V. and Unsal, B. and Warnecke, H.} } @Article { RottgerRGVKCCKRMR2022, subid = {2625}, title = {Radon metrology for use in climate change observation and radiation protection at the environmental level}, journal = {Advances in Geosciences}, year = {2022}, month = {3}, day = {10}, volume = {57}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, pages = {37-47}, keywords = {Radon, climate observation, radon monitor, radiation protection, radon tracer method (RTM), radon emanation source, activity concentration, traceability}, misc2 = {EMPIR 2019: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7359}, DOI = {10.5194/adgeo-57-37-2022}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, S. and R{\"o}ttger, A. and Grossi, C. and Vargas, A. and Karstens, U. and Cinelli, G. and Chung, E. and Kikaj, D. and Rennick, C. and Mertes, F. and Radulescu, I.} } @Article { KlenovskyVKVKF2022, subid = {2689}, title = {Interplay between multipole expansion of exchange interaction and Coulomb correlation of exciton in colloidal II–VI quantum dots}, journal = {Electronic Structure}, year = {2022}, month = {3}, volume = {4}, number = {1}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {015006}, keywords = {quantum dots}, web_url = {https://iopscience.iop.org/article/10.1088/2516-1075/ac5b7e}, misc2 = {EMPIR 2020: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {2516-1075}, DOI = {10.1088/2516-1075/ac5b7e}, stag_bib_extends_levelofaccess = {NA}, author = {Klenovsk{\'y}, P. and Valdhans, J. and Krejč{\'i}, L. and Valtr, M. and Klapetek, P. and Fedotova, O.} } @Article { ChaeKKPTKPGYSCCS2022, subid = {2653}, title = {Investigation of the stability of graphene devices for quantum resistance metrology at direct and alternating current}, journal = {Measurement Science and Technology}, year = {2022}, month = {3}, volume = {33}, number = {6}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {065012}, keywords = {quantum Hall effect, quantized Hall resistance, graphene, impedance standard,F4-TCNQ doping, stability}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/ac4a1a}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac4a1a}, stag_bib_extends_levelofaccess = {NA}, author = {Chae, D-H. and Kruskopf, M. and Kucera, J. and Park, J. and Tran, N.T.M. and Kim, D.B. and Pierz, K. and G{\"o}tz, M. and Yin, Y. and Svoboda, P. and Chrobok, P. and Cou{\"e}do, F. and Schopfer, F.} } @Article { GeorgiKNSSTJ2022, subid = {2621}, title = {Toward 3D dose verification of an electronic brachytherapy source with a plastic scintillation detector}, journal = {Medical Physics}, year = {2022}, month = {3}, volume = {1-12}, number = {1-12}, number2 = {18NRM02: PRISM-eBT: Primary standards and traceable measurement methods for X-ray emitting electronic brachytherapy devices}, pages = {1-12}, keywords = {dose verification, electronic brachytherapy, Monte Carlo dosimetry, plastic scintillators}, web_url = {https://doi.org/10.1002/mp.15568}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.15568}, stag_bib_extends_levelofaccess = {NA}, author = {Georgi, P. and Kertzscher, G. and Nyvang, L. and Solc, J. and Schneider, T. and Tanderup, K. and Johansen, J.G.} } @Article { MarlettoVKPBRAGDG2022, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2020: Industry}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { SteindlK2022, subid = {2690}, title = {Dimension-Dependent Phenomenological Model of Excitonic Electric Dipole in InGaAs Quantum Dots}, journal = {Nanomaterials}, year = {2022}, month = {2}, day = {21}, volume = {12}, number = {4}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {719}, keywords = {quantum dots}, web_url = {https://www.mdpi.com/2079-4991/12/4/719}, misc2 = {EMPIR 2020: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12040719}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Klenovsk{\'y}, P.} } @Article { WarneckeKOKCBBHHU2022, subid = {2574}, title = {New metrological capabilities for measurements of dynamic liquid flows}, journal = {Metrologia}, year = {2022}, month = {2}, day = {17}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {dynamic liquid flow rates, test rigs with dynamic measurement capabilities, validation through inter-facility intercomparison}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac566e}, stag_bib_extends_levelofaccess = {NA}, author = {Warnecke, H. and Kroner, C. and Ogheard, F. and Kondrup, J.B. and Christoffersen, N. and Benkova, M. and B{\"u}ker, O. and Haack, S. and Huovinen, M. and Unsal, B.} } @Proceedings { BircherMKBEKHHL2022, subid = {2585}, title = {Traceable determination of non-static XCT machine geometry: New developments and case studies}, journal = {Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022,}, year = {2022}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {traceability, Dimensional metrology, XCT machine geometry, calibrated reference standards, radiographic XCT geometry determination, stage error motion, CFD/FE simulations, image quality metric based methods}, web_url = {https://www.ndt.net/search/docs.php3?id=26614}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {11th Conference on Industrial Computed Tomography (iCT) 2022}, event_date = {08-02-2022 to 11-02-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id209.pdf}, author = {Bircher, B. and Meli, F. and K{\"u}ng, A. and Bellon, C. and Evsevleev, S. and Katić, M. and Heikkinen, V. and Hemming, B. and Lassila, A.} } @Article { ZutzBKHR2022, subid = {2630}, title = {DEVELOPMENT OF A EUROPEAN METROLOGY NETWORK FOR RELIABLE RADIATION PROTECTION: PULSED HIGH ENERGY PHOTON REFERENCE FIELD AS A METROLOGICAL GAP IN RADIATION PROTECTION}, journal = {Physica Medica}, year = {2022}, month = {2}, volume = {94}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, pages = {S113}, keywords = {high energy pulsed fields, European Metrology Network for Radiation Protection, photon reference field, metrological gaps, supportBSS}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/S1120-1797(22)01699-4}, stag_bib_extends_levelofaccess = {NA}, author = {Zutz, H. and Busse, J. and Khanbabaee, B. and Hupe, O. and R{\"o}ttger, A.} } @Article { WeingartnerHVVROKMD2022, subid = {2519}, title = {Comparing black-carbon- and aerosol-absorption-measuring instruments – a new system using lab-generated soot coated with controlled amounts of secondary organic matter}, journal = {Atmospheric Measurement Techniques}, year = {2022}, month = {2}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, keywords = {soot , black carbon, absorption photometer, photo-thermal interferometer, calibration}, misc2 = {EMPIR 2018: Health}, language = {30}, DOI = {10.5194/amt-15-561-2022}, stag_bib_extends_levelofaccess = {NA}, author = {Weingartner, E. and Hyv{\"a}rinen, A-P. and Vasilatou, K. and Visser, B. and R{\"o}rhbein, J. and Oscity, M. and Kalbermatter, D. and Močnik, G. and Drinovec, L.} } @Article { KuckLHGCRPSGBFLTTCMDTRR2022, subid = {2486}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Single photon sources, quantum radiometry, quantum metrology}, web_url = {https://doi.org/10.1007/s00340-021-07734-2}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { KuckLHGCRPSGBFLTTCMDTRR2022_2, subid = {2752}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, keywords = {Single-photon sources, quantum radiometry, calibration, single photon detectors. defect centres, (nano-)diamonds, molecule semiconductor quantum dots, photon flux, single-photon purity, spectral power distribution}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { TongBKRGGGCHC2022, subid = {2570}, title = {Cathodoluminescence mapping of electron concentration in MBE-grown GaAs:Te nanowires}, journal = {Nanotechnology}, year = {2022}, month = {1}, day = {22}, volume = {33}, number = {18}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {185704}, keywords = {nanowires, GaAs, doping, cathodoluminescence}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/ac4d58}, misc2 = {EMPIR 2019: Energy}, publisher = {IOP}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://hal.archives-ouvertes.fr/hal-03539939}, author = {Tong, C. and Bidaud, T. and Koivusalo, E. and Rizzo Piton, M. and Guina, M. and Galeti, H. and Galvao Gobato, Y. and Cattoni, A. and Hakkarainen, T. and Collin, S.} } @Article { DuKJMYCOMZ2022, subid = {2748}, title = {SU(2)-in-SU(1,1) Nested Interferometer}, journal = {Physical Review Letters}, year = {2022}, month = {1}, day = {20}, volume = {128}, number = {3}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {SU(1,1) interferometry, spin squeezing, entanglement}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2004.14266}, author = {Du, W. and Kong, J. and ., . and ., . and Jia, J. and Ming, S. and Yuan, C-H. and Chen, J.F. and Ou, Z.Y. and Mitchell, M.W. and Zhang, W.} } @Article { MittelstadtSK2022, subid = {2680}, title = {Modeling electronic and optical properties of III–V quantum dots—selected recent developments}, journal = {Light: Science \& Applications}, year = {2022}, month = {1}, day = {17}, volume = {11}, number = {1}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {17}, keywords = {quantum dots, empirical tight binding}, web_url = {https://www.nature.com/articles/s41377-021-00700-9}, misc2 = {EMPIR 2020: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/s41377-021-00700-9}, stag_bib_extends_levelofaccess = {NA}, author = {Mittelst{\"a}dt, A. and Schliwa, A. and Klenovsk{\'y}, P.} } @Article { ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022, subid = {2567}, title = {2022 roadmap on neuromorphic computing and engineering}, journal = {Neuromorphic Computing and Engineering}, year = {2022}, month = {1}, day = {12}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, keywords = {neuromorphic computing, neuromorphic engineering}, web_url = {https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2634-4386}, DOI = {10.1088/2634-4386/ac4a83}, stag_bib_extends_levelofaccess = {NA}, author = {Christensen, D.V. and Dittmann, R. and Linares-Barranco, B. and Sebastian, A. and Le Gallo, M. and Redaelli, A. and Slesazeck, S. and Mikolajick, T. and Spiga, S. and Menzel, S. and Valov, I. and Milano, G. and Ricciardi, C. and Liang, S-J. and Miao, F. and Lanza, M. and Quill, T.J. and Keene, S.T. and Salleo, A. and Grollier, J. and Markovic, D. and Mizrahi, A. and Yao, P. and Yang, J.J. and Indiveri, G. and Strachan, J.P. and Datta, S. and Vianello, E. and Valentian, A. and Feldmann, J. and Li, X. and Pernice, W.H.P. and Bhaskaran, H. and Furber, S. and Neftci, E. and Scherr, F. and Maass, W. and Ramaswamy, S. and Tapson, J. and Panda, P. and Kim, Y. and Tanaka, G. and Thorpe, S. and Bartolozzi, C. and Cleland, T.A. and Posch, C. and Liu, S-C. and Panuccio, G. and Mahmud, M. and Mazumder, A.N. and Hosseini, M. and Mohsenin, T. and Donati, E. and Tolu, S. and Galeazzi, R. and Christensen, M.E. and Holm, S. and Ielmini, D. and Pryds, N.} } @Article { ChristinckRLGHGK2022, subid = {2506}, title = {Comparison of back focal plane imaging of nitrogen vacancy centers in nanodiamond and core-shell CdSe/CdS quantum dots}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {012014}, keywords = {nitrogen vacancy center, nanodiamond, CdSe/CdS quantum dots, back focal imaging}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/2149/1/012014}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/2149/1/012014}, stag_bib_extends_levelofaccess = {NA}, author = {Christinck, J. and Rodiek, B. and L{\'o}pez, M. and Georgieva, H. and Hofer, H. and G{\"o}tzinger, S. and K{\"u}ck, S.} } @Proceedings { HulsenGPGKF2022, subid = {2416}, title = {Angular responsivity of ground and space-based direct solar irradiance radiometers}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {2149}, number2 = {19ENV04: MAPP: Metrology for aerosol optical properties}, pages = {1-7}, keywords = {Radiometry, field of view, angular responsivity}, web_url = {https://iopscience.iop.org/issue/1742-6596/2149/1}, misc2 = {EMPIR 2019: Environment}, publisher = {IOP Publishing Limited}, event_place = {Boulder}, event_name = {14th International Conference on New Developments and Applications in Optical Radiometry (NEWRAD 2021)}, event_date = {21-06-2021 to 24-06-2021}, language = {30}, DOI = {10.1088/1742-6596/2149/1/012001}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"u}lsen, G. and Gr{\"o}bner, J. and Pfiffner, D. and Gyo, M. and Kouremeti, N. and F{\"o}ller, J.} } @Proceedings { KouremetiGN2022, subid = {2417}, title = {Stray-Light Correction Methodology for the Precision Solar Spectroradiometer}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {2149}, number2 = {19ENV04: MAPP: Metrology for aerosol optical properties}, pages = {1-9}, keywords = {Radiometry, spectral, stray light, spectroradiometer}, web_url = {https://iopscience.iop.org/issue/1742-6596/2149/1}, misc2 = {EMPIR 2019: Environment}, publisher = {IOP Publishing Limited}, event_place = {Boulder}, event_name = {14th International Conference on New Developments and Applications in Optical Radiometry (NEWRAD 2021)}, event_date = {21-06-2021 to 24-06-2021}, language = {30}, DOI = {10.1088/1742-6596/2149/1/012002}, stag_bib_extends_levelofaccess = {NA}, author = {Kouremeti, N. and Gr{\"o}bner, J. and Nevas, S.} } @Article { KatonaTSKN2022, subid = {2568}, title = {Geometric system analysis of ILMD-based LID measurement systems using Monte-Carlo simulation}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {1}, number2 = {19NRM02: RevStdLED: Revision and extension of standards for test methods for LED lamps, luminaires and modules}, pages = {012015}, keywords = {ILMD, goniophotometer, geoemtric uncertainty, monte carlo simulation,}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/2149/1/012015}, stag_bib_extends_levelofaccess = {NA}, author = {Katona, M. and Trampert, K. and Schwanengel, C. and Kr{\"u}ger, U. and Neumann, C.} } @Article { ShellingNetoDK2022, subid = {2719}, title = {Deep learning assisted design of high reflectivity metamirrors}, journal = {Optics Express}, year = {2022}, month = {1}, volume = {30}, number = {2}, number2 = {20FUN08: NEXTLASERS: Next generation ultrastable lasers: reducing thermal noise limit and overcoming technical limitations with new materials and tech}, pages = {986}, keywords = {deep learning, nanostructured mirrors, metamirrors}, misc2 = {EMPIR 2020: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.446442}, stag_bib_extends_levelofaccess = {NA}, author = {Shelling Neto, L. and Dickmann, J. and Kroker, S.} } @Article { FasoloBBCCCCCDEFFFFGGGGKLLLMMMMMMMNOPPPRRRSUV2022, subid = {2612}, title = {Bimodal Approach for Noise Figures of Merit Evaluation in Quantum-Limited Josephson Traveling Wave Parametric Amplifiers}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2022}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, keywords = {Physics, Gain, Microwave amplifiers, Noise figure, Superconducting microwave devices, Microwave photonics, Bandwidth}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2022.3148692}, stag_bib_extends_levelofaccess = {NA}, author = {Fasolo, L. and Barone, C. and Borghesi, M. and Carapella, G. and Caricato, A.P. and Carusotto, I. and Chung, W. and Cian, A. and Di Gioacchino, D. and Enrico, E. and Falferi, P. and Faverzani, M. and Ferri, E. and Filatrella, G. and Gatti, C. and Giachero, A. and Giubertoni, D. and Greco, A. and Kutlu, C. and Leo, A. and Ligi, C. and Livreri, P. and Maccarone, G. and Margesin, B. and Maruccio, G. and Matlashov, A. and Mauro, C. and Mezzena, R. and Monteduro, A.G. and Nucciotti, A. and Oberto, L. and Pagano, S. and Pierro, V. and Piersanti, L. and Rajteri, M. and Rettaroli, A. and Rizzato, S. and Semertzidis, Y.K. and Uchaikin, S.V. and Vinante, A.} } @Article { RobertIK2021, subid = {2163}, title = {Variable Launch System for the Metrology of EOCBs}, journal = {International Journal of Optics and Photonic Engineering}, year = {2021}, month = {12}, day = {31}, volume = {6}, number = {1}, number2 = {19SIP05: TTPWC: Technology Transfer of Photonic Waveguide Characterisation}, pages = {6:037}, keywords = {Optical metrology, EOCB, Optical interconnect}, web_url = {https://vibgyorpublishers.org/content/ijope/ijope-6-037.pdf}, misc2 = {EMPIR 2019: Support for Impact}, publisher = {VIBGYOR ePress}, language = {30}, ISSN = {2631-5092}, DOI = {10.35840/2631-5092/4537}, stag_bib_extends_levelofaccess = {NA}, author = {Robert, F. and Irshaad, F. and Ka-ming, L.} } @Article { HutzschenreuterMLK2021, subid = {2415}, title = {Validation of SI-based digital data of measurement the TraCIM system}, journal = {Journal of Sensors and Sensor Systems}, year = {2021}, month = {12}, day = {13}, volume = {10}, number = {2}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, pages = {289-295}, keywords = {Digital Transformation, TraCIM, XML, D-SI, Online Validation}, misc2 = {EMPIR 2017: Industry}, language = {30}, DOI = {10.5194/jsss-10-289-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Hutzschenreuter, D. and Muller, B. and Loewe, J.H. and Klobucar, R.} } @Article { KayserOHB2021, subid = {2485}, title = {Reliable compositional analysis of airborne particulate matter beyond the quantification limits of total reflection X-ray fluorescence.}, journal = {Analytica Chimica Acta}, year = {2021}, month = {12}, day = {12}, volume = {1192}, number = {1}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {339367}, keywords = {Total reflection X-ray fluorescence, Grazing incidence X-ray fluorescence, Aerosols, Airborne particulate matter, Air pollution, Cascade impactors}, web_url = {https://www.sciencedirect.com/journal/analytica-chimica-acta\&\#10;http://www.aerometprojectii.com/}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier B.V.}, language = {30}, ISSN = {0003-2670}, DOI = {10.1016/j.aca.2021.339367}, stag_bib_extends_levelofaccess = {NA}, author = {Kayser, Y. and Os{\'a}n, J. and Honicke, P. and Beckhoff, B.} } @Article { SudTSBSDSSWZZRCKKC2021, subid = {2383}, title = {Tailoring interfacial effect in multilayers with Dzyaloshinskii–Moriya interaction by helium ion irradiation}, journal = {Scientific Reports}, year = {2021}, month = {12}, volume = {11}, number = {23626}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {Spintronics, Nano magnetism, Magnetic skyrmions, Dzyaloshinskii–Moriya interaction}, web_url = {https://www.nature.com/articles/s41598-021-02902-y.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, DOI = {10.1038/s41598-021-02902-y}, stag_bib_extends_levelofaccess = {NA}, author = { Sud, A. and Tacchi, S. and Sagkovits, D. and Barton, C. and Sall, M. and Diez, L.H. and Stylianidis, E. and Smith, N. and Wright, L. and Zhang, S. and Zhang, X. and Ravelosona, D. and Carlotti, G. and Kurebayashi, H. and Kazakova, O. and Cubukcu, M. } } @Article { SanderK2021, subid = {2669}, title = {Comparison of force measuring devices with static and continuous loading}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services}, pages = {100241}, keywords = {Piezoelectric; Drift; Creep; Creep recovery; Continuous load; Hysteresis; Force transducer}, web_url = {https://www.sciencedirect.com/science/article/pii/S266591742100204X}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100241}, stag_bib_extends_levelofaccess = {NA}, author = {Sander, J. and Kumme, R.} } @Article { HirtCHRK2021, subid = {2505}, title = {Sample fabrication and metrological characterization of single-photon emitters based on nitrogen vacancy centers in nanodiamonds}, journal = {Engineering Research Express}, year = {2021}, month = {12}, volume = {3}, number = {4}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {045038}, keywords = {nitrogen vacancy center, nanodiamond, single-photon source, fabrication}, web_url = {https://iopscience.iop.org/article/10.1088/2631-8695/ac34c2}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2631-8695}, DOI = {10.1088/2631-8695/ac34c2}, stag_bib_extends_levelofaccess = {NA}, author = {Hirt, F. and Christinck, J. and Hofer, H. and Rodiek, B. and K{\"u}ck, S.} } @Article { Kuck2021, subid = {2507}, title = {Single photon sources for absolute radiometry – A review about the current state of the art}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {100219}, keywords = {single-photon source, quantum dots, molecules, NV-centre, quantum radiometry}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001823?via\%3Dihub}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100219}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S.} } @Article { SchmelterOKB2021, subid = {2196}, title = {Analysis of multiphase flow simulations and comparison with high-speed video observations}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {100154}, keywords = {Multiphase flowSlug flowPlug flowComputational fluid dynamics (CFD)High-speed video observationsLiquid level time series}, web_url = {https://doi.org/10.1016/j.measen.2021.100154}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100154}, stag_bib_extends_levelofaccess = {NA}, author = {Schmelter, S. and Olbrich, M. and Knotek, S. and B{\"a}r, M.} } @Article { LieberherrACCCGKMMMOSSTV2021, subid = {2368}, title = {Assessment of real-time bioaerosol particle counters using reference chamber experiments}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {12}, volume = {14}, number = {12}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {7693-7706}, keywords = {bioaerosol monitors, calibration, counting efficiency, fluorescence}, web_url = {https://amt.copernicus.org/articles/14/7693/2021/}, misc2 = {EMPIR 2019: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-7693-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Lieberherr, G. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Gysel-Beer, M. and Konzelmann, T. and Manzano, J. and Mihajlovic, A. and Moallemi, A. and O'Connor, D. and Sikoparija, B. and Sauvageat , E. and Tummon, F. and Vasilatou, K.} } @Article { ZelenkaAHKPZM2021, subid = {2205}, title = {Why and how to improve the subdivision technique in mass metrology}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {19RPT02: RealMass: Improvement of the realisation of the mass scale}, pages = {100228}, keywords = {Mass scale, Weights, Kilogram, Multiples and submultiples, Subdivision, OIML R111}, misc2 = {EMPIR 2019: Research Potential}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100228}, stag_bib_extends_levelofaccess = {NA}, author = {Zelenka, Z. and Alisic, S. and Hanrahan, R. and Kolozinsky, I. and Popa, G. and Zůda, J. and Malengo, A.} } @Article { AssoulineJBWTJGKRPR2021, subid = {2371}, title = {Excitonic nature of magnons in a quantum Hall ferromagnet}, journal = {Nature Physics}, year = {2021}, month = {12}, volume = {17}, number = {12}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {1369-1374}, keywords = {Graphene, mangons, interferometry, p-n-junction}, web_url = {https://arxiv.org/abs/2102.02068}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-021-01411-z}, stag_bib_extends_levelofaccess = {NA}, author = {Assouline, A. and Jo, M. and Brasseur, P. and Watanabe, K. and Taniguchi, T. and Jolicoeur, Th. and Glattli, D.C. and Kumada, N. and Roche, P. and Parmentier, F.D. and Roulleau, P.} } @Article { GrahamTKBBNBOZZ2021, subid = {2275}, title = {Ultra-low flow rate measurement techniques}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {100279}, keywords = {Flow metrologyDrug deliveryCalibrationUncertaintyNanoflow}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100279}, stag_bib_extends_levelofaccess = {NA}, author = {Graham, E. and Thiemann, K. and Kartmann, S. and Batista, E. and Bissig, H. and Niemann, A. and Boudaoud, A.W. and Ogheard, F. and Zhang, Y. and Zagnoni, M.} } @Article { MertesKHKSWRRWW2021, subid = {2423}, title = {Ion implantation of 226Ra for a primary 222Rn emanation standard}, journal = {Applied Radiation and Isotopes}, year = {2021}, month = {12}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {Ion implantation222Rn emanationLaser ionizationDefined solid-angle alpha-particle spectrometry}, misc2 = {EMPIR 2019: Environment}, language = {30}, DOI = {10.1016/j.apradiso.2021.110093}, stag_bib_extends_levelofaccess = {NA}, author = {Mertes, F. and Kneip, N. and Heinke, R. and Kieck, T. and Studer, D. and Weber, F. and R{\"o}ttger, S. and R{\"o}ttger, A. and Wendt, K. and Walther, C.} } @Article { OgrincRDBMBKOAGQMUOG2021, subid = {2701}, title = {Support for a European metrology network on food safety Food-MetNet}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {20NET02: Food-MetNet: Support for a European Metrology Network on Food Safety}, pages = {100285}, keywords = {Food; Metrology; Network; Safety; Stakeholders}, misc2 = {EMPIR 2020: Support for Networks}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100285}, stag_bib_extends_levelofaccess = {NA}, author = {Ogrinc, N. and Rossi, A.M. and Durbiano, F. and Becker, R. and Milavec, M. and Bogožalec Košir, A. and Kakoulides, E. and Ozer, H. and Ak\c{c}adag, F. and Goenaga-Infante, H. and Quaglia, M. and Mallia, S. and Umbricht, G. and O'Connor, G. and Guettler, B.} } @Article { KoybasiNTPRPBMSKGOIG2021, subid = {2601}, title = {High Performance Predictable Quantum Efficient Detector Based on Induced-Junction Photodiodes Passivated with SiO2/SiNx}, journal = {Sensors}, year = {2021}, month = {11}, day = {24}, volume = {21}, number = {23}, number2 = {18SIB10: chipS·CALe: Self-calibrating photodiodes for the radiometric linkage to fundamental constants}, pages = {7807}, keywords = {silicon photodetector; inversion layer photodiode; induced-junction; surface passivation;PECVD silicon nitride; radiometry; optical power; primary standard; predictable quantum efficiency}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21237807}, stag_bib_extends_levelofaccess = {NA}, author = {Koybasi, O. and Nordseth, {\O}. and Tran, T. and Povoli, M. and Rajteri, M. and Pepe, C. and Bardalen, E. and Manoocheri, F. and Summanwar, A. and Korpusenko, M. and Getz, M.N. and Ohlckers, P. and Ikonen, E. and Gran, J.} } @Article { NugrohoHPRYIKPWS2021, subid = {2473}, title = {Vertically Aligned n-Type Silicon Nanowire Array as a Free-Standing Anode for Lithium-Ion Batteries}, journal = {Nanomaterials}, year = {2021}, month = {11}, day = {20}, volume = {11}, number = {11}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {3137}, keywords = {silicon nanowire, nanowire array, silicon anode, n-type silicon anode, Li-ion battery}, misc2 = {EMPIR 2019: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11113137}, stag_bib_extends_levelofaccess = {NA}, author = {Nugroho, A.P. and Hawari, N.H. and Prakoso, B. and Refino, A.D. and Yulianto, N. and Iskandar, F. and Kartini, E. and Peiner, E. and Wasisto, H.S. and Sumboja, A.} } @Article { HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021, subid = {2336}, title = {Frequency drift in MR spectroscopy at 3T}, journal = {NeuroImage}, year = {2021}, month = {11}, volume = {241}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {118430}, keywords = {Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2021.118430}, stag_bib_extends_levelofaccess = {NA}, author = {Hui, S.C.N. and Mikkelsen, M. and Z{\"o}llner, H.J. and Ahluwalia, V. and Alcauter, S. and Baltusis, L. and Barany, D.A. and Barlow, L.R. and Becker, R. and Berman, J.I. and Berrington, A. and Bhattacharyya, P.K. and Blicher, J.U. and Bogner, W. and Brown, M.S. and Calhoun, V.D. and Castillo, R. and Cecil, K.M. and Choi, Y.B. and Chu, W.C.W. and Clarke, W.T. and Craven, A.R. and Cuypers, K. and Dacko, M. and de la Fuente-Sandoval, C. and Desmond, P. and Domagalik, A. and Dumont, J. and Duncan, N.W. and Dydak, U. and Dyke, K. and Edmondson, D.A. and Ende, G. and Ersland, L. and Evans, C.J. and Fermin, A.S.R. and Ferretti, A. and Fillmer, A. and Gong, T. and Greenhouse, I. and Grist, J.T. and Gu, M. and Harris, A.D. and Hat, K. and Heba, S. and Heckova, E. and Hegarty, J.P. and Heise, K-F. and Honda, S. and Jacobson, A. and Jansen, J.F.A. and Jenkins, C.W. and Johnston, S.J. and Juchem, C. and Kangarlu, A. and Kerr, A.B. and Landheer, K. and Lange, T. and Lee, P. and Levendovszky, S.R. and Limperopoulos, C. and Liu, F. and Lloyd, W. and Lythgoe, D.J. and Machizawa, M.G. and MacMillan, E.L. and Maddock, R.J. and Manzhurtsev, A.V. and Martinez-Gudino, M.L. and Miller, J.J. and Mirzakhanian, H. and Moreno-Ortega, M. and Mullins, P.G. and Nakajima, S. and Near, J. and Noeske, R. and Nordh{\o}y, W. and Oeltzschner, G. and Osorio-Duran, R. and Otaduy, M.C.G. and Pasaye, E.H. and Peeters, R. and Peltier, S.J. and Pilatus, U. and Polomac, N. and Porges, E.C. and Pradhan, S. and Prisciandaro, J.J. and Puts, N.A. and Rae, C.D. and Reyes-Madrigal, F. and Roberts, T.P.L. and Robertson, C.E. and Rosenberg, J.T. and Rotaru, D-G. and O'Gorman Tuura, R.L. and Saleh, M.G. and Sandberg, K. and Sangill, R. and Schembri, K. and Schrantee, A. and Semenova, N.A. and Singel, D. and Sitnikov, R. and Smith, J. and Song, Y. and Stark, C. and Stoffers, D. and Swinnen, S.P. and Tain, R. and Tanase, C. and Tapper, S. and Tegenthoff, M. and Thiel, T. and Thioux, M. and Truong, P. and van Dijk, P. and Vella, N. and Vidyasagar, R. and Vovk, A. and Wang, G. and Westlye, L.T. and Wilbur, T.K. and Willoughby, W.R. and Wilson, M. and Wittsack, H-J. and Woods, A.J. and Wu, Y-C. and Xu, J. and Lopez, M.Y. and Yeung, D.K.W. and Zhao, Q. and Zhou, X. and Zupan, G. and Edden, R.A.E.} } @Article { DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021, subid = {2365}, title = {A Comprehensive Description of Multi-Term LSM for Applying Multiple a Priori Constraints in Problems of Atmospheric Remote Sensing: GRASP Algorithm, Concept, and Applications}, journal = {Frontiers in Remote Sensing}, year = {2021}, month = {10}, day = {19}, volume = {2}, number2 = {19ENV04: MAPP: Metrology for aerosol optical properties}, keywords = {GRASP, Radiative Transfer, Inversion model}, web_url = {https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full}, misc2 = {EMPIR 2019: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-6187}, DOI = {10.3389/frsen.2021.706851}, stag_bib_extends_levelofaccess = {NA}, author = {Dubovik, O. and Fuertes, D. and Litvinov, P. and Lopatin, A. and Lapyonok, T. and Doubovik, I. and Xu, F. and Ducos, F. and Chen, C. and Torres, B. and Derimian, Y. and Li, L. and Herreras-Giralda, M. and Herrera, M. and Karol, Y. and Matar, C. and Schuster, G.L. and Espinosa, R. and Puthukkudy, A. and Li, Z. and Fischer, J. and Preusker, R. and Cuesta, J. and Kreuter, A. and Cede, A. and Aspetsberger, M. and Marth, D. and Bindreiter, L. and Hangler, A. and Lanzinger, V. and Holter, C. and Federspiel, C.} } @Article { SteindlSABK2021, subid = {2345}, title = {On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001)}, journal = {New Journal of Physics}, year = {2021}, month = {10}, volume = {23}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {103029}, keywords = {Quantum Dots, carrier dynamics, optical spectroscopy, memory devices}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac2bd6}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { VidakoviKochMiCKP2021, subid = {2305}, title = {Nonlinear frequency response analysis: a recent review and perspectives}, journal = {Current Opinion in Electrochemistry}, year = {2021}, month = {10}, number2 = {17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications}, pages = {100851}, keywords = {Harmonic analysis, Diagnosis, Kinetics, MModel discrimination, Battery}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {2451-9103}, DOI = {10.1016/j.coelec.2021.100851}, stag_bib_extends_levelofaccess = {NA}, author = {Vidaković-Koch, T. and Miličić, T. and Živković, L.A. and Chan, H.S. and Krewer, U. and Petkovska, M.} } @Article { RefinoYSNHSKIVSPW2021, subid = {2474}, title = {Versatilely tuned vertical silicon nanowire arrays by cryogenic reactive ion etching as a lithium-ion battery anode}, journal = {Scientific Reports}, year = {2021}, month = {10}, volume = {11}, number = {1}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, keywords = {high-aspect-ratio silicon (Si), nanowire array, lithium ion batteries, ICP-RIE}, web_url = {https://www.nature.com/articles/s41598-021-99173-4}, misc2 = {EMPIR 2019: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-99173-4}, stag_bib_extends_levelofaccess = {NA}, author = {Refino, A.D. and Yulianto, N. and Syamsu, I. and Nugroho, A.P. and Hawari, N.H. and Syring, A. and Kartini, E. and Iskandar, F. and Voss, T. and Sumboja, A. and Peiner, E. and Wasisto, H.S.} } @Article { KnotekSO2021, subid = {2193}, title = {Assessment of different parameters used in mesh independence studies in two-phase slug flow simulations}, journal = {Measurement: Sensors}, year = {2021}, month = {9}, day = {29}, volume = {18}, number = {2021}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {100317}, keywords = {Multiphase flow, Slug flow, Computational fluid dynamics (CFD), Mesh study, Grid refinement}, web_url = {https://doi.org/10.1016/j.measen.2021.100317}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100317}, stag_bib_extends_levelofaccess = {NA}, author = {Knotek, S. and Schmelter, S. and Olbrich, M.} } @Article { BukerSKBPS2021, subid = {2207}, title = {Investigations on the Influence of Total Water Hardness and pH Value on the Measurement Accuracy of Domestic Cold Water Meters}, journal = {MDPI Water}, year = {2021}, month = {9}, day = {29}, volume = {13}, number = {19}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {domestic water meters; total hardness; pH value; wear test; flow measurement}, misc2 = {EMPIR 2017: Industry}, language = {30}, DOI = {10.3390/w13192701}, stag_bib_extends_levelofaccess = {NA}, author = {B{\"u}ker, O. and Stolt, K. and Kroner, C. and Benkova, M. and Pavlas, J. and Seypka, V.} } @Proceedings { WeidingerDLYKZEMZ2021, subid = {2253}, title = {Need for a traceable efficiency determination method of nacelles performed on test benches}, journal = {Measurement: Sensors}, year = {2021}, month = {9}, day = {23}, volume = {18}, number2 = {19ENG08: WindEFCY: Traceable mechanical and electrical power measurement for efficiency determination of wind turbines}, pages = {100159}, keywords = {nacelle test bench, wind turbine power curves, direct efficiency determination, mechanical power measurement, electrical power measurement}, misc2 = {EMPIR 2019: Engergy}, publisher = {Elsevier BV}, event_place = {Yokohama, JAPAN}, event_name = {XXIII IMEKO World Congress}, event_date = {30-08-2021 to 03-09-2021}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100159}, stag_bib_extends_levelofaccess = {NA}, author = {Weidinger, P. and Dubowik, A. and Lehrmann, C. and Yogal, N. and Kumme, R. and Zweiffel, M. and Eich, N. and Mester, C. and Zhang, H.} } @Article { RottgerRGVCOHCCBIRKCAYFMM2021, subid = {2224}, title = {New metrology for radon at the environmental level}, journal = {Measurement Science and Technology}, year = {2021}, month = {9}, day = {23}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {radon, metrology, tracer, environmental measurements}, misc2 = {EMPIR 2019: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac298d}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and R{\"o}ttger, S. and Grossi, C. and Vargas, A. and Curcoll, R. and Ot{\'a}hal, P. and Hern{\'a}ndez-Ceballos, M.{\'A}. and Cinelli, G. and Chambers, S. and Barbosa, S.A. and Ioan, M-R. and Radulescu, I. and Kikaj, D. and Chung, E. and Arnold, T. and Yver Kwok, C. and Fuente, M. and Mertes, F. and Morosh, V.} } @Proceedings { SongWEZYK2021, subid = {2252}, title = {10 MW mechanical power transfer standard for nacelle test benches using a torque transducer and an inclinometer}, journal = {Measurement: Sensors}, year = {2021}, month = {9}, day = {22}, volume = {18}, number2 = {19ENG08: WindEFCY: Traceable mechanical and electrical power measurement for efficiency determination of wind turbines}, pages = {100249}, keywords = {nacelle test bench, wind turbine, inclinometer, rotational speed measurement, mechanical power measurement}, misc2 = {EMPIR 2019: Engergy}, publisher = {Elsevier BV}, event_place = {Yokohama, JAPAN}, event_name = {XXIII IMEKO World Congress}, event_date = {30-08-2021 to 03-09-2021}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100249}, stag_bib_extends_levelofaccess = {NA}, author = {Song, Z. and Weidinger, P. and Eich, N. and Zhang, H. and Yogal, N. and Kumme, R.} } @Article { GroscheKBK2021, subid = {2176}, title = {Validating frequency transfer via interferometric fiber links for optical clock comparisons}, journal = {New Journal of Physics}, year = {2021}, month = {9}, day = {20}, volume = {23}, number = {9}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {093024}, keywords = {optical frequency dissemination, optical fiber links, optical clocks, optical clock comparisons, ultra-stable lasers}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ac21a0}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac21a0}, stag_bib_extends_levelofaccess = {NA}, author = {Grosche, G. and Kuhl, A. and Benkler, E. and Koke, S.} } @Article { GroscheKBK20210, subid = {2176}, title = {Validating frequency transfer via interferometric fiber links for optical clock comparisons}, journal = {New Journal of Physics}, year = {2021}, month = {9}, day = {20}, volume = {23}, number = {9}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {093024}, keywords = {optical frequency dissemination, optical fiber links, optical clocks, optical clock comparisons, ultra-stable lasers}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ac21a0}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac21a0}, stag_bib_extends_levelofaccess = {NA}, author = {Grosche, G. and Kuhl, A. and Benkler, E. and Koke, S.} } @Article { YaoMGZKK2021, subid = {2189}, title = {Induced radiofrequency fields in patients undergoing MR examinations: insights for risk assessment}, journal = {Physics in Medicine \& Biology}, year = {2021}, month = {9}, day = {15}, volume = {66}, number = {18}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {185014}, keywords = {MR safety, electromagnetic modelling, specific power absorption}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac212d}, stag_bib_extends_levelofaccess = {NA}, author = {Yao, A. and Murbach, M. and Goren, T. and Zastrow, E. and Kainz, W. and Kuster, N.} } @Article { BuonacorsiSSTKHHRWB2021, subid = {2168}, title = {Non-adiabatic single-electron pumps in a dopant-free GaAs/AlGaAs 2DEG}, journal = {Applied Physics Letters}, year = {2021}, month = {9}, day = {13}, volume = {119}, number = {11}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {114001}, keywords = {Single electron transport, quantum dot, dopant-free GaAs/AlGaAs system, quantum transport, single electron pump}, web_url = {https://arxiv.org/abs/2102.13320}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0062486}, stag_bib_extends_levelofaccess = {NA}, author = {Buonacorsi, B. and Sfigakis, F. and Shetty, A. and Tam, M.C. and Kim, H.S. and Harrigan, S.R. and Hohls, F. and Reimer, M.E. and Wasilewski, Z.R. and Baugh, J.} } @Article { YamakawaATBFBKRD2021, subid = {2038}, title = {Hg isotopic composition of one-year-old spruce shoots: Application to long-term Hg atmospheric monitoring in Germany}, journal = {Chemosphere}, year = {2021}, month = {9}, volume = {279}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {130631}, keywords = {Hg isotopic composition, spruce shoots, Hg atmospheric monitoring}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0045-6535}, DOI = {10.1016/j.chemosphere.2021.130631}, stag_bib_extends_levelofaccess = {NA}, author = {Yamakawa, A. and Amouroux, D. and Tessier, E. and B{\'e}rail, S. and Fettig, I. and Barre, J.P.G. and Koschorreck, J. and R{\"u}del, H. and Donard, O.F.X.} } @Article { VasilatouWKHISSSWA2021, subid = {2082}, title = {Calibration of optical particle size spectrometers against a primary standard: Counting efficiency profile of the TSI Model 3330 OPS and Grimm 11-D monitor in the particle size range from 300 nm to 10 \(\mu\)m}, journal = {Journal of Aerosol Science}, year = {2021}, month = {9}, volume = {157}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {105818}, keywords = {calibration, aerosol spectrometers, PSL particles, primary standard, particle number concentration}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2021.105818}, stag_bib_extends_levelofaccess = {NA}, author = {Vasilatou, K. and W{\"a}lchli, C. and Koust, S. and Horender, S. and Iida, K. and Sakurai, H. and Schneider, F. and Spielvogel, J. and Wu, T.Y. and Auderset, K.} } @Article { EssBKGV2021, subid = {2081}, title = {Coated soot particles with tunable, well-controlled properties generated in the laboratory with a miniCAST BC and a micro smog chamber}, journal = {Journal of Aerosol Science}, year = {2021}, month = {9}, volume = {157}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, pages = {105820}, keywords = {soot, aerosol, secondary organic matter, calibration, black carbon, absorption photometers}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2021.105820}, stag_bib_extends_levelofaccess = {NA}, author = {Ess, M.N. and Bert{\`o}, M. and Keller, A. and Gysel-Beer, M. and Vasilatou, K.} } @Article { EisermannKWR2021, subid = {2243}, title = {Photonic contact thermometry using silicon ring resonators and tuneable laser-based spectroscopy}, journal = {tm - Technisches Messen}, year = {2021}, month = {9}, volume = {88}, number = {10}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {640-654}, keywords = {Thermometry; photonic; temperature sensor; optical ring resonator}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2196-7113, 0171-8096}, DOI = {10.1515/teme-2021-0054}, stag_bib_extends_levelofaccess = {NA}, author = {Eisermann, R. and Krenek, S. and Winzer, G. and Rudtsch, S.} } @Article { SmithHKWPSDS2021, subid = {2242}, title = {High precision integrated photonic thermometry enabled by a transfer printed diamond resonator on GaN waveguide chip}, journal = {Optics Express}, year = {2021}, month = {8}, day = {25}, volume = {29}, number = {18}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {29095}, keywords = {photonic thermometer, diamond micro-disk resonator}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.433607}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, J.A. and Hill, P. and Klitis, C. and Weituschat, L. and Postigo, P.A. and Sorel, M. and Dawson, M.D. and Strain, M.J.} } @Article { SteinKP2021, subid = {2160}, title = {A Unified Theory for 3D Gear and Thread Metrology}, journal = {Applied Sciences}, year = {2021}, month = {8}, day = {19}, volume = {11}, number = {16}, number2 = {19ENG07: Met4Wind: Metrology for enhanced reliability and efficiency of wind energy systems}, pages = {7611}, keywords = {coordinate metrology, gear metrology, thread metrology, helical machine elements, holistic evaluation, areal measurements}, misc2 = {EMPIR 2019: Engergy}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11167611}, stag_bib_extends_levelofaccess = {NA}, author = {Stein, M. and Keller, F. and Przyklenk, A.} } @Article { CorcolesYK2021, subid = {2190}, title = {Experimental and numerical optimization modelling to reduce radiofrequency-induced risks of magnetic resonance examinations on leaded implants}, journal = {Applied Mathematical Modelling}, year = {2021}, month = {8}, volume = {96}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {177-188}, keywords = {MR safety, implant safety, RF induced heating}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0307-904X}, DOI = {10.1016/j.apm.2021.02.036}, stag_bib_extends_levelofaccess = {NA}, author = {C{\'o}rcoles, J. and Yao, A. and Kuster, N.} } @Article { FuchsJKMB2021, subid = {2508}, title = {A cavity-based optical antenna for color centers in diamond}, journal = {APL Photonics}, year = {2021}, month = {8}, volume = {6}, number = {8}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {086102}, keywords = {color centres, diamond, optical antenna, single-photon source}, web_url = {https://aip.scitation.org/doi/10.1063/5.0057161}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {2378-0967}, DOI = {10.1063/5.0057161}, stag_bib_extends_levelofaccess = {NA}, author = {Fuchs, P. and Jung, T. and Kieschnick, M. and Meijer, J. and Becher, C.} } @Article { KneeviMBBIKMNNWi2021, subid = {2111}, title = {Investigations into the basic properties of different passive dosimetry systems used in environmental radiation monitoring in the aftermath of a nuclear or radiological event}, journal = {Radiation Measurements}, year = {2021}, month = {8}, volume = {146}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106615}, keywords = {Passive dosimetry systems, Environmental radiation monitoring, Nuclear or radiological event}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106615}, stag_bib_extends_levelofaccess = {NA}, author = {Knežević, Ž. and Majer, M. and Baranowska, Z. and Bjelac, O.C. and Iurlaro, G. and Kržanović, N. and Mariotti, F. and Nodilo, M. and Neumaier, S. and Wołoszczuk, K. and Živanović, M.} } @Article { ViereckKNP2021, subid = {2418}, title = {MEMS-Based Cantilever Sensor for Simultaneous Measurement of Mass and Magnetic Moment of Magnetic Particles}, journal = {Chemosensors 2021}, year = {2021}, month = {8}, volume = {9}, number = {207}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {cantilever, resonant frequency, mass, magnetic moment, magnetic force gradient, magneticparticles}, web_url = {https://www.mdpi.com/2227-9040/9/8/207}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI}, language = {30}, DOI = {10.3390/chemosensors9080207}, stag_bib_extends_levelofaccess = {NA}, author = {Viereck, T. and Kahmann, T. and Nyang’au, W.O. and Peiner, E.} } @Article { BarrattRCSKE2021, subid = {2167}, title = {Asymmetric arms maximize visibility in hot-electron interferometers}, journal = {Physical Review B}, year = {2021}, month = {7}, day = {30}, volume = {104}, number = {3}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {035436}, keywords = {single electrons, electron interferometry, quantum transport, electron quantum optics}, web_url = {https://arxiv.org/abs/2104.01653}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.104.035436}, stag_bib_extends_levelofaccess = {NA}, author = {Barratt, C.J. and Ryu, S. and Clark, L.A. and Sim, H.-S. and Kataoka, M. and Emary, C.} } @Article { RadtkeCKLSDAHNVRQLDBUL2021, subid = {2285}, title = {A unified pH scale for all solvents: part I – intention and reasoning (IUPAC Technical Report)}, journal = {Pure and Applied Chemistry}, year = {2021}, month = {7}, day = {30}, volume = {93}, number = {9}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1049-1060}, keywords = {Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {0033-4545, 1365-3075}, DOI = {10.1515/pac-2019-0504}, stag_bib_extends_levelofaccess = {NA}, author = {Radtke, V. and Cam{\~o}es, F. and Krossing, I. and Leito, I. and Stoica, D. and Deleebeeck, L. and Anes, B. and Heering, A. and N{\"a}ykki, T. and Veltz{\'e}, S. and Rozikov{\'a}, M. and Quendera, R. and Liv, L. and D{\'a}niel, N. and Bastkowski, F. and Uysal, E. and Lawrence, N.} } @Article { SilvaniKTC2021, subid = {2426}, title = {Impact of the interfacial Dzyaloshinskii-Moriya interaction on the band structure of one-dimensional artificial magnonic crystals: a micromagnetic study}, journal = {Journal of Magnetism and magnetic Materials}, year = {2021}, month = {7}, day = {27}, volume = {539}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {168342}, keywords = {Magnonic Crystals, spin waves, DMI}, web_url = {https://doi.org/10.1016/j.jmmm.2021.168342}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier}, language = {30}, ISSN = {0304-8853}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2112.05360}, author = {Silvani, R. and Kuepferling, M. and Tacchi, S. and Carlotti, G.} } @Article { TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021, subid = {2260}, title = {A multicentre and multi-national evaluation of the accuracy of quantitative Lu-177 SPECT/CT imaging performed within the MRTDosimetry project}, journal = {EJNMMI Physics}, year = {2021}, month = {7}, day = {23}, volume = {8}, number = {1}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, keywords = {Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2197-7364}, DOI = {10.1186/s40658-021-00397-0}, stag_bib_extends_levelofaccess = {NA}, author = {Tran-Gia, J. and Denis-Bacelar, A.M. and Ferreira, K.M. and Robinson, A.P. and Calvert, N. and Fenwick, A.J. and Finocchiaro, D. and Fioroni, F. and Grassi, E. and Heetun, W. and Jewitt, S.J. and Kotzassarlidou, M. and Ljungberg, M. and McGowan, D.R. and Scott, N. and Scuffham, J. and Gleisner, K.S. and Tipping, J. and Wevrett, J. and Bardi{\`e}s, M. and Berenato, S. and Bilas, I. and Bobin, C. and Capogni, M. and Chauvin, M. and COLLINS, S. and Cox, M. and Dabin, J. and D’Arienzo, M. and Gustafsson, J. and Hallam, A. and Kalathas, T. and Kayal, G. and Lorusso, G. and Maringer, F-J. and Morgan, D. and Smyth, V. and Solc, J. and Štemberkov{\'a}, L. and Struelens, L. and Vergara-Gil, A. and Wiedner, H. and Lassmann, M.} } @Article { NissilaFKMIJBKKOBMGK2021, subid = {2138}, title = {Driving a low critical current Josephson junction array with a mode-locked laser}, journal = {Applied Physics Letters}, year = {2021}, month = {7}, day = {19}, volume = {119}, number = {3}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {032601}, keywords = {Josephson voltage standard, Josephson effect, Superconducting device, Laser, Photodiode}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0060804}, stag_bib_extends_levelofaccess = {NA}, author = {Nissil{\"a}, J. and Fordell, T. and Kohop{\"a}{\"a}, K. and Mykk{\"a}nen, E. and Immonen, P. and Jabdaraghi, R.N. and Bardalen, E. and Kieler, O. and Karlsen, B. and {\O}hlckers, P.A. and Behr, R. and Manninen, A.J. and Govenius, J. and Kemppinen, A.} } @Article { NeasK2021, subid = {2117}, title = {Synthetic Data in Quantitative Scanning Probe Microscopy}, journal = {Nanomaterials}, year = {2021}, month = {7}, volume = {11}, number = {7}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {1746}, keywords = {nanometrology; data synthesis; scanning probe microscopy}, web_url = {https://www.mdpi.com/2079-4991/11/7/1746}, misc2 = {EMPIR 2019: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11071746}, stag_bib_extends_levelofaccess = {NA}, author = {Nečas, D. and Klapetek, P.} } @Article { GeorgievaLHKKRRK2021, subid = {2504}, title = {Absolute calibration of a single-photon avalanche detector using a bright triggered single-photon source based on an InGaAs quantum dot}, journal = {Optics Express}, year = {2021}, month = {7}, volume = {29}, number = {15}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {23500}, keywords = {calibration, single-photon avalanche detector, triggered single-photon source, InGaAs quantum dot}, web_url = {https://opg.optica.org/oe/fulltext.cfm?uri=oe-29-15-23500\&id=453180}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.430680}, stag_bib_extends_levelofaccess = {NA}, author = {Georgieva, H. and L{\'o}pez, M. and Hofer, H. and Kanold, N. and Kaganskiy, A. and Rodt, S. and Reitzenstein, S. and K{\"u}ck, S.} } @Article { KruskopfBPCPREPPGS2021, subid = {2113}, title = {Graphene Quantum Hall Effect Devices for AC and DC Electrical Metrology}, journal = {IEEE Transactions on Electron Devices}, year = {2021}, month = {7}, volume = {68}, number = {7}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {3672-3677}, keywords = {Alternating current, dissipation factor,double-shield, epitaxial graphene, magnetocapacitance,magnetotransport, precision measurements, quantized Hallresistance (QHR) standards, quantum Hall effect (QHE),superconducting contacts}, web_url = {https://ieeexplore.ieee.org/document/9446081}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9383, 1557-9646}, DOI = {10.1109/TED.2021.3082809}, stag_bib_extends_levelofaccess = {NA}, author = {Kruskopf, M. and Bauer, S. and Pimsut, Y. and Chatterjee, A. and Patel, D.K. and Rigosi, A.F. and Elmquist, R.E. and Pierz, K. and Pesel, E. and G{\"o}tz, M. and Schurr, J.} } @Article { ZeliKG2021, subid = {2303}, title = {Derivation of Transmission Line Model from the Concentrated Solution Theory (CST) for Porous Electrodes}, journal = {Journal of The Electrochemical Society}, year = {2021}, month = {7}, volume = {168}, number = {7}, number2 = {17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications}, pages = {070543}, keywords = {transmission line model, concentrated solution theory, electrochemical cell, porous electrodes, batteries}, misc2 = {EMPIR 2017: Industry}, publisher = {The Electrochemical Society}, language = {30}, ISSN = {0013-4651, 1945-7111}, DOI = {10.1149/1945-7111/ac1314}, stag_bib_extends_levelofaccess = {NA}, author = {Zelič, K. and Katrašnik, T. and Gaberšček, M.} } @Article { MarzanoTDSEOPKC2021, subid = {2115}, title = {Design and development of a coaxial cryogenic probe for precision measurements of the quantum Hall effect in the AC regime}, journal = {ACTA IMEKO}, year = {2021}, month = {6}, day = {29}, volume = {10}, number = {2}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {24}, keywords = {Quantum Hall effect, Metrology, Impedance, Graphene, Cryogenic probe}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-10\%20\%282021\%29-02-05}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v10i2.925}, stag_bib_extends_levelofaccess = {NA}, author = {Marzano, M. and Tran, N.T.M. and D'Elia, V. and Serazio, D. and Enrico, E. and Ortolano, M. and Pierz, K. and Kucera, J. and Callegaro, L.} } @Proceedings { DickmannWEKPK2021, subid = {2279}, title = {Heat dynamics in optical ring resonators}, journal = {Modeling Aspects in Optical Metrology VIII}, year = {2021}, month = {6}, day = {20}, volume = {11783}, number = {1178309}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {1-12}, keywords = {optical ring resonators, heat equation, absorption, two-photon absorption, temperature sensing, thermalmodeling}, web_url = {https://www.spiedigitallibrary.org/conference-proceedings-of-spie}, misc2 = {EMPIR 2017: Fundamental}, publisher = {SPIE}, event_place = {on line}, event_name = {SPIE Optical Metrology, 2021}, event_date = {21-06-2021 to 25-06-2021}, language = {30}, DOI = {10.1117/12.2592552}, stag_bib_extends_levelofaccess = {NA}, author = {Dickmann, W. and Weituschat, L. and Eisermann, R. and Krenek, S. and Postigo, P.A. and Kroker, S.} } @Article { GajjelaHDSSKBMBK2021, subid = {2614}, title = {Structural and compositional analysis of (InGa)(AsSb)/GaAs/GaP Stranski–Krastanov quantum dots}, journal = {Light: Science \& Applications}, year = {2021}, month = {6}, day = {15}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {125}, keywords = {Ga)(AsSb)/GaAs/GaP, Stranski–Krastanov, quantum dots}, web_url = {https://www.nature.com/articles/s41377-021-00564-z}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/s41377-021-00564-z}, stag_bib_extends_levelofaccess = {NA}, author = {Gajjela, R.S.R. and Hendriks, A.L. and Douglas, J.O. and Sala, E.M. and Steindl, P. and Klenovsk{\'y}, P. and Bagot, P.A.J. and Moody, M.P. and Bimberg, D. and Koenraad, P.M.} } @Proceedings { SchodelKMTHWSPP2021, subid = {2106}, title = {Design and manufacture of a reference interferometer for long-range distance metrology}, journal = {Proceedings of the euspen 21st International Conference \& Exhibition}, year = {2021}, month = {6}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {511-512}, keywords = {Geodetic length instrumentation, closed-frame design, thermal and long-term stability, manual positioning system, precision assembly}, misc2 = {EMPIR 2018: SI Broader Scope}, event_place = {Copenhagen, DK}, event_name = {euspen 21st International Conference \& Exhibition}, event_date = {07-06-2021 to 11-06-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE21222.pdf}, author = {Sch{\"o}del, R. and K{\"o}chert, P. and Meyer, T. and Truong, D. and Huismann, J. and Weinrich, S. and Schmaljohann, F. and Pilarski, F. and Pollinger, F.} } @Article { BircherNKM2021, subid = {2411}, title = {Measurement of temperature induced X-ray tube transmission target displacements for dimensional computed tomography}, journal = {Precision Engineering}, year = {2021}, month = {6}, volume = {72}, number = {2021}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {409-416}, keywords = {X-ray tube, Transmission target, Thermal stability, Focal spot, Finite element simulation, Dimensional metrology, X-ray computed tomography}, web_url = {https://www.sciencedirect.com/science/article/pii/S0141635921001574?via\%3Dihub}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2021.06.002}, stag_bib_extends_levelofaccess = {NA}, author = {Bircher, B. and Neuhaus, S. and K{\"u}ng, A. and Meli, F.} } @Article { KnotekBCKHUKS2021, subid = {2369}, title = {Measurements of water consumption for the development of new test regimes for domestic water meters}, journal = {Flow Measurement and Instrumentation}, year = {2021}, month = {6}, volume = {79}, number = {-}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, pages = {101963}, keywords = {water consumption, consumption measurement, water meters, dynamic loads, billing}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2021.101963}, stag_bib_extends_levelofaccess = {NA}, author = {Knotek, S. and Benkova, M. and Christophersen, N. and Kondrup, J.B. and Haack, S. and Unsal, B. and Kroner, C. and Schumann, D.} } @Article { KusterYGKS2021, subid = {2191}, title = {Radiofrequency‐induced heating of broken and abandoned implant leads during magnetic resonance examinations}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {6}, volume = {86}, number = {4}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {2156-2164}, keywords = {magnetic resonance imaging, MR safety, implant safety, abandoned leads}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28836}, stag_bib_extends_levelofaccess = {NA}, author = {Kuster, N. and Yao, A. and Goren, T. and Kainz, W. and Samaras, T.} } @Article { KhamlichiGOAR2021, subid = {2488}, title = {Error in the measurement of partial discharge pulses according to the frequency response of HFCT sensors}, journal = {2021 IEEE Electrical Insulation Conference (EIC)}, year = {2021}, month = {6}, volume = {.}, number = {.}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {.}, keywords = {sensor phenomena and characterization, performance evaluation, partial discharges, insulation testing,condition monitoring}, web_url = {https://zenodo.org/record/5906679}, misc2 = {EMPIR 2019: Energy}, publisher = {IEEE}, language = {30}, ISSN = {2576-6791}, DOI = {10.1109/EIC49891.2021.9612353}, stag_bib_extends_levelofaccess = {NA}, author = {Khamlichi, A. and Garnacho, F. and Ortego, J. and Alvarez, F. and Rovira, J.} } @Article { LanzaMCCSDGNKRCMBP2021, subid = {2392}, title = {Calibration of non-catching precipitation measurement instruments: A review}, journal = {Meteorological Applications}, year = {2021}, month = {5}, day = {25}, volume = {28}, number = {3}, number2 = {18NRM03: INCIPIT: Calibration and accuracy of non-catching instruments to measure liquid/solid atmospheric precipitation}, pages = {e2002}, keywords = {calibration, hydro-meteorology, meteomet, non-catching gauges, precipitation, precipitation measurement and analysis, uncertainty analysis, verification}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/met.2002}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {RMets}, language = {30}, ISSN = {14698080}, DOI = {10.1002/met.2002}, stag_bib_extends_levelofaccess = {NA}, author = {Lanza, L.G. and Merlone, A. and Cauteruccio, A. and Chinchella, E. and Stagnaro, M. and Dobre, M. and Garcia Izquierdo, M.C. and Nielsen, J. and Kjeldsen, H. and Roulet, Y.A. and Coppa, G. and Musacchio, C. and Bordianu, C. and Parrondo, M.} } @Article { GolokolenovGKPT2021, subid = {2051}, title = {On the origin of the controversial electrostatic field effect in superconductors}, journal = {Nature Communications}, year = {2021}, month = {5}, day = {12}, volume = {12}, number = {1}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, keywords = {superconducting devices, superconductor electronics, electrostatic field effect}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-021-22998-0}, stag_bib_extends_levelofaccess = {NA}, author = {Golokolenov, I. and Guthrie, A. and Kafanov, S. and Pashkin, Y.A. and Tsepelin, V.} } @Article { ManskePKRP2021, subid = {2044}, title = {Monte-Carlo Analysis of Challenges and Limitations of Dispersion-based Optical Thermometry}, journal = {SMSI 2021 - Sensors and Instrumentation}, year = {2021}, month = {5}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {203-204}, keywords = {dispersive thermometry, measurement uncertainty modelling, multi-wavelength interferometry, Monte-Carlo Simulation}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {AMA Service GmbH, Von-M{\"u}nchhausen-Str. 49, 31515 Wunstorf, Germany}, language = {30}, DOI = {10.5162/SMSI2021/C4.4}, stag_bib_extends_levelofaccess = {NA}, author = {Manske, E. and Prellinger, G. and K{\"o}chert, P. and Rose, A. and Pollinger, F.} } @Article { KlapetekGNVSN2021, subid = {2318}, title = {GSvit — An open source FDTD solver for realistic nanoscale optics simulations}, journal = {Computer Physics Communications}, year = {2021}, month = {5}, volume = {265}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {108025}, keywords = {FDTD, Plasmonics, Optics, Roughness}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0010-4655}, DOI = {10.1016/j.cpc.2021.108025}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P. and Grolich, P. and Nezval, D. and Valtr, M. and Šlesinger, R. and Nečas, D.} } @Article { KazemipourHWHRSAGZ2021, subid = {2048}, title = {Standard Load Method: A New Calibration Technique for Material Characterization at Terahertz Frequencies}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, month = {5}, volume = {70}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1007310}, keywords = {Material characterization, measurement uncertainty, parameter extraction, standard load, vector network analyzer (VNA) time gating}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2021.3077660}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Hudlicka, M. and R{\"u}fenacht, J. and Stalder, D. and Allal, D. and G{\"a}umann, G. and Zeier, M.} } @Article { KalincevDKYFM2021, subid = {2476}, title = {Motional heating of spatially extended ion crystals}, journal = {Quantum Science and Technology}, year = {2021}, month = {5}, volume = {6}, number = {3}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {034003}, keywords = {multi-ion clocks, vibrational mode heating, ion Coulomb crystals, precision metrology, radio frequency noise}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2058-9565}, DOI = {10.1088/2058-9565/abee99}, stag_bib_extends_levelofaccess = {NA}, author = {Kalincev, D. and Dreissen, L.S. and Kulosa, A.P. and Yeh, C-H. and F{\"u}rst, H.A. and Mehlst{\"a}ubler, T.E.} } @Article { SiekkinenKKSFSTISTT2021, subid = {2109}, title = {Assessment of a digital and an analog PET/CT system for accurate myocardial perfusion imaging with a flow phantom}, journal = {Journal of Nuclear Cardiology}, year = {2021}, month = {5}, volume = {n/a}, number = {n/a}, number2 = {19SIP04: TracPETperf: Software for evaluating PET cardiac perfusion imaging uncertainties for more accurate diagnosis}, pages = {n/a}, keywords = {digital and analog PET/CT system, myocardial perfusion imaging, flow phantom}, misc2 = {EMPIR 2019: Support for Impact}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1071-3581, 1532-6551}, DOI = {10.1007/s12350-021-02631-9}, stag_bib_extends_levelofaccess = {NA}, author = {Siekkinen, R. and Kirjavainen, A.K. and Koskensalo, K. and Smith, N.A.S. and FENWICK, A. and Saunavaara, V. and Tolvanen, T. and Iida, H. and Saraste, A. and Ter{\"a}s, M. and Teuho, J.} } @Article { GeorgievaMRHGDGLK2021, subid = {2092}, title = {Detection of ultra-weak laser pulses by free-running single-photon detectors: Modeling dead time and dark counts effects}, journal = {Applied Physics Letters}, year = {2021}, month = {4}, day = {26}, volume = {118}, number = {17}, number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware}, pages = {174002}, keywords = {Quantum commutation, QKD, Non-Classical Light Emitters, Single-Photon Detectors, RadiometryMetrology for Quantum Technologies}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0046014}, stag_bib_extends_levelofaccess = {NA}, author = {Georgieva, H. and Meda, A. and Raupach, S.M.F. and Hofer, H. and Gramegna, M. and Degiovanni, I.P. and Genovese, M. and L{\'o}pez, M. and K{\"u}ck, S.} } @Article { GanikiRJKH2021, subid = {2034}, title = {Validating an Evaporative Calibrator for Gaseous Oxidized Mercury}, journal = {Sensors}, year = {2021}, month = {4}, volume = {21}, number = {7}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {2501}, keywords = {Gaseous oxidized mercury, calibration, traceability, 197-Hg}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21072501}, stag_bib_extends_levelofaccess = {NA}, author = {Gačnik, J. and Živković, I. and Ribeiro Guevara, S. and Jaćimović, R. and Kotnik, J. and Horvat, M.} } @Article { MoroshRNKiKPIMSBIKS2021, subid = {2017}, title = {Investigation into the performance of dose rate measurement instruments used in non-governmental networks}, journal = {Radiation Measurements}, year = {2021}, month = {4}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106580}, keywords = {Dosimetry networks.Dose rate meters.Environmental Radiation.Geiger counter.Metrological evaluation}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106580}, stag_bib_extends_levelofaccess = {NA}, author = {Morosh, V. and R{\"o}ttger, A. and Neumaier, S. and Krasniqi, F. and Živanović, M. and Kržanović, N. and Pantelić, G. and Iurlaro, G. and Mariotti, F. and Sperandio, L. and Bell, S. and Ioannidis, S. and Kelly, M. and Sangiorgi, M.} } @Article { JoBAFSWTDRGKPR2021, subid = {2125}, title = {Quantum Hall Valley Splitters and a Tunable Mach-Zehnder Interferometer in Graphene}, journal = {Physical Review Letters}, year = {2021}, month = {4}, volume = {126}, number = {14}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {146803}, keywords = {Graphene, electron interferometer, Mach-Zehnder, Quantum Hall Valley Beam Splitter}, web_url = {https://arxiv.org/abs/2011.04958}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.146803}, stag_bib_extends_levelofaccess = {NA}, author = {Jo, M. and Brasseur, P. and Assouline, A. and Fleury, G. and Sim, H-S. and Watanabe, K. and Taniguchi, T. and Dumnernpanich, W. and Roche, P. and Glattli, D.C. and Kumada, N. and Parmentier, F.D. and Roulleau, P.} } @Article { PanuTTMAKF2021, subid = {2201}, title = {Real-time HCl gas detection at parts-per-billion level concentrations utilising a diode laser and a bismuth-doped fibre amplifier}, journal = {Measurement Science and Technology}, year = {2021}, month = {3}, day = {26}, volume = {32}, number = {5}, number2 = {17IND09: MetAMCII: Metrology for Airborne Molecular Contaminants II}, pages = {055206}, keywords = {gas sensing, photoacoustic spectroscopy, laser, bismuth, fibre, cleanroom}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abd651}, stag_bib_extends_levelofaccess = {NA}, author = {Panu, H. and Timo, R. and Thomas, F. and Makkonen, J. and Alyshev, S. and Kharakhordin, A. and Firstov, S.} } @Article { deKromBZMBiGFKHE2021, subid = {2071}, title = {Comparability of calibration strategies for measuring mercury concentrations in gas emission sources and the atmosphere}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {3}, day = {25}, volume = {14}, number = {3}, number2 = {19NRM03: SI-Hg: Metrology for traceable protocols for elemental and oxidised mercury concentrations}, pages = {2317-2326}, keywords = {Mercury, Metrology, Calibration, SI-traceability, Environmental}, web_url = {https://amt.copernicus.org/articles/14/2317/2021/amt-14-2317-2021.html}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-2317-2021}, stag_bib_extends_levelofaccess = {NA}, author = {de Krom, I. and Bavius, W. and Ziel, R. and McGhee, E.A. and Brown, R.J.C. and Živković, I. and Gačnik, J. and Fajon, V. and Kotnik, J. and Horvat, M. and Ent, H.} } @Article { MetznerWFGKE2021, subid = {1989}, title = {Bayesian uncertainty quantification for magnetic resonance fingerprinting}, journal = {Physics in Medicine \& Biology}, year = {2021}, month = {3}, day = {23}, volume = {66}, number = {7}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, pages = {075006}, keywords = {MRF, Bayesian inference, uncertainty}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/abeae7}, stag_bib_extends_levelofaccess = {NA}, author = {Metzner, S. and W{\"u}bbeler, G. and Flassbeck, S. and Gatefait, C. and Kolbitsch, C. and Elster, C.} } @Article { LoslerEKR2021, subid = {2007}, title = {ILRS Reference Point Determination Using Close Range Photogrammetry}, journal = {Applied Sciences}, year = {2021}, month = {3}, day = {20}, volume = {11}, number = {6}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {2785}, keywords = {close range photogrammetry, bundle adjustment, reference point determination, unscentedtransformation, stochastic model, satellite laser ranging, GeoMetre}, web_url = {https://www.mdpi.com/2076-3417/11/6/2785}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11062785}, stag_bib_extends_levelofaccess = {NA}, author = {L{\"o}sler, M. and Eschelbach, C. and Kl{\"u}gel, T. and Riepl, S.} } @Article { CliffordMFHHKPRSP2021, subid = {2013}, title = {The importance of international standards for the graphene community}, journal = {Nature Reviews Physics}, year = {2021}, month = {3}, day = {15}, volume = {3}, number = {4}, number2 = {19NRM04: ISO-G-SCoPe: Standardisation of structural and chemical properties of graphene}, pages = {233-235}, keywords = {graphene, standards, ISO, IEC, 2D materials, standardisation}, web_url = {https://www.nature.com/articles/s42254-021-00278-6.epdf?sharing_token=_RIs5V6Xm7w_YnHU36ykhtRgN0jAjWel9jnR3ZoTv0NPpzni0dDHfaSDxkLVCOVw58FsyO6wELZUo5O32Eh0l-PBSDtirSTDnDrgEzBq40IQw69h7pcwLtLVCw2MuYIUVmHN0-WNNYkKy_jgkRmTZPKe2I2wUTrJd-QYBiq-ZrQ\%3D}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2522-5820}, DOI = {dx.doi.org/10.1038/s42254-021-00278-6}, stag_bib_extends_levelofaccess = {NA}, author = {Clifford, C.A. and Martins Ferreira, E.H. and Fujimoto, T. and Herrmann, J. and Hight Walker, A.R. and Koltsov, D. and Punckt, C. and Ren, L. and Smallwood, G.J. and Pollard, A.J.} } @Article { AsconeKWKK2021_2, subid = {2541}, title = {A longitudinal, randomized experimental pilot study to investigate the effects of airborne ultrasound on human mental health, cognition, and brain structure}, journal = {Scientific Reports}, year = {2021}, month = {3}, day = {12}, volume = {11}, number = {1}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {5814-5823}, keywords = {air-borne ultrasound, noise assessment, functional magnetic resonance imaging}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-83527-z}, stag_bib_extends_levelofaccess = {NA}, author = {Ascone, L. and Kling, C. and Wieczorek, J. and Koch, C. and K{\"u}hn, S.} } @Article { EichstadtGVSBK2021, subid = {2301}, title = {Toward Smart Traceability for Digital Sensors and the Industrial Internet of Things}, journal = {Sensors}, year = {2021}, month = {3}, day = {12}, volume = {21}, number = {6}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, pages = {2019}, keywords = {Internet of Things, calibration, measurement uncertainty, traceability, semantics, ontology, sensor network, digital sensors, redundancy}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21062019}, stag_bib_extends_levelofaccess = {NA}, author = {Eichst{\"a}dt, S. and Gruber, M. and Vedurmudi, A.P. and Seeger, B. and Bruns, T. and Kok, G.} } @Article { KietheTLKMM2021, subid = {2421}, title = {Finite-temperature spectrum at the symmetry-breaking linear to zigzag transition}, journal = {Physical Review B}, year = {2021}, month = {3}, volume = {103}, number = {10}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {104106}, keywords = {research areas, second order phase transitions, structural phase transition, physical systems, trapped ions, techniques, atom and ion cooling, molecular dynamics, atomic, molecular and optical}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {ISSN 2469-9969 (online), 2469-}, DOI = {10.1103/PhysRevB.103.104106}, stag_bib_extends_levelofaccess = {NA}, author = {Kiethe, J. and Timm, L. and Landa, H. and Kalincev, D. and Morigi, G. and Mehlst{\"a}ubler, T.E.} } @Article { KenbarS2021, subid = {1774}, title = {Influence of flow disturbances on the performance of industry-standard LNG flow meters}, journal = {Flow Measurement and Instrumentation}, year = {2021}, month = {3}, volume = {77}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {101871}, keywords = {LNG Liquid nitrogen Calibration Cryogenic Flow meter Flow disturbance Custody transfer}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101871}, stag_bib_extends_levelofaccess = {NA}, author = {Kenbar, A. and Schakel, M.} } @Article { IurlaroBCBFKMMMNNSVWi2021, subid = {2018}, title = {Study on the uncertainty of passive area dosimetry systems for environmental radiation monitoring in the framework of the EMPIR “Preparedness” project}, journal = {Radiation Measurements}, year = {2021}, month = {3}, volume = {142}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106543}, keywords = {Passive dosimetry systems, Uncertainty budget, Decision threshold, Detection limitEnvironmental radiation monitoring, Emergency preparedness}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106543}, stag_bib_extends_levelofaccess = {NA}, author = {Iurlaro, G. and Baranowska, Z. and Campani, L. and Bjelac, O.C. and Ferrari, P. and Knežević, Ž. and Majer, M. and Mariotti, F. and Morelli, B. and Neumaier, S. and Nodilo, M. and Sperandio, L. and Vittoria, F.A. and Wołoszczuk, K. and Živanović, M.} } @Article { RuhleKH2021, subid = {2046}, title = {Workflow towards automated segmentation of agglomerated, non-spherical particles from electron microscopy images using artificial neural networks}, journal = {Scientific Reports}, year = {2021}, month = {3}, volume = {11}, number = {1}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {10}, keywords = {Artificial intelligence;Automated image analysis;Electron microscopy;Image segmentation;Neural networks}, web_url = {https://www.nature.com/articles/s41598-021-84287-6.pdf}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-84287-6}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"u}hle, B. and Krumrey, J.F. and Hodoroaba, V-D.} } @Article { SeegerOCGSSOALGFGKB2021, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SeegerOCGSSOALGFGKB20210, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SeegerOCGSSOALGFGKB20211, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SassiKL2012, subid = {2000}, title = {Reproducibility of the Quantification of Reversible Wall Interactions in VOC Sampling Lines}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {20}, volume = {12}, number = {2}, number2 = {19ENV06: MetClimVOC: Metrology for climate relevant volatile organic compounds}, pages = {280}, keywords = {VOC measurements, surface interaction, gas sampling, acetone, Sulfinert®, equilibrium, uncertainty}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {2073-4433}, DOI = {10.3390/atmos12020280}, stag_bib_extends_levelofaccess = {NA}, author = {Sassi, G. and Khan, B.A. and Lecuna, M.} } @Article { FernandezScarioniBCSHALRCKS2021, subid = {2055}, title = {Thermoelectric Signature of Individual Skyrmions}, journal = {Physical Review Letters}, year = {2021}, month = {2}, day = {16}, volume = {126}, number = {7}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {1-6/077202}, keywords = {Magnetism, Nernst effect, Skyrmions, Thermomagnetic effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.077202}, stag_bib_extends_levelofaccess = {NA}, author = {Fern{\'a}ndez Scarioni, A. and Barton, C. and Corte-Le{\'o}n, H. and Sievers, S. and Hu, X. and Ajejas, F. and Legrand, W. and Reyren, N. and Cros, V. and Kazakova, O. and Schumacher, H.W.} } @Article { HorenderAQSNDSWAKGV2021, subid = {1901}, title = {Facility for production of ambient-like model aerosols (PALMA) in the laboratory: application in the intercomparison of automated PM monitors with the reference gravimetric method}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {2}, day = {16}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, keywords = {ambient-like aerosols, particulate matter, calibration , PM monitors}, web_url = {https://amt.copernicus.org/articles/14/1225/2021/amt-14-1225-2021.html}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.5194/amt-14-1225-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Horender, S. and Auderset, K. and Quincey, P. and Seeger, S. and Nielsen Skov, S. and Dirscherl, K. and Smith, T.O.M. and Williams, K. and Aegerter, C.C. and Kalbermatter, D.M. and Gaie-Levrel, F. and Vasilatou, K.} } @Article { KuttTSLKSL2021, subid = {2184}, title = {Strengths of Acids in Acetonitrile}, journal = {European Journal of Organic Chemistry}, year = {2021}, month = {2}, day = {16}, volume = {2021}, number = {9}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1407-1419}, keywords = {acidity;acetonitrile pKa scale}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {1434-193X, 1099-0690}, DOI = {10.1002/ejoc.202001649}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}tt, A. and Tshepelevitsh, S. and Saame, J. and L{\~o}kov, M. and Kaljurand, I. and Selberg, S. and Leito, I.} } @Article { AsconeKWKK2021, subid = {2540}, title = {A longitudinal, randomized experimental pilot study to investigate the effects of airborne infrasound on human mental health, cognition, and brain structure}, journal = {Scientific Reports}, year = {2021}, month = {2}, volume = {11}, number = {1}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {3190 - 3199}, keywords = {infrasound, long-time study, functional magnetic resonance imaging}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-82203-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ascone, L. and Kling, C. and Wieczorek, J. and Koch, C. and K{\"u}hn, S.} } @Article { BuonincontriKKMGCDCCMFMGSRZ2021, subid = {1697}, title = {Three dimensional MRF obtains highly repeatable and reproducible multi-parametric estimations in the healthy human brain at 1.5T and 3T}, journal = {NeuroImage}, year = {2021}, month = {2}, volume = {226}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, pages = {117573}, keywords = {MRI, Quantitation, Relaxometry, Brain, MR fingerprinting, Three dimensional, 3D}, web_url = {https://www.sciencedirect.com/science/article/pii/S1053811920310582?via\%3Dihub}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2020.117573}, stag_bib_extends_levelofaccess = {NA}, author = {Buonincontri, G. and Kurzawski, J.W. and Kaggie, J.D. and Matys, T. and Gallagher, F.A. and Cencini, M. and Donatelli, G. and Cecchi, P. and Cosottini, M. and Martini, N. and Frijia, F. and Montanaro, D. and G{\'o}mez, P.A. and Schulte, R.F. and Retico, A. and Zilberti, L.} } @Article { LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021, subid = {2093}, title = {Roadmap on quantum nanotechnologies}, journal = {Nanotechnology}, year = {2021}, month = {2}, volume = {32}, number = {16}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {162003}, keywords = {Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/abb333}, stag_bib_extends_levelofaccess = {NA}, author = {Laucht, A. and Hohls, F. and Ubbelohde, N. and Fernando Gonzalez-Zalba, M. and Reilly, D.J. and Stobbe, S. and Schr{\"o}der, T. and Scarlino, P. and Koski, J.V. and Dzurak, A. and Yang, C-H. and Yoneda, J. and Kuemmeth, F. and Bluhm, H. and Pla, J. and Hill, C. and Salfi, J. and Oiwa, A. and Muhonen, J.T. and Verhagen, E. and LaHaye, M.D. and Kim, H.H. and Tsen, A.W. and Culcer, D. and Geresdi, A. and Mol, J.A. and Mohan, V. and Jain, P.K. and Baugh, J.} } @Article { KoutsourakisEKB2021, subid = {1948}, title = {High resolution linearity measurements of photovoltaic devices using digital light processing projection}, journal = {Measurement Science and Technology}, year = {2021}, month = {1}, day = {29}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {digital light processing projection}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abe162}, stag_bib_extends_levelofaccess = {NA}, author = {Koutsourakis, G. and Eales, T.D. and Kroeger, I. and Blakesley, J.} } @Article { SobanskiTSLKIPHE2021, subid = {1916}, title = {Advances in High-Precision NO2 Measurement by Quantum Cascade Laser Absorption Spectroscopy}, journal = {Applied Sciences}, year = {2021}, month = {1}, day = {29}, volume = {11}, number = {3}, number2 = {16ENV05: MetNO2: Metrology for nitrogen dioxide}, pages = {1222}, keywords = {air pollution; trace gas; nitrogen dioxide; laser spectroscopy; mid-infrared; quantum cascade laser; selective detection}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11031222}, stag_bib_extends_levelofaccess = {NA}, author = {Sobanski, N. and Tuzson, B. and Scheidegger, P. and Looser, H. and Kupferschmid, A. and Iturrate, M. and Pascale, C. and H{\"u}glin, C. and Emmenegger, L.} } @Article { ShalmZBSSMAAMAFOMNK2021, subid = {2736}, title = {Device-independent randomness expansion with entangled photons}, journal = {Nature Physics}, year = {2021}, month = {1}, day = {28}, volume = {17}, number = {4}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {452-456}, keywords = {Bell inequality test, Entangled photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1912.11158}, author = {Shalm, L.K. and Zhang, Y. and Bienfang, J.C. and Schlager, C. and Stevens, M.J. and Mazurek, M.D. and Abell{\'a}n, C. and Amaya, W. and Mitchell, M.W. and Alhejji, M.A. and Fu, H. and Ornstein, J. and Mirin, R.P. and Nam, S.W. and Knill, E.} } @Article { KlussEW2021, subid = {2063}, title = {High-Frequency Current Transformer Design and Implementation Considerations for Wideband Partial Discharge Applications}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, month = {1}, day = {18}, volume = {70}, number = {N/A}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {1-9}, keywords = {Current transformers, frequency-domain analysis, high-voltage techniques, partial discharge (PD) measurement, time-domain analysis.}, misc2 = {EMPIR 2019: Energy}, publisher = {IEEE}, language = {30}, ISSN = {N/A}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4772471}, author = {Kl{\"u}ss, J. and Elg, A-P. and Wingqvist, C.} } @Proceedings { RitzmannWMKDF2021, subid = {1861}, title = {Measurement of 2-150 kHz Conducted Emissions in Power Networks}, journal = {Proceedings of CPEM 2020}, year = {2021}, month = {1}, number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods}, keywords = {Electromagnetic compatibility,measurement standards,measurement techniques,power quality,power system measurements,supraharmonics}, tags = {SEG}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, event_place = {Bolder}, event_name = {Conference of Precession Electromagnetic MeasurementsPEM}, event_date = {01-08-2020 to 07-08-2020}, language = {30}, DOI = {10.36227/techrxiv.13536830.v1}, stag_bib_extends_levelofaccess = {NA}, author = {Ritzmann, D. and Wright, P. and Meyer, J. and Khokhlov, V. and De La Vega, D. and Fernandez, I.} } @Article { KrasniqiKLETRT2021, subid = {1827}, title = {Standoff UV-C imaging of alpha particle emitters}, journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment}, year = {2021}, month = {1}, volume = {987}, number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities}, pages = {164821}, keywords = {Optical remote detection, alpha radiation}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2020.164821}, stag_bib_extends_levelofaccess = {NA}, author = {Krasniqi, F.S. and Kerst, T. and Leino, M. and Eisheh, J-T. and Toivonen, H. and R{\"o}ttger, A. and Toivonen, J.} } @Article { JenningerABBDGISJKRSSSTTW2021, subid = {1775}, title = {Development of a design for an ionisation vacuum gauge suitable as a reference standard}, journal = {Vacuum}, year = {2021}, month = {1}, volume = {183}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {109884}, keywords = {Ionisation gauge, Hot cathode, Sensitivity, Simulation, Reference standard}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109884}, stag_bib_extends_levelofaccess = {NA}, author = {Jenninger, B. and Anderson, J. and Bernien, M. and Bundaleski, N. and Dimitrova, H. and Granovskij, M. and Illgen, C. and Šetina, J. and Jousten, K. and Kucharski, P. and Reinhardt, C. and Scuderi, F. and Silva, R.A.S. and St{\"o}ltzel, A. and Teodoro, O.M.N.D. and Trzpil-Jurgielewicz, B. and W{\"u}est, M.} } @Article { PoppeLHWSKP2021, subid = {1843}, title = {Ion collection efficiency of ionization chambers in ultra‐high dose‐per‐pulse electron beams}, journal = {Medical Physics}, year = {2021}, month = {1}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, FLASH radiation therapy, ionization chambers, ion collection efficiency}, misc2 = {EMPIR 2018: Health}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.14620}, stag_bib_extends_levelofaccess = {NA}, author = {Poppe, B. and Looe, H.K. and Hackel, T. and Weidner, J. and Sch{\"u}ller, A. and Kranzer, R. and Poppinga, D.} } @Inbook { BELLGAABSIDPSVRIWPNKSD2021, subid = {2552}, title = {A NEW EUROPEAN RADIATION PROTECTION NETWORK DEVELOPED BY THE SUPPORT BSS JOINT NETWORK PROJECT}, year = {2021}, month = {1}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {radiation protection, metrology, national regulation, European regulation, supportBSS, ENM for Radiation Protection}, web_url = {https://vinar.vin.bg.ac.rs/bitstream/handle/123456789/10125/309-314.pdf}, misc2 = {EMPIR 2019: Support for Networks}, booktitle = {RADIATION PROTECTION SOCIETY OF SERBIA AND MONTENEGRO, PROCEEDINGS, XXXI SYMPOSIUM RPSSM, 2021}, language = {30}, ISBN = {78-86-7306-161-0}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {78-86-7306-161-0}, author = {Bell, S. and Glavič-Cindro, D. and ALVES, J. and Adam-Guillermin, C. and Bernat, R. and Sabeta, A. and Ioan, M-R. and DERLACINSKI, M. and Pinto, M. and Sochor, V. and Veres, A. and R{\"O}TTGER, .A. and Živanović, M. and Wens, B. and Persson, L. and Nylund, R. and Kržanović, N. and STANKOVIĆ, S. and DIMOVIĆ, S.} } @Article { BehrEBGHKKLPPS2020, subid = {1857}, title = {A four-terminal-pair Josephson impedance bridge combined with a graphene quantized Hall resistance}, journal = {Measurement Science and Technology}, year = {2021}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, keywords = {impedance measurement,quantized Hall resistor,coaxial impedance bridge,graphene,Josephson arbitrary waveform synthesizer}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/abcff3/pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abcff3}, stag_bib_extends_levelofaccess = {NA}, author = {Bauer, S. and Elmquist, R. and Behr, R. and Goetz, M. and Herick, J. and Kieler, O.F. and Kruskopf, M. and Lee, J. and Palafox, L. and Pimsut, Y. and Schurr, J.} } @Article { MagniBSSMKSLGKLO2021, subid = {2136}, title = {Spin Hall magnetoresistance and spin orbit torque efficiency in Pt/FeCoB bilayers}, journal = {IEEE Transactions on Magnetics}, year = {2021}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {1-1}, keywords = {spin Hall magnetoresistance, spin Hall effect, spin orbit torque, FeCoB, Pt}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9464, 1941-0069}, DOI = {10.1109/TMAG.2021.3084866}, stag_bib_extends_levelofaccess = {NA}, author = {Magni, A. and Basso, V. and Sola, A. and Soares, G. and Meggiato, N. and Kuepferling, M. and Skowronski, W. and Lazarski, S. and Grochot, K. and Khanjani, M.V. and Langer, J. and Ocker, B.} } @Article { OrtolanoMDMRKKMCCKP2021, subid = {2054}, title = {A Comprehensive Analysis of Error Sources in Electronic Fully Digital Impedance Bridges}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, volume = {70}, number2 = {17RPT04: VersICaL: A versatile electrical impedance calibration laboratory based on digital impedance bridges}, pages = {1-14}, keywords = {Impedance measurement, bridge circuits, measurement errors, measurement uncertainty, calibration}, misc2 = {EMPIR 2017: Research Potential}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2020.3034115}, stag_bib_extends_levelofaccess = {NA}, author = {Ortolano, M. and Marzano, M. and D'Elia, V. and Mai Tran, N.T. and Rybski, R. and Kaczmarek, J. and Koziol, M. and Musiol, K. and Christensen, A.E. and Callegaro, L. and Kucera, J. and Power, O.} } @Article { BernienGIDKBJ2021, subid = {2648}, title = {Traceable low-current measurements for a novel ionization gauge suitable as reference standard}, journal = {Measurement: Sensors}, year = {2021}, volume = {18}, number = {December 2}, number2 = {20SIP01: ISO Gauge: Developing an ISO Technical Specification ''Characteristics for a stable ionisation vacuum gauge''}, pages = {100202}, keywords = {Ionization vacuum gaugeSensitivityLow currentTraceable measurementsMetrology}, misc2 = {EMPIR 2020: Support for Impact}, publisher = {Elsevier Ltd}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100202}, stag_bib_extends_levelofaccess = {NA}, author = {Bernien, M. and G{\"o}tz, M. and Illgen, C. and Drung, D. and Krause, C. and Bock, T. and Jousten, K.} } @Article { StarkWBCDKRGNOSSLSKLMSPC2021, subid = {2407}, title = {An ultralow-noise superconducting radio-frequency ion trap for frequency metrology with highly charged ions}, journal = {AIP Review of Scientific Instruments}, year = {2021}, volume = {92}, number = {8}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {083203}, keywords = {Radio frequency cavities, radio-frequency quadrupole}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1063/5.0046569}, stag_bib_extends_levelofaccess = {NA}, author = {Stark, J. and Warnecke, C. and Bogen, S. and Chen, S. and Dijck, E.A. and K{\"u}hn, S. and Rosner, M. K. and Graf, A. and Nauta, J. and Oelmann, J-H. and Schm{\"o}ger, L. and Schwarz, M. and Liebert, D. and Spie{\ss}, L.J. and King, S.A. and Leopold, T. and Micke, P. and Schmidt, P.O. and Pfeifer, T. and Crespo L{\'o}pez-Urrutia, J.R.} } @Article { KrehlikSBSK2021, subid = {1850}, title = {Optical multiplexing of metrological time and frequency signals in a single 100 GHz-grid optical channel}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2021}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, keywords = {Time and frequency transfer, fiber optics, optical interleavers, wavelength multiplexing, Optical fibers, Optical filters, Optical variables control, Optical fiber networks, Ultrafast optics, Optical reflection, Time-frequency analysis}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010, 1525-8955}, DOI = {10.1109/TUFFC.2021.3053430}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Buczek, L. and Schnatz, H. and Kronj{\"a}ger, J.} } @Article { RehbehnRBBSKMGMSC2021, subid = {2408}, title = {Sensitivity to new physics of isotope-shift studies using the coronal lines of highly charged calcium ions}, journal = {Physical Review A}, year = {2021}, volume = {103}, number = {4}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {L040801}, keywords = {research areas, dark matter, electronic transitions, particle interactions, techniques, spectroscopy, nuclear physics, atomic, molecular and optical}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {ISSN 2469-9934 (online), 2469-}, DOI = {10.1103/PhysRevA.103.L040801}, stag_bib_extends_levelofaccess = {NA}, author = {Rehbehn, N-H. and Rosner, M.K. and Bekker, H. and Berengut, J.C. and Schmidt, P.O. and King, S.A. and Micke, P. and Gu, M.F. and M{\"u}ller, R. and Surzhykov, A. and Crespo L{\'o}pez-Urrutia, J.R.} } @Proceedings { GogyanKBZ2021, subid = {2747}, title = {Theoretical Investigation of Superradiant Lasing in 2-or 3-Level Atoms in an Optical Lattice}, journal = {2021 JOINT CONFERENCE OF THE EUROPEAN FREQUENCY AND TIME FORUM AND IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM}, year = {2021}, volume = {1}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {superradiance 2-3 level atoms}, misc2 = {EMPIR 2017: Fundamental}, event_place = {on line}, event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {09-07-2022 to 14-07-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip}, author = {Gogyan, A. and Kazakov, G. and Bober, M. and Zawada, M.} } @Article { LovenDBKTRWI2021, subid = {1897}, title = {Toxicological effects of zinc oxide nanoparticle exposure: an in vitro comparison between dry aerosol air-liquid interface and submerged exposure systems}, journal = {Nanotoxicology}, year = {2021}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, keywords = {Air-liquid interface; NACIVT, aerosol, cell response, toxicity}, web_url = {https://www.tandfonline.com/doi/full/10.1080/17435390.2021.1884301}, misc2 = {EMPIR 2018: Health}, language = {30}, DOI = {10.1080/17435390.2021.1884301}, stag_bib_extends_levelofaccess = {NA}, author = {Lov{\'e}n , K. and Dobric, J. and B{\"o}l{\"u}kbas, D.A. and K{\aa}redal, M. and Tas, S. and Rissler, J. and Wagner, D.E. and Isaxon, C. } } @Proceedings { KhanbabaeeRBRFHZTLdBGLCA2021, subid = {2235}, title = {Support for a European Metrology Network on reliable radiation protection: Gaps in radiation protection metrology}, journal = {Book of Abstracts}, year = {2021}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {European Metrology Network, radiation protection, radionuclide, radon, reference field, traceability}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {RAD Centre}, event_place = {Herceg Novi, Montenegro}, event_name = {RAD-Conference}, event_date = {14-06-2021 to 18-06-2021}, language = {30}, DOI = {10.21175/rad.abstr.book.2021.31.8}, stag_bib_extends_levelofaccess = {NA}, author = {Khanbabaee, B. and R{\"o}ttger, A. and Behrens, R. and R{\"o}ttger, S. and Feige, S. and Hupe, O. and Zutz, H. and Toroi, P. and Leonard, P. and de la Fuente Rosales, L. and Burgess, P. and Gressier, V. and Luis Gutierrez Villanueva, J. and Cruz Su{\'a}rez, R. and Arnold, D.} } @Proceedings { KhanbabaeeRBRFHZTLdBGGCA2021, subid = {2377}, title = {SUPPORT FOR A EUROPEAN METROLOGY NETWORK ON RELIABLE RADIATION PROTECTION: GAPS IN RADIATION PROTECTION AND RELATED METROLOGY}, journal = {RAD Conference Proceedings}, year = {2021}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {Activity standards, new operational quantities in radiation protection, type testing, calibration, radon,reference field, pulsed radiation, dosimetry, standards, radiological emergency response}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {RAD Centre}, event_place = {Herceg Novi, Montenegro}, event_name = {9th international conference on Radiation in various fields of research}, event_date = {14-06-2021 to 18-06-2021}, language = {30}, DOI = {10.21175/RadProc.2021.04}, stag_bib_extends_levelofaccess = {NA}, author = {Khanbabaee, B. and R{\"o}ttger, A. and Behrens, R. and R{\"o}ttger, S. and Feige, S. and Hupe, O. and Zutz, H. and Toroi, P. and Leonard, P. and de la Fuente Rosales, L. and Burgess, P. and Gressier, V. and Guti{\'e}rrez Villanueva, J–L. and Cruz Su{\'a}rez, R. and Arnold, D.} } @Proceedings { SinghTNMKGBBWZ2021, subid = {2732}, title = {Towards a Continuous Active Optical Atomic Clock With Cold Strontium Atoms}, journal = {2021 JOINT CONFERENCE OF THE EUROPEAN FREQUENCY AND TIME FORUM AND IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM (IEEE EFTF-IFCS 2021)}, year = {2021}, volume = {1}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Contiunous clock,}, web_url = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip}, misc2 = {EMPIR 2017: Fundamental}, event_place = {on line}, event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {09-07-2021 to 14-07-2021}, language = {30}, ISBN = {978-1-6654-3935-0}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {2327-1914}, author = {Singh, V. and Tonoyan, A. and Naroznik, M. and Morzyński, P. and Kovacic, D. and Gogyan, A. and Bilicki, S. and Bober, M. and Witkowski, M. and Zawada, M.} } @Article { ZakrissonSFSMPKARA2020, subid = {1787}, title = {Simulation of pressure-induced cavity deformation – the 18SIB04 Quantumpascal EMPIR project}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {281-286}, keywords = {EMPIR; QuantumPascal; FEM; Pressure; Refractometry; Deformation.}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-58}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.985}, stag_bib_extends_levelofaccess = {NA}, author = {Zakrisson, J. and Silander, I. and Forss{\'e}n, C. and Silvestri, Z. and Mari, D. and Pasqualin, S. and Kussicke, A. and Asbahr, P. and Rubin, T. and Axner, O.} } @Article { ZelenkaASHKPPDZCM2020, subid = {2108}, title = {Improvement of the realisation of the mass scale}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {19RPT02: RealMass: Improvement of the realisation of the mass scale}, pages = {4}, keywords = {Mass realisation, kilogram, multiplies and sub-multiplies, subdivision and multiplication, OIML R111}, web_url = {https://acta.imeko.org/index.php/acta-imeko/index}, misc2 = {EMPIR 2019: Research Potential}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.928}, stag_bib_extends_levelofaccess = {NA}, author = {Zelenka, Z. and Alisic, S. and Stoilkovska, B. and Hanrahan, R. and Kolozinsky, I. and Popa, G. and Pantic, D. and Dikov, V. and Zůda, J. and Coenegrachts, M. and Malengo, A.} } @Article { YrjanaSIKLB2020, subid = {2182}, title = {Potentiometric Carboxylate Sensors Based on Carbazole-Derived Acyclic and Macrocyclic Ionophores}, journal = {Chemosensors}, year = {2020}, month = {12}, day = {24}, volume = {9}, number = {1}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {4}, keywords = {ion-selective electrodesanion receptorsionophorescarboxylateelectrode shell material}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-9040}, DOI = {10.3390/chemosensors9010004}, stag_bib_extends_levelofaccess = {NA}, author = {Yrj{\"a}n{\"a}, V. and Saar, I. and Ilisson, M. and Kadam, S.A. and Leito, I. and Bobacka, J.} } @Article { GabrischDLWCGFKPP2020, subid = {1844}, title = {VHEE beam dosimetry at CERN Linear Electron Accelerator for Research under ultra-high dose rate conditions}, journal = {Biomedical Physics \& Engineering Express}, year = {2020}, month = {12}, day = {18}, volume = {7}, number = {1}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {015012}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, ionization chamber}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {2057-1976}, DOI = {10.1088/2057-1976/abcae5}, stag_bib_extends_levelofaccess = {NA}, author = {Gabrisch, L. and Delfs, B. and Looe, H.K. and Wyrwoll, V. and Corsini, R. and Gilardi, A. and Farabolini, W. and Kranzer, R. and Poppinga, D. and Poppe, B.} } @Article { PojtingerNGPPKT2020, subid = {2375}, title = {Experimental determination of magnetic field correction factors for ionization chambers in parallel and perpendicular orientations}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {12}, day = {15}, volume = {65}, number = {24}, number2 = {19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy}, pages = {245044}, keywords = {MR-linac, dosimetry, alanine dosimetry, ionization chambers, magnetic field correction factors}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/abca06}, stag_bib_extends_levelofaccess = {NA}, author = {Pojtinger, S. and Nachbar, M. and Ghandour, S. and Pisaturo, O. and Pachoud, M. and Kapsch, R-P. and Thorwarth, D.} } @Article { MarschallHWHRKE2020, subid = {1801}, title = {Compressed FTIR spectroscopy using low-rank matrix reconstruction}, journal = {Optics Express}, year = {2020}, month = {12}, volume = {28}, number = {26}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {38762}, keywords = {Fourier transform infrared; FTIR spectroscopy; low-rank matrix reconstruction}, web_url = {https://www.osapublishing.org/oe/fulltext.cfm?uri=oe-28-26-38762\&id=444648}, misc2 = {EMPIR 2018: Health}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.404959}, stag_bib_extends_levelofaccess = {NA}, author = {Marschall, M. and Hornemann, A. and W{\"u}bbeler, G. and Hoehl, A. and Ruhl, E. and K{\"a}stner, B. and Elster, C.} } @Article { SchmelterKOFB2020, subid = {1764}, title = {On the influence of inlet perturbations on slug dynamics in horizontal multiphase flow – a computational study}, journal = {Metrologia}, year = {2020}, month = {12}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, keywords = {multiphase flow, two-phase flow, gas-liquid flow, slug flow, computational fluid dynamics (CFD), inlet perturbation, random perturbation}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abd1c9}, stag_bib_extends_levelofaccess = {NA}, author = {Schmelter, S. and Knotek, S. and Olbrich, M. and Fiebach, A. and Baer, M.} } @Article { SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020, subid = {1841}, title = {The European Joint Research Project UHDpulse – Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, journal = {Physica Medica}, year = {2020}, month = {12}, volume = {80}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {134-150}, keywords = {Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2020.09.020}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}ller, A. and Heinrich, S. and Fouillade, C. and Subiel, A. and De Marzi, L. and Romano, F. and Peier, P. and Trachsel, M. and Fleta, C. and Kranzer, R. and Caresana, M. and Salvador, S. and Busold, S. and Sch{\"o}nfeld, A. and McEwen, M. and Gomez, F. and Solc, J. and Bailat, C. and Linhart, V. and Jakubek, J. and Pawelke, J. and Borghesi, M. and Kapsch, R-P. and Knyziak, A. and Boso, A. and Olsovcova, V. and Kottler, C. and Poppinga, D. and Ambrozova, I. and Schmitzer, C-S. and Rossomme, S. and Vozenin, M-C.} } @Article { PiliaSRGDKCL2020, subid = {2455}, title = {Quantification and classification of potassium and calcium disorders with the electrocardiogram: What do clinical studies, modeling, and reconstruction tell us?}, journal = {APL Bioengineering}, year = {2020}, month = {12}, volume = {4}, number = {4}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {041501}, keywords = {Electrolytes, Medical diagnosis, Computational models, Wearable technology, Medical tests, Artificial neural networks, Artificial intelligence, Machine learning, Dialysis}, misc2 = {EMPIR 2018: Health}, publisher = {AIP Publishing}, language = {30}, ISSN = {2473-2877}, DOI = {10.1063/5.0018504}, stag_bib_extends_levelofaccess = {NA}, author = {Pilia, N. and Severi, S. and Raimann, J.G. and Genovesi, S. and D{\"o}ssel, O. and Kotanko, P. and Corsi, C. and Loewe, A.} } @Article { ShakelWGK2020, subid = {1873}, title = {Narrow stack emissions: Errors in flow rate measurement due to disturbances and swirl}, journal = {Journal of the Air \& Waste Management Association}, year = {2020}, month = {11}, day = {30}, volume = {71}, number = {1}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, pages = {46-59}, keywords = {international standards, methods to measure emissions, industrial stacks, small emission limit values, data, flow disturbances, narrow stacks, policy-makers.}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1096-2247, 2162-2906}, DOI = {10.1080/10962247.2020.1832621}, stag_bib_extends_levelofaccess = {NA}, author = {Shakel, D. and Workamp, M. and Gersl, J. and Knotek, S.} } @Article { KrauseBNLS2020, subid = {2733}, title = {Simple and compact diode laser system stabilized to Doppler-broadened iodine lines at 633  nm}, journal = {Applied Optics}, year = {2020}, month = {11}, day = {30}, volume = {59}, number = {34}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {10808}, keywords = {Iodine cell, laser system}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1559-128X, 2155-3165}, DOI = {10.1364/AO.409308}, stag_bib_extends_levelofaccess = {NA}, author = {Krause, F. and Benkler, E. and N{\"o}lleke, C. and Leisching, P. and Sterr, U.} } @Article { LopezMPSGBSCDK2020, subid = {1731}, title = {A study to develop a robust method for measuring the detection efficiency of free-running InGaAs/InP single-photon detectors}, journal = {EPJ Quantum Technology}, year = {2020}, month = {11}, day = {25}, volume = {7}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {14}, keywords = {Quantum technologyQuantum radiometryDetection efficiencySingle-photon detectorsSingle-photon sourcesMetrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2662-4400, 2196-0763}, DOI = {10.1140/epjqt/s40507-020-00089-1}, stag_bib_extends_levelofaccess = {NA}, author = {L{\'o}pez, M. and Meda, A. and Porrovecchio, G. and Starkwood, R.A. and Genovese, M. and Brida, G. and Smid, M. and Chunnilall, C.J. and Degiovanni, I.P. and K{\"u}ck, S.} } @Article { LopezMPSGBSCDK2020_2, subid = {1805}, title = {A study to develop a robust method for measuring the detection efficiency of free-running InGaAs/InP single-photon detectors}, journal = {EPJ Quantum Technology}, year = {2020}, month = {11}, day = {25}, volume = {7}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Quantum technologyQuantum radiometryDetection efficiencySingle-photon detectorsSingle-photon sourcesMetrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2662-4400, 2196-0763}, DOI = {10.1140/epjqt/s40507-020-00089-1}, stag_bib_extends_levelofaccess = {NA}, author = {L{\'o}pez, M. and Meda, A. and Porrovecchio, G. and Starkwood, R.A. and Genovese, M. and Brida, G. and Smid, M. and Chunnilall, C.J. and Degiovanni, I.P. and K{\"u}ck, S.} } @Article { SachsePVSRBBHKSKH2020, subid = {1704}, title = {Assessing Optical and Electrical Properties of Highly Active IrOx Catalysts for the Electrochemical Oxygen Evolution Reaction via Spectroscopic Ellipsometry}, journal = {ACS Catalysis}, year = {2020}, month = {11}, day = {20}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {14210-14223}, keywords = {spectroscopic ellipsometry, electrocatalysis, oxygen evolution reaction, mesoporous iridium oxidefilms, non-destructive ambient analysis, intrinsic OER activity, complementary methodology and metrology}, misc2 = {EMPIR 2016: Energy}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2155-5435, 2155-5435}, DOI = {10.1021/acscatal.0c03800}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Pfl{\"u}ger, M. and Velasco-V{\'e}lez, J-J. and Sahre, M. and Radnik, J. and Bernicke, M. and Bernsmeier, D. and Hodoroaba, V-D. and Krumrey, M. and Strasser, P. and Kraehnert, R. and Hertwig, A.} } @Article { LodewyckLPBKK2020, subid = {1834}, title = {Universal formalism for data sharing and processing in clock comparison networks}, journal = {Physical Review Research}, year = {2020}, month = {11}, day = {20}, volume = {2}, number = {4}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {043269}, keywords = {atomic clocks, frequency comparison, frequency combs}, web_url = {https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.2.043269}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.2.043269}, stag_bib_extends_levelofaccess = {NA}, author = {Lodewyck, J. and Le Targat, R. and Pottie, P-E. and Benkler, E. and Koke, S. and Kronj{\"a}ger, J.} } @Article { MaraisvKv2020, subid = {2080}, title = {Reduction of Static Electricity Meter Errors by Broadband Compensation of Voltage and Current Channel Differences}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2020}, month = {11}, day = {20}, volume = {70}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {1-11}, keywords = {Energy measurement; electromagnetic compatibility; electromagnetic interference; immunity testing; measurement errors; standards; watthour meters;}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2020.3039631}, stag_bib_extends_levelofaccess = {NA}, author = {Marais, Z. and van den Brom, H.E. and Kok, G. and van Veghel, M.G.A.} } @Article { RitzmannLDKGWMFK2020, subid = {1754}, title = {Comparison of Measurement Methods for 2-150 kHz Conducted Emissions in Power Networks}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2020}, month = {11}, day = {19}, number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods}, pages = {1-1}, keywords = {High frequency distortion,power quality,harmonics,supraharmonics,measurement techniques,voltage distortion}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2020.3039302}, stag_bib_extends_levelofaccess = {NA}, author = {Ritzmann, D. and Lodetti, S. and De La Vega, D. and Khokhlov, V. and Gallarreta, A. and Wright, P. and Meyer, J. and Fernandez, I. and Klingbeil, D.} } @Article { KokurewiczSBSKHMKJ2020, subid = {1842}, title = {Dosimetry for New Radiation Therapy Approaches Using High Energy Electron Accelerators}, journal = {Frontiers in Physics}, year = {2020}, month = {11}, day = {13}, volume = {8}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {Dosimetry, FLASH beams, Absorbed dose, ultra-high pulse dose rates, High Energy Electron Accelerators}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2020.568302}, stag_bib_extends_levelofaccess = {NA}, author = {Kokurewicz, K. and Sch{\"u}ller, A. and Brunetti, E. and Subiel, A. and Kranzer, R. and Hackel, T. and Meier, M. and Kapsch, R-P. and Jaroszynsk, D.A.} } @Miscellaneous { ArduinoPZKC, subid = {1667}, title = {EMUE-D5-3-EPT Tissue Characterization}, year = {2020}, month = {11}, day = {6}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Electric Properties Tomography; Magnetic Resonance Imaging; Variance-covariance matrix; Shrinkage estimation; Law of propagation of uncertainty}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.4248879}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Pennecchi, F. and Zilberti, L and Katscher, U. and Cox, M.G.} } @Article { HonickeWWKB2020, subid = {1688}, title = {Towards a calibration of laboratory setups for grazing incidence and total-reflection X-ray fluorescence analysis}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {11}, volume = {174}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {106009}, keywords = {Gracing incidence X-ray fluorescenceLaboratory setupSolid angle characterization}, web_url = {https://arxiv.org/abs/2003.05192}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.106009}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Waldschl{\"a}ger, U. and Wiesner, T. and Kr{\"a}mer, M. and Beckhoff, B.} } @Article { BlakesleyKDHTMSA2020, subid = {1949}, title = {Effective Spectral Albedo from Satellite Data for Bifacial Gain Calculations of PV Systems}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {1292 - 1297}, keywords = {Albedo, Bificial PV Module}, web_url = {https://zenodo.org/record/4055920}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {3-936338-73-6}, author = {Blakesley, J.C. and Koutsourakis, G. and Douglas, S. and Holder, J.K.L. and Torry, J. and Mukadam, F. and Schmid, A. and Abrams, R.S.J.} } @Article { IstrateKSRFSSG2020, subid = {1960}, title = {Laboratory Calibration of Energy Measurement Systems (EMS) under AC Distorted Waveforms}, journal = {Sensors}, year = {2020}, month = {11}, volume = {20}, number = {21}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {6301}, keywords = {energy measurement; railway system; calibration setup; fictive power source; distorted regime; harmonic waveform; calibration procedure; energy measuring system}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20216301}, stag_bib_extends_levelofaccess = {NA}, author = {Istrate, D. and Khamlichi, A. and Soccalingame, S. and Rovira, J. and Fortune, D. and Š{\'i}ra, M. and Simon, P. and Garnacho, F.} } @Article { IstrateKSRFSS2020, subid = {1930}, title = {Laboratory Calibration of Energy Measurement Systems (EMS) under AC Distorted Waveforms}, journal = {Sensors}, year = {2020}, month = {11}, volume = {20}, number = {21}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {6301}, keywords = {energy measurement; railway system; calibration setup; fictive power source; distorted regime; harmonic waveform; calibration procedure; energy measuring system}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20216301}, stag_bib_extends_levelofaccess = {NA}, author = {Istrate, D. and Khamlichi, A. and Soccalingame, S. and Rovira, J. and Fortune, D. and Š{\'i}ra, M. and Simon, P.} } @Article { HuggettBBGHKKMMNPSSVVWZ2020, subid = {1862}, title = {Cautionary Note on Contamination of Reagents Used for Molecular Detection of SARS-CoV-2}, journal = {Clinical Chemistry}, year = {2020}, month = {10}, day = {30}, volume = {66}, number = {11}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {1369-1372}, keywords = {SARS-CoV-2, RT-qPCR, contamination, false positive, molecular diagnosis}, web_url = {https://academic.oup.com/clinchem/article/66/11/1369/5902447}, misc2 = {EMPIR 2018: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0009-9147, 1530-8561}, DOI = {10.1093/clinchem/hvaa214}, stag_bib_extends_levelofaccess = {NA}, author = {Huggett, J.F. and Benes, V. and Bustin, S.A. and Garson, J.A. and Harris, K. and Kammel, M. and Kubista, M. and McHugh, T.D. and Moran-Gilad, J. and Nolan, T. and Pfaffl, M.W. and Salit, M. and Shipley, G. and Vallone, P.M. and Vandesompele, J. and Wittwer, C. and Zeichhardt, H.} } @Article { BourgouinSHKPKM2020, subid = {1840}, title = {Calorimeter for Real-Time Dosimetry of Pulsed Ultra-High Dose Rate Electron Beams}, journal = {Frontiers in Physics}, year = {2020}, month = {10}, day = {30}, volume = {8}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, FLASH radiation therapy, calorimetry}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2020.567340}, stag_bib_extends_levelofaccess = {NA}, author = {Bourgouin, A. and Sch{\"u}ller, A. and Hackel, T. and Kranzer, R. and Poppinga, D. and Kapsch, R-P. and McEwen, M. } } @Article { HuntRSK2020, subid = {1692}, title = {High-speed density measurement for LNG and other cryogenic fluids using electrical capacitance tomography}, journal = {Cryogenics}, year = {2020}, month = {10}, day = {24}, volume = {113}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {103207}, keywords = {Liquefied natural gasLNGElectrical capacitance tomographyECTDensity measurement}, tags = {EnG}, web_url = {https://doi.org/10.1016/j.cryogenics.2020.103207}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0011-2275}, DOI = {10.1016/j.cryogenics.2020.103207}, stag_bib_extends_levelofaccess = {NA}, author = {Hunt, A. and Rusli, I. and Schakel, M. and Kenbar, A.} } @Article { HanZGPCSLHKSPLP2020, subid = {1868}, title = {Measurement of thermodynamic temperature between 5 K and 24.5 K with single-pressure refractive-index gas thermometry}, journal = {Metrologia}, year = {2020}, month = {10}, day = {19}, volume = {57}, number = {6}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {065006}, keywords = {SPRIGT, Cryostat, Resonator.thermodynamic temperature,}, tags = {SEG}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/ab84ca/pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab84ca}, stag_bib_extends_levelofaccess = {NA}, author = {Han, D. and Zhang, H. and Gao, B. and Pan, C. and Chen, H. and Song, Y. and Liu, W. and Hu, J. and Kong, X. and Sparasci, F. and Plimmer, M. and Luo, E. and Pitre, L.} } @Article { FurstYKKDLBHPM2020, subid = {1650}, title = {Coherent Excitation of the Highly Forbidden Electric Octupole Transition in Yb+172}, journal = {Physical Review Letters}, year = {2020}, month = {10}, day = {16}, volume = {125}, number = {16}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {163001}, keywords = {Atomic spectra, Optical clocks, Coherent control, Cooling \& trapping, Laser spectroscopy, Trapped Ions}, web_url = {https://link.aps.org/doi/10.1103/PhysRevLett.125.163001}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.163001}, stag_bib_extends_levelofaccess = {NA}, author = {F{\"u}rst, H.A. and Yeh, C.H. and Kalincev, D. and Kulosa, A.P. and Dreissen, L.S. and Lange, R. and Benkler, E. and Huntemann, N. and Peik, E. and Mehlst{\"a}ubler, T.E.} } @Article { ClarkKE2020, subid = {1686}, title = {Mitigating decoherence in hot electron interferometry}, journal = {New Journal of Physics}, year = {2020}, month = {10}, day = {15}, volume = {22}, number = {10}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {103031}, keywords = {electron quantum optics,mesoscopics,electron transport, quantum Hall effect,electron interferometry}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/abb9e5}, stag_bib_extends_levelofaccess = {NA}, author = {Clark, L.A. and Kataoka, M. and Emary, C.} } @Article { MantouvalouJSMKWHWGBGD2020, subid = {1689}, title = {Laboratory grazing-incidence X-ray fluorescence spectroscopy as an analytical tool for the investigation of sub-nanometer CrSc multilayer water window optics}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {10}, day = {10}, volume = {174}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {105995}, keywords = {GIXRFMultilayer characterization}, web_url = {https://arxiv.org/abs/2006.12198}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.105995}, stag_bib_extends_levelofaccess = {NA}, author = {Mantouvalou, I. and Jonnard, P. and Szwedowski-Rammert, V. and Meltchakov, E. and Kanngie{\ss}er, B. and Wu, M. and Honicke, P. and Waldschl{\"a}ger, U. and Gross, A. and Baumann, J. and Goetzke, G. and Delmotte, F.} } @Article { BremerWFTSKRHSPMGR2020, subid = {1803}, title = {Quantum dot single-photon emission coupled into single-mode fibers with 3D printed micro-objectives}, journal = {APL Photonics}, year = {2020}, month = {10}, volume = {5}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {106101}, keywords = {Quantum dot single-photon emission}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {2378-0967}, DOI = {10.1063/5.0014921}, stag_bib_extends_levelofaccess = {NA}, author = {Bremer, L. and Weber, K. and Fischbach, S. and Thiele, S. and Schmidt, M. and Kaganskiy, A. and Rodt, S. and Herkommer, A. and Sartison, M. and Portalupi, S.L. and Michler, P. and Giessen, H. and Reitzenstein, S.} } @Article { PojtingerNKT2020, subid = {2376}, title = {Influence of beam quality on reference dosimetry correction factors in magnetic resonance guided radiation therapy}, journal = {Physics and Imaging in Radiation Oncology}, year = {2020}, month = {10}, volume = {16}, number2 = {19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy}, pages = {95-98}, keywords = {MR-linac, Dosimetry, Ionization chambers, Magnetic field correction factors, EGSnrc, Monte Carlo}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {2405-6316}, DOI = {10.1016/j.phro.2020.10.005}, stag_bib_extends_levelofaccess = {NA}, author = {Pojtinger, S. and Nachbar, M. and Kapsch, R-P. and Thorwarth, D.} } @Article { SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI2020, subid = {1664}, title = {Intercontinental comparison of optical atomic clocks through very long baseline interferometry}, journal = {Nature Physics}, year = {2020}, month = {10}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology}, web_url = {http://hdl.handle.net/11696/64130}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-020-01038-6}, stag_bib_extends_levelofaccess = {NA}, author = {Sekido, M. and Takefuji, K. and Ujihara, H. and Hachisu, H. and Nemitz, N. and Tsutsumi, M. and Kondo, T. and Kawai, E. and Ichikawa, R. and Namba, K. and Okamoto, Y. and Takahashi, R. and Komuro, J. and Clivati, C. and Bregolin, F. and Barbieri, P. and Mura, A. and Cantoni, E. and Cerretto, G. and Levi, F. and Maccaferri, G. and Roma, M. and Bortolotti, C. and Negusini, M. and Ricci, R. and Zacchiroli, G. and Roda, J. and Leute, J. and Petit, G. and Perini, F. and Calonico, D. and Pizzocaro, M. and Ido, T.} } @Article { JandaGOPUHRSMRNCHWEACDMORONJKZ2020, subid = {1683}, title = {Magneto-Seebeck microscopy of domain switching in collinear antiferromagnet CuMnAs}, journal = {Physical Review Materials}, year = {2020}, month = {9}, day = {28}, volume = {4}, number = {9}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {094413-1 to 094413-9}, keywords = {-}, web_url = {https://arxiv.org/abs/2004.05460}, misc2 = {EMPIR 2016: Energy}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2475-9953}, DOI = {10.1103/PhysRevMaterials.4.094413}, stag_bib_extends_levelofaccess = {NA}, author = {Janda, T. and Godinho, J. and Ostatnicky, T. and Pfitzner, E. and Ulrich, G. and Hoehl, A. and Reimers, S. and Šob{\'a}ň, Z. and Metzger, T. and Reichlov{\'a}, H. and Nov{\'a}k, V. and Campion, R. P. and Heberle, J. and Wadley, P. and Edmonds, K. W. and Amin, O. J. and Chauhan, J. S. and Dhesi, S. S. and Maccherozzi, F. and Otxoa, R. M. and Roy, P. E. and Olejn{\'i}k, K. and Němec, P. and Jungwirth, T. and Kaestner, B. and Ziade, Francois} } @Article { SikorskyGHKGEMRDWBRSKSF2020, subid = {1642}, title = {Measurement of the Th229 Isomer Energy with a Magnetic Microcalorimeter}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {Th229 Isomer Energy, Magnetic Microcalorimeter}, web_url = {https://arxiv.org/abs/2005.13340}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.142503}, stag_bib_extends_levelofaccess = {NA}, author = {Sikorsky, T. and Geist, J. and Hengstler, D. and Kempf, S. and Gastaldo, L. and Enss, C. and Mokry, C. and Runke, J. and D{\"u}llmann, C.E. and Wobrauschek, P. and Beeks, K. and Rosecker, V. and Sterba, J.H. and Kazakov, G. and Schumm, T. and Fleischmann, A.} } @Article { EckmannvCLvKR2020, subid = {1605}, title = {Density Measurements of (0.99 Methane + 0.01 Butane) and (0.98 Methane + 0.02 Isopentane) over the Temperature Range from (100 to 160) K at Pressures up to 10.8 MPa}, journal = {International Journal of Thermophysics}, year = {2020}, month = {9}, day = {23}, volume = {41}, number = {11}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {1-19/156}, keywords = {Cryogenic state · Density measurement · Liquefied binary mixtures ·Magnetic-suspension coupling · Single-sinker densimeter}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-020-02728-2}, stag_bib_extends_levelofaccess = {NA}, author = {Eckmann, P. and von Preetzmann, N. and Cavuoto, G. and Li, J. and van der Veen, A. and Kleinrahm, R. and Richter, M.} } @Article { KuipervNVv2020, subid = {1706}, title = {Reliable measurements of extracellular vesicles by clinical flow cytometry}, journal = {American Journal of Reproductive Immunology}, year = {2020}, month = {9}, day = {23}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, keywords = {calibration,data interpretation,extracellular vesicles,flow cytometry,standardization}, misc2 = {EMPIR 2018: Health}, publisher = {John Wiley \& Sons Ltd}, language = {30}, ISSN = {1046-7408}, DOI = {10.1111/aji.13350}, stag_bib_extends_levelofaccess = {NA}, author = {Kuiper, M. and van de Nes, A. and Nieuwland, R. and Varga, Z. and van de Pol, E.} } @Article { deKromBZMBiGFKHE2020, subid = {2032}, title = {Comparability of calibration strategies for measuring mercury concentrations in gas emission sources and the atmosphere}, journal = {Atmospheric Measuremnt Techniques Discussion}, year = {2020}, month = {9}, day = {21}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {Mercury, emissions, calibration, traceability}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, DOI = {10.5194/amt-2020-314}, stag_bib_extends_levelofaccess = {NA}, author = {de Krom, I. and Bavius, W. and Ziel, R. and McGhee, E.A. and Brown, R.J.C. and Živković, I. and Gačnik, J. and Fajon, V. and Kotnik, J. and Horvat, M. and Ent, H.} } @Article { ChristinckRLHGK2020, subid = {1880}, title = {Characterization of the angular-dependent emission of nitrogen-vacancy centers in nanodiamond}, journal = {Applied Physics B}, year = {2020}, month = {9}, day = {18}, volume = {126}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Single-photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-020-07508-2}, stag_bib_extends_levelofaccess = {NA}, author = {Christinck, J. and Rodiek, B. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and K{\"u}ck, S.} } @Article { WinterSVMRPKHLHDBBBBBBKSR2020, subid = {1950}, title = {Results of the Bifacial PV Cells and PV Modules Power Measurement Round Robin Activity of the PV-Enerate Project}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {9}, day = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {877 - 882}, keywords = {Testing, PV Module, Bifacial PV}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4055707}, author = {Winter, S. and Str{\"a}ter, H. and Vegas, A. and Molinero, R.R. and Riechelmann, S. and Pavanello, D. and Kenny, R. and Herrmann, W. and Lopez-Garcia, J. and Hinken, D. and Dittmann, S. and Bonilla, J. and Bliss, M. and Bothe, K. and Blakesley, J.C. and Betts, T.R. and Bellenda, G. and Koutsourakis, G. and Schmid, A. and Rauer, M.} } @Article { GeorgievaLHCRSKHRRK2020, subid = {1881}, title = {Radiometric characterization of a triggered narrow-bandwidth single-photon source and its use for the calibration of silicon single-photon avalanche detectors}, journal = {Metrologia}, year = {2020}, month = {9}, volume = {57}, number = {5}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {055001}, keywords = {quantum radiometry, quantum metrology, single-photon source, single-photondetector, quantum dot}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab9db6}, stag_bib_extends_levelofaccess = {NA}, author = {Georgieva, H. and L{\'o}pez, M. and Hofer, H. and Christinck, J. and Rodiek, B. and Schnauber, P. and Kaganskiy, A. and Heindel, T. and Rodt, S. and Reitzenstein, S. and K{\"u}ck, S.} } @Article { GunkelDHLKRUBT2020, subid = {1684}, title = {Phonon‐Enhanced Near‐Field Spectroscopy to Extract the Local Electronic Properties of Buried 2D Electron Systems in Oxide Heterostructures}, journal = {Advanced Functional Materials}, year = {2020}, month = {9}, volume = {30}, number = {46}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {2004767}, keywords = {2D electron systems, electronic properties, LaAlO/SrTiO, near-field spectroscopy, oxide heterostructure}, misc2 = {EMPIR 2016: Energy}, publisher = {Wiley}, language = {30}, ISSN = {1616-301X, 1616-3028}, DOI = {10.1002/adfm.202004767}, stag_bib_extends_levelofaccess = {NA}, author = {Gunkel, F. and Dittmann, R. and Hoehl, A. and Lewin, M. and K{\"a}stner, B. and Rose, M‐A. and Ulrich, G. and Barnett, J. and Taubner, T.} } @Article { PfitznerUHLZSSHKMW2020, subid = {1800}, title = {Thermoelectric nanospectroscopy for the imaging of molecular fingerprints}, journal = {Nanophotonics}, year = {2020}, month = {8}, day = {21}, volume = {9}, number = {14}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {4347-4354}, keywords = {nanospectroscopy; photothermoelectric effect; s-SNOM}, web_url = {https://www.degruyter.com/view/journals/nanoph/ahead-of-print/article-10.1515-nanoph-2020-0316/article-10.1515-nanoph-2020-0316.xml?tab_body=fullHtml-79543}, misc2 = {EMPIR 2018: Health}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2192-8614, 2192-8606}, DOI = {10.1515/nanoph-2020-0316}, stag_bib_extends_levelofaccess = {NA}, author = {Pfitzner, E. and Ulrich, G. and Hoehl, A. and Liao, J-W. and Zadvorna, O. and Sirringhaus, H. and Schweicher, G. and Heberle, J. and K{\"a}stner, B. and Minutoli, D. and Wunderlich, J.} } @Article { CainSTLWKBLF2020, subid = {1615}, title = {In Situ Electric-Field Study of Surface Effects in Domain Engineered Pb(In1/2Nb1/2)O3-Pb(Mg1/3Nb2/3)O3-PbTiO3 Relaxor Crystals by Grazing Incidence Diffraction}, journal = {Crystals}, year = {2020}, month = {8}, day = {20}, volume = {10}, number = {9}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {728}, keywords = {-}, web_url = {https://electrosciences.co.uk/2020/08/27/grazing_incidence/}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4352}, DOI = {10.3390/cryst10090728}, stag_bib_extends_levelofaccess = {NA}, author = {Cain, M.G. and Staruch, M. and Thompson, P. and Lucas, C. and Wermeille, D. and Kayser, Y. and Beckhoff, B. and Lofland, S.E. and Finkel, P.} } @Article { SchinkePHWBKNW2020_2, subid = {1604}, title = {Calibrating spectrometers for measurements of the spectral irradiance caused by solar radiation}, journal = {Metrologia}, year = {2020}, month = {8}, day = {17}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {spectral irradiance, solar radiation, measurement uncertainty analysis, spectrometer, spectroradiometer, calibration, solar simulator}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abafc5}, stag_bib_extends_levelofaccess = {NA}, author = {Schinke, C. and Pollex, H. and Hinken, D. and Wolf, M. and Bothe, K. and Kroeger, I. and Nevas, S. and Winter, S.} } @Article { KrehlikSB2020, subid = {1738}, title = {Electrical regeneration for long-haul fiber-optic time and frequency distribution systems}, journal = {Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2020}, month = {8}, day = {13}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, keywords = {Time and frequency transfer, fiber optics, optical-electrical-optical regeneration}, web_url = {https://ieeexplore.ieee.org/document/9166557}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TUFFC.2020.3016610}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, Ł. and Buczek, Ł.} } @Proceedings { KazemipourHWAHRSZ2020, subid = {1663}, title = {VNA-Based Material Characterization in THz Domain without Classic Calibration and Time-Gating}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, volume = {N/A}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1-2}, keywords = {Material characterization, parameter extraction, VNA time-gating, RF metrology, measurement uncertainty}, web_url = {https://doi.org/10.5281/zenodo.4243044}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Denver, CO, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5898-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM49742.2020.9191818}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Allal, D. and Hudlicka, M. and Ruefenacht, J. and Stalder, D. and Zeier, M.} } @Proceedings { vanVeghelSvHRvMK2020, subid = {2103}, title = {Towards improved standardization of electricity meter testing}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Energy measurement,electromagnetic compatibility,measurement errors,electricity meters}, web_url = {https://www.techrxiv.org/articles/preprint/Towards_improved_standardization_of_electricity_meter_testing/13469622/1}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Bolder}, event_name = {Conference of Precession Electromagnetic MeasurementsPEM}, event_date = {01-08-2020 to 07-08-2020}, language = {30}, DOI = {10.1109/CPEM49742.2020.9191719}, stag_bib_extends_levelofaccess = {NA}, author = {van Veghel, M.G.A. and Sharma, S. and van den Brom, H.E. and Hoogenboom, D. and Rietveld, G. and van Leeuwen, R. and Marais, Z. and Kok, G.J.P.} } @Article { RuutelYKSIDHHTBL2020, subid = {2185}, title = {Design, synthesis and application of carbazole macrocycles in anion sensors}, journal = {Beilstein Journal of Organic Chemistry}, year = {2020}, month = {8}, volume = {16}, number = {2020}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1901-1914}, keywords = {anion sensors; carboxylates;ionophores; acrocycles; sensor prototype}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Beilstein Institut}, language = {30}, ISSN = {1860-5397}, DOI = {10.3762/bjoc.16.157}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"u}{\"u}tel, A. and Yrj{\"a}n{\"a}, V. and Kadam, S.A. and Saar, I. and Ilisson, M. and Darnell, A. and Haav, K. and Haljasorg, T. and Toom, L. and Bobacka, J. and Leito, I.} } @Article { KazemipourWHHYRSGZ2020, subid = {1603}, title = {Analytical Uncertainty Evaluation of Material Parameter Measurements at THz Frequencies}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2020}, month = {7}, day = {24}, volume = {41}, number = {10}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1199 - 1217}, keywords = {Material characterization, Extraction method, THz domain, Sensitivity coefficient, Measurement uncertainty, RF metrology}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1866-6892, 1866-6906}, DOI = {10.1007/s10762-020-00723-0}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Wollensack, M. and Hoffmann, J. and Hudlicka, M. and Yee, S-K. and R{\"u}fenacht, J. and Stalder, D. and G{\"a}umann, G. and Zeier, M.} } @Article { ivkoviBKJH2020, subid = {2030}, title = {Traceable Determination of Atmospheric Mercury Using Iodinated Activated Carbon Traps}, journal = {Atmosphere}, year = {2020}, month = {7}, day = {24}, volume = {11}, number = {8}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {780}, keywords = {Mercury, sorbent traps, atmosphere, traceability}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4433}, DOI = {10.3390/atmos11080780}, stag_bib_extends_levelofaccess = {NA}, author = {Živković, I. and Berisha, S. and Kotnik, J. and Jagodic, M. and Horvat, Milena} } @Article { MayerBTOPAGMIMSK2020, subid = {1600}, title = {Flexible numerical simulation framework for dynamic PET-MR data}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {7}, day = {21}, volume = {65}, number = {14}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, pages = {145003}, keywords = {PET-MR,motion correction,simulation,image registration,open source}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab7eee}, stag_bib_extends_levelofaccess = {NA}, author = {Mayer, J. and Brown, R. and Thielemans, K. and Ovtchinnikov, E. and Pasca, E. and Atkinson, D. and Gillman, A. and Marsden, P. and Ippoliti, M. and Makowski, M. and Schaeffter, T. and Kolbitsch, C.} } @Article { BodermannBZMKSDHDK2020, subid = {1559}, title = {Quasi-bound states in the continuum for deep subwavelength structural information retrieval for DUV nano-optical polarizers}, journal = {Optics Express}, year = {2020}, month = {7}, day = {20}, volume = {28}, number = {16}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {23122}, keywords = {quasi-bound states}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.396044}, stag_bib_extends_levelofaccess = {NA}, author = {Bodermann, B. and Burger, S. and Zeitner, U. and Meyer, J. and K{\"a}seberg, T. and Siefke, T. and Dickmann, W. and Hurtado, C.B.R. and Dickmann, J. and Kroker, S.} } @Article { FretwellLBKDLMPRSF2020, subid = {1539}, title = {Direct Measurement of the 7Be L/K Capture Ratio in Ta-Based Superconducting Tunnel Junctions}, journal = {Physical Review Letters}, year = {2020}, month = {7}, day = {14}, volume = {125}, number = {3}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {032701}, keywords = {7Be, Electron captures, Cryogenic detectors, Theoretical calculations}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2003.04921}, author = {Fretwell, S. and Leach, K.G. and Bray, C. and Kim, G.B. and Dilling, J. and Lennarz, A. and Mougeot, X. and Ponce, F. and Ruiz, C. and Stackhouse, J. and Friedrich, S.} } @Article { BogoalecKosirCKGZM2020, subid = {2145}, title = {Digital PCR method for detection and quantification of specific antimicrobial drug-resistance mutations in human cytomegalovirus}, journal = {Journal of Virological Methods}, year = {2020}, month = {7}, volume = {281}, number = {/}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, pages = {113864}, keywords = {Digital PCR, Antimicrobial-Drug resistance, HCMV, Polymerase chain reaction, Viruses}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0166-0934}, DOI = {10.1016/j.jviromet.2020.113864}, stag_bib_extends_levelofaccess = {NA}, author = {Bogožalec Košir, A. and Cvelbar, T. and Kammel, M. and Grunert, H-P. and Zeichhardt, H. and Milavec, M.} } @Article { HeeringSCANNQRBBNSLLURVSDRKL2020, subid = {1554}, title = {Symmetric Potentiometric Cells for the Measurement of Unified pH Values}, journal = {Symmetry}, year = {2020}, month = {7}, volume = {12}, number = {7}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1150}, keywords = {unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-8994}, DOI = {10.3390/sym12071150}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, Agnes and Stoica, Daniela and Cam{\~o}es, Filomena and Anes, B{\'a}rbara and Nagy, D{\'a}niel and Nagyn{\'e} Szil{\'a}gyi, Zs{\'o}fia and Quendera, Raquel and Ribeiro, Luis and Bastkowski, Frank and Born, Rasmus and Nerut, Jaak and Saame, Jaan and Lainela, Silvie and Liv, Lokman and Uysal, Emrah and Rozikov{\'a}, Matilda and Vičarov{\'a}, Martina and Snedden, Alan and Deleebeeck, Lisa and Radtke, Valentin and Krossing, Ingo and Leito, Ivo} } @Miscellaneous { ElsterECNKM, subid = {1527}, title = {EMUE-D5-4-Method Comparison With Correlation}, year = {2020}, month = {6}, day = {28}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Measurement model; GUM; Straight-line regression; Correlation; Weighted total least-squares; Method comparison; Haemoglobin; AHD; HiCN}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3911584}, stag_bib_extends_levelofaccess = {NA}, author = {Elster, C. and Ellison, S. and Cowen, S. and Neukammer, J. and Klauenberg, K. and Martens, S.} } @Article { dePooterBdDKKvW2020, subid = {1629}, title = {Reference dosimetry in MRI-linacs: evaluation of available protocols and data to establish a code of practice}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {6}, day = {22}, volume = {1}, number = {1}, number2 = {19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy}, pages = {1}, keywords = {Reference dosimetry, MRI linac, Monte Carlo simulation, MR guided radiotherapy}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ab9efe}, stag_bib_extends_levelofaccess = {NA}, author = {de Pooter, J.A. and Billas, I. and de Prez, L.A. and Duane, S. and Kapsch, R-P. and Karger, C.P. and van Asselen, B. and Wolthaus, J.W.H.} } @Article { SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020, subid = {1522}, title = {Determination of consensus kQ values for megavoltage photon beams for the update of IAEA TRS-398}, journal = {Physics in Medicine and Biology}, year = {2020}, month = {6}, day = {22}, volume = {65}, number = {9}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {095011}, keywords = {TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Institute of Physics}, address = {London}, language = {30}, DOI = {10.5281/zenodo.3903294}, stag_bib_extends_levelofaccess = {NA}, author = {Seuntjens, J. and de Prez, L.A. and Pinto, M. and Pimpinella, M. and Oliver, C.P. and Ojala, J. and Muir, B. and Mirzakhanian, L. and Hanlon, M.D. and Francescon, P. and Delaunay, F. and Borbinha, J. and Ballester, F. and Andersen, C.E. and Vatnitsky, S. and McEwen, M. and Kapsch, R.P. and Burns, D.T. and Andreo, P. and Sommier, L. and Teles, P. and Tikkanen, J. and Vijande, J. and Zink, K.} } @Proceedings { RoseLKPMP2020, subid = {1590}, title = {Modulation-based long-range interferometry as basis for an optical two-color temperature sensor}, journal = {Proceedings 20th euspen International Conference and Exhibition}, year = {2020}, month = {6}, day = {12}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, keywords = {2f/3f detection, laser modulation}, web_url = {https://oar.ptb.de/files/download/5f3b86124c93900740005e17}, misc2 = {EMPIR 2018: SI Broader Scope}, event_place = {Online Conference}, event_name = {20th euspen International Conference and Exhibition}, event_date = {08-06-2020 to 12-06-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/euspen-knowledge-base/proceedings-search/\#!/author=Anni\%20Ro\&event=7871}, author = {Rose, A. and Liu, Y. and K{\"o}chert, P. and Prellinger, G. and Manske, E. and Pollinger, F.} } @Proceedings { BircherMKT2020, subid = {1758}, title = {METAS-CT: Metrological X-ray computed tomography at sub-micrometre precision}, journal = {Proceedings 20th euspen International Conference and Exhibition}, year = {2020}, month = {6}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {Industrial X-ray computed tomography, dimensional metrology, high-resolution, microtechnology, micro-parts, additive manufacturing}, web_url = {https://www.euspen.eu/knowledge-base/ICE20131.pdf}, misc2 = {EMPIR 2017: Industry}, event_place = {Online Conference}, event_name = {20th euspen International Conference and Exhibition}, event_date = {08-06-2020 to 12-06-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE20131.pdf}, author = {Bircher, B. and Meli, F. and K{\"u}ng, A. and Thalmann, R.} } @Article { KolovouGCBL2020, subid = {1524}, title = {Procedures to Measure Mean Ambient Dose Equivalent Rates Using Electret Ion Chambers}, journal = {Radiation Protection Dosimetry}, year = {2020}, month = {6}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, keywords = {electret ion chambers,ambient dose equivalent rates}, misc2 = {EMPIR 2016: Environment}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncaa061}, stag_bib_extends_levelofaccess = {NA}, author = {Leontaris, F. and Boziari, A. and Clouvas, A. and Kolovou, M. and Guilhot, J.} } @Article { HarrisLXWZYBWKCBSM2020, subid = {1578}, title = {N2O isotopocule measurements using laser spectroscopy: analyzer characterization and intercomparison}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {5}, day = {28}, volume = {13}, number = {-}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {2797–2831}, keywords = {nitrous oxide, isotopic composition, laser spectroscopy, spectral interference, matrix effect}, web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa\%3A22186}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus Gesellschaft mbH}, address = {G{\"o}ttingen}, language = {30}, DOI = {10.5194/amt-13-2797-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Harris, Stephen J. and Liisberg, Jesper and Xia, Longlong and Wei, Jing and Zeyer, Kerstin and Yu, Longfei and Barthel, Matti and Wolf, Benjamin and Kelly, Bryce F. J. and Cend{\'o}n, Dioni I. and Blunier, Thomas and Six, Johan and Mohn, Joachim} } @Miscellaneous { ElsterKM, subid = {1501}, title = {EMUE-D6-2-Calibration Uncertainty GUM vs Bayesian}, year = {2020}, month = {5}, day = {26}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Measurement model; GUM; Bayesian inference; Calibration; Straight-line regression, Least-squares estimation; Torque measuring device; VDI/VDE 2600 Blatt 2}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3858121}, stag_bib_extends_levelofaccess = {NA}, author = {Elster, C. and Klauenberg, K. and Martens, S.} } @Article { WagnerSBKLSS2020, subid = {1968}, title = {PTB-XL, a large publicly available electrocardiography dataset}, journal = {Scientific Data}, year = {2020}, month = {5}, day = {25}, volume = {7}, number = {1}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, keywords = {electrocardiography, cardiovascular system, 12 lead electrocardiography, presence of co-occurring diseases}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2052-4463}, DOI = {10.1038/s41597-020-0495-6}, stag_bib_extends_levelofaccess = {NA}, author = {Wagner, P. and Strodthoff, N. and Bousseljot, R-D. and Kreiseler, D. and Lunze, F.I. and Samek, W. and Schaeffter, T.} } @Article { RadtkePHK2020, subid = {1634}, title = {The Inverted Philosopher’s Stone: how to turn silver to a base metal}, journal = {Journal of Solid State Electrochemistry}, year = {2020}, month = {5}, day = {23}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, keywords = {Hydrogen electrode . Ionic liquid . Ion solvation . Protoelectric Potential Map}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1432-8488, 1433-0768}, DOI = {10.1007/s10008-020-04633-y}, stag_bib_extends_levelofaccess = {NA}, author = {Radtke, V. and P{\"u}tz, K. and Himmel, D. and Krossing, I.} } @Article { YamakawaBATBSNKYD2020, subid = {2039}, title = {Hg isotopic composition and total Hg mass fraction in NIES Certified Reference Material No. 28 Urban Aerosols}, journal = {Analytical and Bioanalytical Chemistry}, year = {2020}, month = {5}, day = {18}, volume = {412}, number = {19}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {4483-4493}, keywords = {Hg isotopic composition, Certified Reference Material, Urban Aerosols}, misc2 = {EMPIR 2016: Environment}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-020-02691-9}, stag_bib_extends_levelofaccess = {NA}, author = {Yamakawa, A. and B{\'e}rail, S. and Amouroux, D. and Tessier, E. and Barre, J. and Sano, T. and Nagano, K. and Kanwal, S. and Yoshinaga, J. and Donard, O.F.X.} } @Article { KongJTLTM2020, subid = {2746}, title = {Measurement-induced, spatially-extended entanglement in a hot, strongly-interacting atomic system}, journal = {Nature Communications}, year = {2020}, month = {5}, day = {15}, volume = {11}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Sensing beyond QSL, entanglement, hot atoms}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-020-15899-1 |}, stag_bib_extends_levelofaccess = {NA}, author = {Kong, J. and Jim{\'e}nez-Mart{\'i}nez, R. and Troullinou, C. and Lucivero, V.G. and T{\'o}th, G. and Mitchell, M.W.} } @Article { WeituschatDGRKP2020, subid = {1983}, title = {Photonic and Thermal Modelling of Microrings in Silicon, Diamond and GaN for Temperature Sensing}, journal = {Nanomaterials}, year = {2020}, month = {5}, day = {12}, volume = {10}, number = {5}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {934}, keywords = {finite-element-simulation; optical ring resonator; diamond; silicon; gallium nitride;temperature sensor; thermal modelling; two-photon absorption; self-heating}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano10050934}, stag_bib_extends_levelofaccess = {NA}, author = {Weituschat, L.M. and Dickmann, W. and Guimbao, J. and Ramos, D. and Kroker, S. and Postigo, P-A.} } @Article { WeituschatDGRKP2020_2, subid = {2238}, title = {Photonic and Thermal Modelling of Microrings in Silicon, Diamond and GaN for Temperature Sensing}, journal = {Nanomaterials}, year = {2020}, month = {5}, day = {12}, volume = {10}, number = {5}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {934}, keywords = {finite-element-simulation; optical ring resonator; diamond; silicon; gallium nitride;temperature sensor; thermal modelling; two-photon absorption; self-heating}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano10050934}, stag_bib_extends_levelofaccess = {NA}, author = {Weituschat, L.M. and Dickmann, W. and Guimbao, J. and Ramos, D. and Kroker, S. and Postigo, P.A.} } @Article { KasebergSKB2020, subid = {1595}, title = {Inverted plasmonic lens design for nanometrology applications}, journal = {Measurement Science and Technology}, year = {2020}, month = {5}, volume = {31}, number = {7}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {074013}, keywords = {Plasmonics, Metrology, Plasmonic lens, Microscopy, Nanostructures, Finite Element Method}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab7e6b}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}seberg, T. and Siefke, T. and Kroker, S. and Bodermann, B.} } @Article { KatiFS2020, subid = {1655}, title = {Investigation of Temperature-Induced Errors in XCT Metrology}, journal = {International Journal of Automation Technology}, year = {2020}, month = {5}, volume = {14}, number = {3}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {484-490}, keywords = {length metrology, computed tomography, traceability, temperature measurement}, web_url = {https://www.fujipress.jp/ijat/au/ijate001400030484/}, misc2 = {EMPIR 2017: Industry}, publisher = {Fuji Technology Press Ltd.}, language = {30}, ISSN = {1883-8022, 1881-7629}, DOI = {10.20965/ijat.2020.p0484}, stag_bib_extends_levelofaccess = {NA}, author = {Katić, M. and Ferdelji, N. and Sestan, D.} } @Article { MartinezABNVJHKVKL2020, subid = {1488}, title = {Step height standards based on self-assembly for 3D metrology of biological samples}, journal = {Measurement Science and Technology}, year = {2020}, month = {4}, day = {23}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {nanometrology, transfer standard, calibration, CSI, SWLI, AFM, traceability}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab8c6a}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, V. and Kassamakov, I. and Viitala, T. and J{\"a}rvinen, M. and Vainikka, T. and Nolvi, A. and Bermudez, C. and Artigas, R. and Martinez, P. and Korpelainen, V. and Lassila, A.} } @Article { RonnbergBGMK2020, subid = {1492}, title = {Comparison of Measurement Methods for the Frequency Range 2–150 kHz (Supraharmonics) Based on the Present Standards Framework}, journal = {IEEE Access}, year = {2020}, month = {4}, day = {15}, volume = {8}, number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods}, pages = {77618-77630}, keywords = {Distortion measurement, electromagnetic compatibility, measurement standards, powerquality, supraharmonics, frequency domain analysis}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=9067844}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2169-3536}, DOI = {10.1109/ACCESS.2020.2987996}, stag_bib_extends_levelofaccess = {NA}, author = {Khokhlov, V. and Meyer, J. and Grevener, A. and Busatto, T. and Ronnberg, S.} } @Article { ZhuKPRLP2020, subid = {1480}, title = {Combining Harmonic Laser Beams by Fiber Components for Refractivity–Compensating Two-Color Interferometry}, journal = {Journal of Lightwave Technology}, year = {2020}, month = {4}, volume = {38}, number = {7}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {1945-1952}, keywords = {Beam properties, photonics crystal fiber (PCF), two–color interferometry, wavelength division multiplexing (WDM)}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0733-8724, 1558-2213}, DOI = {10.1109/JLT.2019.2960473}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, Y. and Rose, A. and Prellinger, G. and K{\"o}chert, P. and Zhu, J. and Pollinger, F.} } @Article { YacootKHDDRVN2020, subid = {1489}, title = {Multiple fibre interferometry setup for probe sample interaction measurements in atomic force microscopy}, journal = {Measurement Science and Technology}, year = {2020}, month = {4}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {atomic force microscopy, Fibre interferometry, probe sample interaction, nanometrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab85d8}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P. and Yacoot, A. and Hortv{\'i}k, V. and Duchoň, V. and Dongmo, H. and Rerucha, S. and Valtr, M. and Nečas, D.} } @Article { SliwczynskiKIESPB2020, subid = {1851}, title = {Fiber-Based UTC Dissemination Supporting 5G Telecommunications Networks}, journal = {IEEE Communications Magazine}, year = {2020}, month = {4}, volume = {58}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {67-73}, keywords = {time transfer, frequency transfer, fiber optic, 5G, network synchronization, synchronization supervision}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.5281/zenodo.3903158}, stag_bib_extends_levelofaccess = {NA}, author = {Śliwczyński, L. and Krehlik, P. and Imlau, H. and Ender, H. and Schnatz, H. and Piester, D. and Bauch, A.} } @Article { PimonSKGMM2020, subid = {1500}, title = {DFT calculation of 229thorium-doped magnesium fluoride for nuclear laser spectroscopy}, journal = {Journal of Physics: Condensed Matter}, year = {2020}, month = {4}, volume = {32}, number = {25}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {255503}, keywords = {DFT, thorium,MgF2, nuclear clock}, web_url = {https://iopscience.iop.org/article/10.1088/1361-648X/ab7c90/pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0953-8984, 1361-648X}, DOI = {10.1088/1361-648X/ab7c90}, stag_bib_extends_levelofaccess = {NA}, author = {Pimon, M. and Gugler, J. and Mohn, P. and Kazakov, G.A. and Mauser, N. and Schumm, T.} } @Miscellaneous { SousaPvCFDBKE, subid = {1467}, title = {EMUE-D1-2-Bayesian Mass Calibration}, year = {2020}, month = {3}, day = {25}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Bayesian statistics, measurement uncertainty, prior knowledge, calibration}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3726908}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Pellegrino, O. and van der Veen, A.M.H. and Cox, M.G. and Fischer, N. and Demeyer, S. and Bošnjakovic, A. and Karahodžić, V. and Elster, C.} } @Article { KueraKPBV2020, subid = {1607}, title = {Characterization of a precision modular sinewave generator}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, day = {17}, volume = {31}, number = {6}, number2 = {17RPT04: VersICaL: A versatile electrical impedance calibration laboratory based on digital impedance bridges}, pages = {064002}, keywords = {signal generator, synthesizer, voltage, calibration, metrology, impedance,AC Josephson effect}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab6f2e}, stag_bib_extends_levelofaccess = {NA}, author = {Kucera, J. and Kov{\'a}č, J. and Palafox, L. and Behr, R. and Voj{\'a}čkov{\'a}, L.} } @Article { KorpelainenXD2020, subid = {1476}, title = {Accurate tip characterization in critical dimension atomic force microscopy}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, day = {13}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {atomic force microscopy (AFM), critical dimension (CD), tip characterization, tip correction, morphological operation, dimensional nanometrology, 3D nanometrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab7fd2}, stag_bib_extends_levelofaccess = {NA}, author = {Dai, G. and Xu, L. and Hahm, K.} } @Article { ChaeKP2004, subid = {1451}, title = {Realization of 5h/e\verb=^=2 with graphene quantum Hall resistance array}, journal = {Applied Physics Letters}, year = {2020}, month = {3}, day = {4}, volume = {116}, number = {-}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {093102}, keywords = {Quantum Hall effect, quantum Hall array resistance standard, graphene}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Institute of Physics}, language = {30}, ISSN = {0003-6951 (print) 1077-3118 (w}, DOI = {10.1063/1.5139965}, stag_bib_extends_levelofaccess = {NA}, author = {Park, J. and Kim, W.-S. and Chae, D.-H.} } @Article { RussellPavierPPDYHK2020, subid = {1477}, title = {Bringing real-time traceability to high-speed atomic force microscopy}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {Metrology, high-speed atomic force microscopy, traceability, nanometrology, nanotechnology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab7ca9}, stag_bib_extends_levelofaccess = {NA}, author = {Heaps, E. and Yacoot, A. and Dongmo, H. and Picco, L. and Payton, O.D. and Russell-Pavier, F.S and Klapetek, P} } @Article { SalmiCVWVYKHS2020, subid = {1354}, title = {AlOx surface passivation of black silicon by spatial ALD: Stability under light soaking and damp heat exposure}, journal = {Journal of Vacuum Science \& Technology A}, year = {2020}, month = {3}, volume = {38}, number = {2}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {022401}, keywords = {Spatial Atomic Layer Deposition, aluminum oxide, surface passivation, light soaking, damp heat}, misc2 = {EMPIR 2016: Energy}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5133896}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, I.T.S. and Koutsourakis, G. and Virtanen, S. and Yli-Koski, M. and Wood, S. and V{\"a}h{\"a}nissi, V. and Salmi, E. and Castro, F.A. and Savin, H.} } @Article { BaumannBKEZ2020, subid = {1497}, title = {Monte Carlo calculation of beam quality correction factors in proton beams using TOPAS/GEANT4}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {3}, volume = {65}, number = {5}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {055015}, keywords = {radiotherapy dosimetry, protons}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab6e53}, stag_bib_extends_levelofaccess = {NA}, author = {Baumann, K-S. and Kaupa, S. and Bach, C. and Engenhart-Cabillic, R. and Zink, K.} } @Article { LanevskiMVHKMAKI2020, subid = {1876}, title = {Determining the shape of reflectance reference samples for curved surface reflectors}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, volume = {31}, number = {5}, number2 = {16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials}, pages = {054010}, keywords = {reflectance, Monte-Carlo, reflective insulators, foil, curved surface, reference sample,additive manufacturing}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab68bf}, stag_bib_extends_levelofaccess = {NA}, author = {Lanevski, D. and Manoocheri, F. and Vaskuri, A. and Hameury, J. and Kersting, R. and Monte, C. and Adibekyan, A. and Kononogova, E. and Ikonen, E.} } @Article { TangSLKNBMSCKMKBNMKKSSDPvM2020, subid = {1473}, title = {Clinical quantitative cardiac imaging for the assessment of myocardial ischaemia}, journal = {Nature Reviews Cardiology}, year = {2020}, month = {2}, day = {24}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, keywords = {cardiac imaging, myocardial ischaemia}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1759-5002, 1759-5010}, DOI = {10.1038/s41569-020-0341-8}, stag_bib_extends_levelofaccess = {NA}, author = {Dewey, M. and Siebes, M. and Kachelrie{\ss}, M. and Kofoed, K.F. and Maurovich-Horvat, P. and Nikolaou, K. and Bai, W. and Kofler, A. and Manka, R. and Kozerke, S. and Chiribiri, A. and Schaeffter, T. and Michallek, F. and Bengel, F. and Nekolla, S. and Knaapen, P. and Lubberink, M. and Senior, R. and Tang, M-X. and Piek, J.J. and van de Hoef, T. and Martens, J. and Schreiber, L.} } @Article { GogyanKBZ2020, subid = {1481}, title = {Characterisation and feasibility study for superradiant lasing in 40Ca atoms}, journal = {Optics Express}, year = {2020}, month = {2}, day = {24}, volume = {28}, number = {5}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {6881}, keywords = {optical clock, superradiance}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.381991}, stag_bib_extends_levelofaccess = {NA}, author = {Gogyan, A. and Kazakov, G. and Bober, M. and Zawada, M.} } @Article { TxoperenaRLFERAPCCCCHMZK2020, subid = {1505}, title = {Towards standardisation of contact and contactless electrical measurements of CVD graphene at the macro-, micro- and nano-scale}, journal = {Scientific Reports}, year = {2020}, month = {2}, day = {21}, volume = {10}, number = {1}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, pages = {3223}, keywords = {Characterization and analytical techniques,Electronic properties and devices,Imaging techniques,Materials science,Nanoscience and technology,Physics,Graphene}, web_url = {https://www.nature.com/articles/s41598-020-59851-1}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-59851-1}, stag_bib_extends_levelofaccess = {NA}, author = {Melios, C. and Huang, N. and Callegaro, L. and Centeno, A. and Cultrera, A. and Cordon, A. and Panchal, V. and Arnedo, I. and Redo-Sanchez, A. and Etayo, D. and Fernandez, M. and Lopez, A. and Rozhko, S. and Txoperena, O. and Zurutuza, A. and Kazakova, O.} } @Article { HuynhMOKABKI2020, subid = {1432}, title = {Measurement setup for differential spectral responsivity of solar cells}, journal = {Optical Review}, year = {2020}, month = {2}, day = {12}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Radiometry, Solar cell, Spectral responsivity, Efficacy, Electricity, Bifacial}, web_url = {https://link.springer.com/article/10.1007\%2Fs10043-020-00584-x}, misc2 = {EMPIR 2016: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1340-6000, 1349-9432}, DOI = {10.1007/s10043-020-00584-x}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}rh{\"a}, P. and Baumgartner, H. and Askola, J. and Kylm{\"a}nen, K. and Oksanen, B. and Maham, K. and Huynh, V. and Ikonen, E.} } @Techreport { WeberHSRDBMHKMENHSW2020, subid = {1431}, title = {Document specifying rules for the secure use of DCC covering legal aspects of metrology}, journal = {Zenodo}, year = {2020}, month = {2}, day = {12}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {digital calibration certificate (DCC) cryptography minimum requirements data communication IoT-communication IoT-networking SmartCom}, web_url = {https://zenodo.org/record/3664211\#.XlO2QTFKhaR}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.3664211}, stag_bib_extends_levelofaccess = {NA}, author = {Weber, H. and Hutzschenreuter, D. and Smith, I. and Rhodes, S. and Dawkins, J. and Brown, C. and Maennel, O. and Hovhannisyan, K. and Kuosmanen, P. and Mustap{\"a}{\"a}, T. and Elo, T. and Nikander, P. and Heeren, W. and Sch{\"o}nhals, S. and Wiedenh{\"o}fer, Th.} } @Article { BeyerKP2020, subid = {1356}, title = {An unfolding algorithm for high resolution microcalorimetric beta spectrometry}, journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment}, year = {2020}, month = {2}, volume = {953}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {163128}, keywords = {Beta spectrometry, Unfolding, Deconvolution, Microcalorimeter, Monte Carlo Simulation, Bremsstrahlung}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2019.163128}, stag_bib_extends_levelofaccess = {NA}, author = {Paulsen, M. and Kossert, K. and Beyer, J.} } @Manual { PearceABEdIKS2020, subid = {1766}, title = {Guidelines on the Calibration of Thermocouples: EURAMET Calibration Guide No. 8}, year = {2020}, month = {2}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, keywords = {Thermocouples, calibration, thermoelectric, thermometry, ITS-90, EMPRESS 2}, web_url = {https://www.euramet.org/publications-media-centre/calibration-guidelines/}, misc2 = {EMPIR 2017: Industry}, publisher = {EURAMET}, address = {Braunschweig}, language = {30}, ISBN = {ISBN 978-3-942992-57-2}, ISSN = {N/A}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISBN 978-3-942992-57-2}, author = {Pearce, J. and Arifovic, N. and Bojkovski, J. and Edler, F. and de Groot, M. and Izquierdo, G.G. and Kalemci, M. and Strnad, R.} } @Proceedings { ObatonKRMBACD2020, subid = {1759}, title = {Reference standards for XCT measurements of additively manufactured parts }, journal = {Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020}, year = {2020}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {152}, keywords = {X-ray computed tomography (XCT), dimensional metrology, reference standards, additive manufacturing}, web_url = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {10th Conference on Industrial Computed Tomography (iCT 2020)}, event_date = {04-02-2020 to 07-02-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf}, author = {Obaton, A. and Klingaa, C. and Rivet, C. and Mohaghegh, K. and Baier, S. and Andreasen, J. and Carli, L. and De Chiffre, L.} } @Article { OverneyPBKBJ2020, subid = {1546}, title = {Load compensation bridge for Josephson arbitrary waveform synthesizers}, journal = {Measurement Science and Technology}, year = {2020}, month = {1}, day = {31}, volume = {31}, number = {5}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {055004}, keywords = {Load compensation bridge for Josephson arbitrary}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab62c7}, stag_bib_extends_levelofaccess = {NA}, author = {Overney, F. and Pimsut, Y. and Bauer, S. and Kieler, O. and Behr, R. and Jeanneret, B.} } @Article { SchwarzSSBKLMCS2020, subid = {1540}, title = {Coherent laser spectroscopy of highly charged ions using quantum logic}, journal = {Nature}, year = {2020}, month = {1}, day = {29}, volume = {578}, number = {7793}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {60-65}, keywords = {spectroscopy highly charged ions atomic clocks3}, web_url = {https://arxiv.org/abs/2010.15984}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0028-0836, 1476-4687}, DOI = {10.1038/s41586-020-1959-8}, stag_bib_extends_levelofaccess = {NA}, author = {Schwarz, M. and Schm{\"o}ger, L. and Spie{\ss}, L.J. and Benkler, E. and King, S.A. and Leopold, T. and Micke, P. and Crespo L{\'o}pez-Urrutia, J.R. and Schmidt, P.O.} } @Article { HatanoMKTIGFTHGGB2020, subid = {1394}, title = {Spectroscopic investigations of negatively charged tin-vacancy centres in diamond}, journal = {New Journal of Physics}, year = {2020}, month = {1}, day = {23}, volume = {22}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {013048}, keywords = {colour centres, diamond, tin-vacancy centre, single photons,Fourier-limited Emission lines,electron–Phonon scattering}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab6631/pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab6631}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}rlitz, J. and Herrmann, D. and Thiering, G. and Fuchs, P. and Gandil, M. and Iwasaki, T. and Taniguchi, T. and Kieschnick, M. and Meijer, J. and Hatano, M. and Gali, A. and Becher, C.} } @Article { SetionoBNXFKUDFSWP2020, subid = {2362}, title = {In-Plane and Out-of-Plane MEMS Piezoresistive Cantilever Sensors for Nanoparticle Mass Detection}, journal = {Sensors}, year = {2020}, month = {1}, day = {22}, volume = {20}, number = {3}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {618}, keywords = {MEMS piezoresistive cantilever sensors, dynamic mode, carbon nanoparticle, particle mass measurement}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20030618}, stag_bib_extends_levelofaccess = {NA}, author = {Setiono, A. and Bertke, M. and Nyang’au, W.O. and Xu, J. and Fahrbach, M. and Kirsch, I. and Uhde, E. and Deutschinger, A. and Fantner, E.J. and Schwalb, C. H. and Wasisto, H.S. and Peiner, E.} } @Article { FortmeierSLMSHBBKSE2020, subid = {1374}, title = {Round robin comparison study on the form measurement of optical freeform surfaces}, journal = {Journal of the European Optical Society-Rapid Publications}, year = {2020}, month = {1}, volume = {16}, number = {1}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, keywords = {Freeform optical surfaces, Metrology, Interlaboratory comparison}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1990-2573}, DOI = {10.1186/s41476-019-0124-1}, stag_bib_extends_levelofaccess = {NA}, author = {Fortmeier, I. and Schachtschneider, R. and L{\'e}dl, V. and Matoušek, O. and Siepmann, J. and Harsch, A. and Beisswanger, R. and Bitou, Y. and Kondo, Y. and Schulz, M. and Elster, C.} } @Article { MinkMFMZSBSMNAAL2020, subid = {1399}, title = {Experimental Low-Latency Device-Independent Quantum Randomness}, journal = {Physical Review Letters}, year = {2020}, month = {1}, volume = {124}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {quantum randomness}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.124.010505}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1812.07786}, author = {Zhang, Y. and Shalm, L.K. and Bienfang, J.C. and Stevens, M.J. and Mazurek, M.D. and Nam, S.W. and Abell{\'a}n, C. and Amaya, W. and Mitchell, M.W. and Fu, H. and Miller, C.A. and Mink, A. and Knill, E.} } @Proceedings { HahtelaKLMMPYBGKMMPP2020, subid = {1810}, title = {Coulomb Blockade Thermometry on a Wide Temperature Range}, journal = {Proceedings of 2020 Conference on Precision Electromagnetic Measurements (CPEM 2020)}, year = {2020}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, keywords = {Temperature measurement, thermometers, cryogenics, nanoelectronics, tunneling, single electron devices}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Denver (Aurora), CO, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM 2020)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2101.03932}, author = {Hahtela, O.M. and Kemppinen, A. and Lehtinen, J. and Manninen, A.J. and Mykk{\"a}nen, E. and Prunnila, M. and Yurttag{\"u}l, N. and Blanchet, F. and Gramich, M. and Karimi, B. and Mannila, E.T. and Muhojoki, J. and Peltonen, J.T. and Pekola, J.P.} } @Article { BurkeUK2020, subid = {1644}, title = {A psychoacoustical study to investigate the perceived unpleasantness of infrasound combined with audio-frequency sound}, journal = {Acta Acustica}, year = {2020}, volume = {4}, number = {5}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {20}, keywords = {Infrasound / Unpleasantness / Psychoacoustic scaling methods / Detection threshold}, misc2 = {EMPIR 2015: Health}, publisher = {EDP Sciences}, language = {30}, ISSN = {2681-4617}, DOI = {10.1051/aacus/2020019}, stag_bib_extends_levelofaccess = {NA}, author = {Burke, E. and Uppenkamp, S. and Koch, C.} } @Article { SchoneweisKK2020, subid = {2545}, title = {A laboratory study for occupational safety and health on the structure of airborne ultrasound fields}, journal = {Acta Acustica}, year = {2020}, volume = {4}, number = {4}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {12}, keywords = {occupational safety, aorborne-ultrasound, noise,}, misc2 = {EMPIR 2015: Health}, publisher = {EDP Sciences}, language = {30}, ISSN = {2681-4617}, DOI = {10.1051/aacus/2020013}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"o}newei{\ss}, R. and Kling, C. and Koch, C.} } @Article { BurkeUK2020_2, subid = {2543}, title = {A psychoacoustical study to investigate the perceived unpleasantness of infrasound combined with audio-frequency sound}, journal = {Acta Acustica}, year = {2020}, volume = {4}, number = {5}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {20}, keywords = {annoyance, infrasound, unpleaseantness, hearing experiment}, misc2 = {EMPIR 2015: Health}, publisher = {EDP Sciences}, language = {30}, ISSN = {2681-4617}, DOI = {10.1051/aacus/2020019}, stag_bib_extends_levelofaccess = {NA}, author = {Burke, E. and Uppenkamp, S. and Koch, C.} } @Article { Klaus2020, subid = {1792}, title = {Static and dynamic bridge amplifiercalibration according to ISO 4965-2}, journal = {Acta IMEKO}, year = {2020}, volume = {9}, number = {5}, number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services}, pages = {200-204}, keywords = {Dynamic measurement, International standard ISO 4965, dynamic calibration, force transducers}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-42}, misc2 = {EMPIR 2018: SI Broader Scope}, language = {30}, DOI = {10.21014/acta_imeko.v9i5.969}, stag_bib_extends_levelofaccess = {NA}, author = {Klaus, L.} } @Article { WodarczykKl2020, subid = {1691}, title = {A MAINTENANCE-FREE SOLUTION FOR OPTICAL FREQUENCY TRANSFER}, journal = {Metrology and Measurement Systems}, year = {2020}, volume = {27}, number = {3}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {441–450}, keywords = {fiber-optics, optical frequency transfer, tracking filter, automatic startup}, web_url = {https://zenodo.org/record/4110659\#.X7zfu2j7Q2x}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Polish Academy of Sciences Committee on Metrology and Scientific Instrumentation}, language = {30}, ISSN = {ISSN 0860-8229}, DOI = {10.24425/mms.2020.134586}, stag_bib_extends_levelofaccess = {NA}, author = {Włodarczyk, P. and Krehlik, P. and Śliwczyński, Ł.} } @Proceedings { ShlomaSKNPP2020, subid = {1528}, title = {Analysis of accuracy requirements to the meteorological sensors used to compensate for the influence of the Earth’s atmosphere in high precision length measurement}, journal = {SMSI Sensor and Measurement Science International}, year = {2020}, volume = {SMSI 2020}, number = {2020}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {279 - 280}, keywords = {length measurement, meteorological sensors, refractive index, gradient method, GeoMetre}, web_url = {https://www.ama-science.org/proceedings/details/3759}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {AMA Association for Sensors and Measurement}, address = {Berlin}, event_place = {Nuremberg, Germany}, event_name = {SMSI 2020}, event_date = {22-06-2020 to 25-06-2020}, language = {30}, ISBN = {978-3-9819376-2-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {dx.doi.org/10.5162/SMSI2020/D3.3}, author = {Shloma, A. and Skliarov, V. and Kupko, V. and Neyezhmakov, P. and Panasenko, T. and Prokopov, A.} } @Article { GuoPBGPKHU2020, subid = {1494}, title = {Interaction of nanoparticle properties and X-ray analytical techniques}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, volume = {35}, number = {5}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {1022-1033}, keywords = {X-ray Standing Wavefield, GIXRF, TXRF, NEXAFS, Core-Shell Nanoparticles}, web_url = {https://arxiv.org/abs/2004.02955}, misc2 = {EMPIR 2016: Environment}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/D0JA00049C}, stag_bib_extends_levelofaccess = {NA}, author = {Unterumsberger, R. and Honicke, P. and Kayser, Y. and Pollakowski-Herrmann, B. and Gholhaki, S. and Guo, Q. and Palmer, R.E. and Beckhoff, B.} } @Article { WanslebenVWBHBK2020, subid = {1685}, title = {Speciation of iron sulfide compounds by means of X-ray emission spectroscopy using a compact full-cylinder von Hamos spectrometer}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, volume = {35}, number = {11}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {2679-2685}, keywords = {-}, web_url = {https://arxiv.org/abs/2005.09509}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/D0JA00244E}, stag_bib_extends_levelofaccess = {NA}, author = {Wansleben, M. and Vinson, J. and W{\"a}hlisch, A. and Bzheumikhova, K. and Honicke, P. and Beckhoff, B. and Kayser, Y.} } @Article { CaraMSGRCDHKBMZCLBF2020, subid = {1829}, title = {Towards a traceable enhancement factor in surface-enhanced Raman spectroscopy}, journal = {Journal of Materials Chemistry C}, year = {2020}, volume = {8}, number = {46}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {16513-16519}, keywords = {Raman spectroscopy (SERS)}, misc2 = {EMPIR 2016: Environment}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2050-7526, 2050-7534}, DOI = {10.1039/D0TC04364H}, stag_bib_extends_levelofaccess = {NA}, author = {Cara, E. and Mandrile, L. and Sacco, A. and Giovannozzi, A.M. and Rossi, A.M. and Celegato, F. and De Leo, N. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Marchi, D. and Zoccante, A. and Cossi, M. and Laus, M. and Boarino, L. and Ferrarese Lupi, F.} } @Article { ZilbertiKLGCBAZ2020, subid = {1334}, title = {Accuracy Assessment of Numerical Dosimetry for the Evaluation of Human Exposure to Electric Vehicle Inductive Charging Systems}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2020}, volume = {ea}, number = {ea}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-12}, keywords = {Basic restrictions, electric vehicles, electro-magnetic fields, inductive charging, numerical dosimetry, safety}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2019.2954111}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Bottauscio, O. and Chiampi, M. and Giaccone, L. and Liorni, I. and Kuster, N. and Zilberti, L. and Zucca, M.} } @Article { KendigVUMZ2020, subid = {1438}, title = {Dynamic Temperature Measurements of a GaN DC/DC Boost Converter at MHz Frequencies}, journal = {IEEE Transactions on Power Electronics}, year = {2020}, volume = {Not yet pr}, number = {Not yet pr}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {1-1}, keywords = {Thermoreflectance measurement , boost converter , gallium nitride, power transistor}, web_url = {http://epubs.surrey.ac.uk/853825/}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-8993, 1941-0107}, DOI = {10.1109/TPEL.2020.2964996}, stag_bib_extends_levelofaccess = {NA}, author = {Matei, C. and Urbonas, J. and Votsi, H. and Kendig, D. and Aaen, P.H.} } @Article { TummonLKCCCAZSV2020, subid = {1472}, title = {Real-time pollen monitoring using digital holography}, journal = {Atmospheric Measurement Techniques}, year = {2020}, volume = {13}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {1539–1550}, keywords = {pollen monitoring, digital holography,}, web_url = {https://www.atmos-meas-tech.net/13/1539/2020/}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus Publications}, language = {30}, DOI = {10.5194/amt-13-1539-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Sauvageat , E. and Zeder, Y. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Konzelmann, T. and Lieberherr, G. and Tummon, F. and Vasilatou, K.} } @Article { LofdahlJFKKL2020, subid = {1619}, title = {Silver Nanoparticles Alter Cell Viability Ex Vivo and in Vitro and Induce Proinflammatory Effects in Human Lung Fibroblasts}, journal = {Nanomaterials}, year = {2020}, volume = {10}, number = {9}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, pages = {1868}, keywords = {silver nanoparticles; human lung fibroblasts; precision-cut lung slices; toxicity;extracellular matrix; procollagen; growth factors; cytokines}, misc2 = {EMPIR 2018: Health}, language = {30}, DOI = {10.3390/nano10091868}, stag_bib_extends_levelofaccess = {NA}, author = {L{\"o}fdahl, A. and Jern, A. and Flyman, S. and K{\aa}redal, M. and Karlsson, H.L. and Larsson-Callerfelt , A-K.} } @Article { FidelusK2020, subid = {1793}, title = {GUM’s Rockwell hardness standard machines after modernization}, journal = {ACTA IMEKO}, year = {2020}, volume = {9}, number = {5}, number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services}, pages = {240-246}, keywords = {twin deadweight-type Rockwell hardness standard machines, GUM, hydraulic pump, displacement measuring system,}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-50}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {ACTA IMEKO}, language = {30}, DOI = {10.21014/acta_imeko.v9i5.977}, stag_bib_extends_levelofaccess = {NA}, author = {Fidelus, J. and Kozuchowski, M. } } @Article { SachseBSHHKNL2020, subid = {2015}, title = {Colloidal bimetallic platinum–ruthenium nanoparticles in ordered mesoporous carbon films as highly active electrocatalysts for the hydrogen evolution reaction}, journal = {Catalysis Science \& Technology}, year = {2020}, volume = {10}, number = {7}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {2057-2068}, keywords = {Hydrogen, Nanoparticles, Hyrdrogen evolution reaction (HER)}, web_url = {https://pubs.rsc.org/en/content/articlelanding/2020/CY/C9CY02285F\#!divAbstract}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2044-4753, 2044-4761}, DOI = {10.1039/C9CY02285F}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Bernsmeier, D. and Schmack, R. and H{\"a}usler, I. and Hertwig, A. and Kraffert, K. and Nissen, J. and Lewis, H.} } @Article { PottieAQCLRWKKG2019, subid = {1393}, title = {Combining fiber Brillouin amplification with a repeater laser station for fiber-based optical frequency dissemination over 1400 km}, journal = {New Journal of Physics}, year = {2019}, month = {12}, day = {13}, volume = {21}, number = {.}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {123017}, keywords = {optical frequency dissemination}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab5d95}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOPscience}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab5d95}, stag_bib_extends_levelofaccess = {NA}, author = {Koke, S. and Kuhl, A. and Waterholter, T. and Raupach, S.M.F. and Lopez, O. and Cantin, E. and Quintin, N. and Amy-Klein, A. and Pottie, P.-E. and Grosche, G.} } @Article { KlenovskyCSRCLHR2019, subid = {1360}, title = {Single-particle-picture breakdown in laterally weakly confining GaAs quantum dots}, journal = {Physical Review B}, year = {2019}, month = {12}, day = {13}, volume = {100}, number = {23}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {GaAs, quantum dot}, web_url = {https://journals.aps.org/prb/pdf/10.1103/PhysRevB.100.235425}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.235425}, stag_bib_extends_levelofaccess = {NA}, author = {Huber, D. and Lehner, B.U. and Csontosov{\'a}, D. and Reindl, M. and Schuler, S. and Covre Da Silva, S.F. and Klenovsk{\'y}, P. and Rastelli, A.} } @Article { KungBM2019, subid = {1762}, title = {Low-Cost 2D Index and Straightness Measurement System Based on a CMOS Image Sensor}, journal = {Sensors}, year = {2019}, month = {12}, day = {11}, volume = {19}, number = {24}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {5461}, keywords = {2D position sensor, 2D index sensor, straightness sensor, machine tool geometry correction}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s19245461}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ng, A. and Bircher, B.A. and Meli, F.} } @Article { RodtHSSHKFSR2019, subid = {1359}, title = {Deterministically fabricated spectrally-tunable quantum dot based single-photon source}, journal = {Optical Materials Express}, year = {2019}, month = {12}, day = {10}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {76}, keywords = {quantum dot, single-photon source}, web_url = {https://arxiv.org/ftp/arxiv/papers/1805/1805.10623.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {2159-3930}, DOI = {10.1364/OME.10.000076}, stag_bib_extends_levelofaccess = {NA}, author = {Schmidt, R. and Schmidt, M. and Helversen, M.V. and Fischbach, S. and Kaganskiy, A. and Schliwa, A. and Heindel, T. and Rodt, S. and Reitzenstein, S.} } @Article { RanitzschABBBEKKLMNPRW2019, subid = {1729}, title = {MetroMMC: Electron-Capture Spectrometry with Cryogenic Calorimeters for Science and Technology}, journal = {Journal of Low Temperature Physics}, year = {2019}, month = {12}, volume = {199}, number = {1-2}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {441-450}, keywords = {Electron-capture decay, Metallic magnetic calorimeter, Radionuclide metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0022-2291, 1573-7357}, DOI = {10.1007/s10909-019-02278-4}, stag_bib_extends_levelofaccess = {NA}, author = {Ranitzsch, P.C-O. and Arnold, D. and Beyer, J. and Bockhorn, L. and Bonaparte, J.J. and Enss, C. and Kossert, K. and Kempf, S. and Loidl, M. and Mariam, R. and N{\"a}hle, O. J. and Paulsen, M. and Rodrigues, M. and Wegner, M.} } @Proceedings { KazemipourWHYRGHZ2019, subid = {1662}, title = {Material Parameter Extraction in THz Domain, Simplifications and Sensitivity Analysis}, journal = {2019 IEEE Asia-Pacific Microwave Conference (APMC)}, year = {2019}, month = {12}, volume = {N/A}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {276-278}, keywords = {material characterization, extraction method, THz domain, sensitivity coefficient, measurement uncertainty}, web_url = {https://doi.org/10.5281/zenodo.4243025}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Singapore}, event_name = {019 IEEE Asia-Pacific Microwave Conference (APMC)}, event_date = {10-12-2019 to 13-12-2019}, language = {30}, ISBN = {978-1-7281-3517-5}, ISSN = {N/A}, DOI = {10.1109/APMC46564.2019.9038523}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Wollensack, M. and Hoffmann, J. and Yee, S-K. and R{\"u}fenacht, J. and G{\"a}umann, G. and Hudlicka, M. and Zeier, M.} } @Article { SliwczynskiKT2019, subid = {1471}, title = {Stability limitations of optical frequency transfer in telecommunication DWDM networks}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2019}, month = {12}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {1-1}, keywords = {optical frequency transfer, DWDM network, optical fiber, alien wavelength}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010, 1525-8955}, DOI = {10.1109/TUFFC.2019.2957176}, stag_bib_extends_levelofaccess = {NA}, author = {Śliwczyński, L. and Krehlik, P. and Turza, K.} } @Article { BockhornPBKLNRR2019, subid = {1355}, title = {Improved Source/Absorber Preparation for Radionuclide Spectrometry Based on Low-Temperature Calorimetric Detectors}, journal = {Journal of Low Temperature Physics}, year = {2019}, month = {11}, day = {30}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, keywords = {Beta spectrometry, Preparation techniques, Low-temperature detectors}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0022-2291, 1573-7357}, DOI = {10.1007/s10909-019-02274-8}, stag_bib_extends_levelofaccess = {NA}, author = {Bockhorn, L. and Paulsen, M. and Beyer, J. and Kossert, K. and Loidl, M. and N{\"a}hle, O. J. and Ranitzsch, P. C.-O. and Rodrigues, M.} } @Article { GeislerNBHSRKWHTHMSU2019, subid = {1316}, title = {Determining the Thickness and Completeness of the Shell of Polymer Core–Shell Nanoparticles by X-ray Photoelectron Spectroscopy, Secondary Ion Mass Spectrometry, and Transmission Scanning Electron Microscopy}, journal = {The Journal of Physical Chemistry C}, year = {2019}, month = {11}, day = {26}, number2 = {17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses}, keywords = {Nanoparticles, core-shell, XPS, SIMS, T-SEM, polymer}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.9b09258}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, A. and Heinrich, T. and Tougaard, S. and Werner, W. S. M. and Hronek, M. and Kunz, V. and Radnik, J. and Stockmann, J. M. and Hodoroaba, V-D. and Benemann, S. and Nirmalananthan-Budau, N. and Gei{\ss}ler, D. and Sparnacci, K. and Unger, W. E. S } } @Article { KashcheyevsFBJLSGFRK2019, subid = {1312}, title = {Continuous-variable tomography of solitary electrons}, journal = {Nature Communications}, year = {2019}, month = {11}, day = {22}, volume = {10}, number = {1}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, keywords = {Single electron, Electron wave packet, Tomography}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-13222-1}, stag_bib_extends_levelofaccess = {NA}, author = {Fletcher, J. D. and Johnson, N. and Locane, E. and See, P. and Griffiths, J. P. and Farrer, I. and Ritchie, D. A. and Brouwer, P. W. and Kashcheyevs, V. and Kataoka, M.} } @Article { BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019, subid = {2340}, title = {The Metrological Traceability, Performance and Precision of European Radon Calibration Facilities}, journal = {International Journal of Environmental Research and Public Health}, year = {2019}, month = {11}, day = {21}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, keywords = {radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.3390/ijerph182212150}, stag_bib_extends_levelofaccess = {NA}, author = {Beck, T.R. and Antohe, A. and Cardellini, F. and Cucoş, A. and Fialova, E. and Grossi, C. and Hening, K. and Jensen, J. and Kastratović, D. and Krivoš{\'i}k, M. and Lobner, P. and Luca, A. and Maringer, F.J. and Michielsen, N. and Otahal, P.P.S. and Quindos, L. and Rabago, D. and Sainz, C. and Sz{\"u}cs, L. and Teodorescu, T. and Tolinsson, C. and Tugulan, C.L. and Turtiainen, T. and Vargas, A. and Vosahlik, J. and Vukoslavovic, G. and Wiedner, H. and Wołoszczuk, K.} } @Article { SchneiderHHCFKRSTR2019, subid = {1362}, title = {Resolving the temporal evolution of line broadening in single quantum emitters}, journal = {Optics Express}, year = {2019}, month = {11}, day = {18}, volume = {27}, number = {24}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {35290}, keywords = {single quantum emitter, GaAs and In(Ga)As quantum dots}, web_url = {https://www.osapublishing.org/DirectPDFAccess/0872F4C8-F64C-1DD3-BF83A9359A9A78C7_423274/oe-27-24-35290.pdf?da=1\&id=423274\&seq=0\&mobile=no}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.035290}, stag_bib_extends_levelofaccess = {NA}, author = {Schimpf, C. and Reindl, M. and Klenovsk{\'y}, P. and Fromherz, T. and Covre Da Silva, S.F. and Hofer, J. and Schneider, C. and H{\"o}fling, S. and Trotta, R. and Rastelli, A.} } @Article { KlauiJPDGVCC2019, subid = {1308}, title = {Individual skyrmion manipulation by local magnetic field gradients}, journal = {Communications Physics}, year = {2019}, month = {11}, day = {15}, volume = {2}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {145}, keywords = {Skyrmion, MFM}, web_url = {https://www.nature.com/articles/s42005-019-0242-5\#article-info}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-019-0242-5}, stag_bib_extends_levelofaccess = {NA}, author = {Casiraghi, A. and Corte-Le{\'o}n, H. and Vafaee, M. and Garcia-Sanchez, F. and Durin, G. and Pasquale, M. and Jakob, G. and Kl{\"a}ui, M.} } @Article { KlauiJPDGVCC20190, subid = {1308}, title = {Individual skyrmion manipulation by local magnetic field gradients}, journal = {Communications Physics}, year = {2019}, month = {11}, day = {15}, volume = {2}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {145}, keywords = {Skyrmion, MFM}, web_url = {https://www.nature.com/articles/s42005-019-0242-5\#article-info}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-019-0242-5}, stag_bib_extends_levelofaccess = {NA}, author = {Casiraghi, A. and Corte-Le{\'o}n, H. and Vafaee, M. and Garcia-Sanchez, F. and Durin, G. and Pasquale, M. and Jakob, G. and Kl{\"a}ui, M.} } @Article { RanitzschPNMKKEBBLRS2019, subid = {1234}, title = {Beta spectrometry with metallic magnetic calorimeters in the framework of the European EMPIR project MetroBeta}, journal = {Applied Radiation and Isotopes}, year = {2019}, month = {11}, volume = {153}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {108830}, keywords = {Beta spectrometry; Metallic magnetic calorimeter; Ionizing radiation metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2019.108830}, stag_bib_extends_levelofaccess = {NA}, author = {Loidl, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Mariam, R. and N{\"a}hle, O. and Paulsen, M. and Ranitzsch, P. and Rodrigues, M. and Schmidt, M.} } @Article { ProdromakisKKPCK2019, subid = {1479}, title = {Impact of Line Edge Roughness on ReRAM Uniformity and Scaling}, journal = {Materials}, year = {2019}, month = {11}, volume = {12}, number = {23}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {3972}, keywords = {Resistive Random Access Memory (ReRAM); Line Edge Roughness (LER); variability; uniformity; modeling; lithography}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {1996-1944}, DOI = {10.3390/ma12233972}, stag_bib_extends_levelofaccess = {NA}, author = {Constantoudis, V. and Papavieros, G. and Karakolis, P. and Khiat, A. and Prodromakis, T. and Dimitrakis, P.} } @Article { IkonenKOB2019, subid = {1286}, title = {Optical Characterization of III-V Multijunction Solar Cells for Temperature-Independent Band Gap Features}, journal = {IEEE Journal of Photovoltaics}, year = {2019}, month = {11}, volume = {9}, number = {6}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {1631-1636}, keywords = {Band gap, light-emitting diode (LED), spectral response, temperature, III-V solar cells}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2019.2933190}, stag_bib_extends_levelofaccess = {NA}, author = {Baumgartner, H. and Oksanen, B. and K{\"a}rh{\"a}, P. and Ikonen, E.} } @Manual { EloKnKALSZSFRBSHWHHHNHMMHP2019, subid = {1433}, title = {SmartCom Digital System of Units (D-SI) Guide for the use of the metadata-format used in metrology for the easy-to-use, safe, harmonised and unambiguous digital transfer of metrological data}, year = {2019}, month = {11}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Digital-SI (D-SI) metrology data digital exchange format SmartCom data communication IoT-networking IoT-communication}, web_url = {https://zenodo.org/record/3522631\#.XlTbaTFKhaQ}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.3522631}, stag_bib_extends_levelofaccess = {NA}, author = {Elo, T. and Kuosmanen, P. and  Mustap{\"a}{\"a}, T. and Klobucar, R. and Acko, B. and Linkeov{\'a}, I. and S{\'y}kora, J. and Zelen{\'y}, V. and Smith, I. and Forbes, A. and Rhodes, S. and Brown, C. and Scheibner, A. and Hackel, S.G. and Wiedenh{\"o}fer, T. and Heeren, W. and Haertig, F. and Hutschenreuter, D. and Nikander, P. and Hovhannisyan, K. and Maennel, O. and Muller, B. and Heindorf, L. and Paciello, V.} } @Article { KhabipovDL2019, subid = {1256}, title = {DC measurement of dressed states in a coupled 100 GHz resonator system using a single quasiparticle transistor as a sensitive microwave detector}, journal = {Applied Physics Letters}, year = {2019}, month = {11}, volume = {115}, number = {19}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, pages = {192601}, keywords = {microwave detectors, single-electron tunneling, photon-assisted tunneling, Josephson generation, superconducting coplanar resonators, quantum oscillators, circuit QED, Josephson qubit, transmon qubit}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/1.5119220}, stag_bib_extends_levelofaccess = {NA}, author = {Lotkhov, S. V. and Dolata, R. and Khabipov, M.} } @Article { KlenovskyBMASS2019, subid = {1361}, title = {Optical response of (InGa)(AsSb)/GaAs quantum dots embedded in a GaP matrix}, journal = {Physical Review B}, year = {2019}, month = {11}, volume = {100}, number = {19}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {electronic structure, quantum dot}, web_url = {https://arxiv.org/abs/1906.09842}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.195407}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Marr{\'o}n, D.F. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { KipperHLBPHLV2019, subid = {1406}, title = {Retention of acidic and basic analytes in reversed phase column using fluorinated and novel eluent additives for liquid chromatography-tandem mass spectrometry}, journal = {Journal of Chromatography A}, year = {2019}, month = {11}, volume = {in press}, number = {in press}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {460667}, keywords = {Eluent additivesHFIPHFTBPPNFTBRetention mechanisms}, web_url = {https://www.sciencedirect.com/search/advanced?qs=Retention\%20of\%20acidic\%20and\%20basic\&pub=Journal\%20of\%20Chromatography\%20A\&cid=271409\&volumes=0\&lastSelectedFacet=volumes}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-9673}, DOI = {10.1016/j.chroma.2019.460667}, stag_bib_extends_levelofaccess = {NA}, author = {Veigure, R. and Lossmann, K. and Hecht, M. and Parman, E. and Born, R. and Leito, I. and Herodes, K. and Kipper, K.} } @Article { BinghamWSTMFZSRKH2019, subid = {1353}, title = {Formation of N{\'e}el-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy}, journal = {Physical Review B}, year = {2019}, month = {10}, day = {25}, volume = {100}, number = {14}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {144435}, keywords = {Skyrmions, DMI, spin waves}, web_url = {https://arxiv.org/abs/1910.04515}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.144435}, stag_bib_extends_levelofaccess = {NA}, author = {Saha, S. and Zelent, M. and Finizio, S. and Mruczkiewicz, M. and Tacchi, S. and Suszka, A. K. and Wintz, S. and Bingham, N. S. and Raabe, J. and Krawczyk, M. and Heyderman, L. J.} } @Article { KuckLDMCTLT2019_2, subid = {1444}, title = {A Molecule‐Based Single‐Photon Source Applied in Quantum Radiometry}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {10}, day = {22}, volume = {3}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1900083}, keywords = {quantum radiometrysingle moleculessingle‐photon detectorssingle‐photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900083}, stag_bib_extends_levelofaccess = {NA}, author = {Lombardi, P. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and L{\'o}pez, M. and K{\"u}ck, S. and Toninelli, C.} } @Article { LombardiTCMDLKT2019, subid = {1807}, title = {A Molecule‐Based Single‐Photon Source Applied in Quantum Radiometry}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {10}, day = {22}, volume = {3}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1900083}, keywords = {quantum radiometry single molecules single‐photon detectors single‐photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900083}, stag_bib_extends_levelofaccess = {NA}, author = {Lombardi, P. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and L{\'o}pez, M. and K{\"u}ck, S. and Toninelli, C.} } @Article { KayserUWBWHH2019, subid = {1269}, title = {Experimental determination of line energies, line widths and relative transition probabilities of the Gadolinium L x-ray emission spectrum}, journal = {Metrologia}, year = {2019}, month = {10}, day = {21}, volume = {56}, number = {6}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {065007}, keywords = {x-ray spectrometry, von Hamos spectrometer, rare earth metal, x-ray metrology, HAPG, gadolinium, atomic fundamental parameters}, web_url = {https://arxiv.org/abs/1903.08085}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab40d2}, stag_bib_extends_levelofaccess = {NA}, author = {Wansleben, M. and Kayser, Y. and Honicke, P. and Holfelder, I. and W{\"a}hlisch, A. and Unterumsberger, R. and Beckhoff, B.} } @Article { LaihoSSKHSBWR2019, subid = {2617}, title = {Photon-number parity of heralded single photons from a Bragg-reflection waveguide reconstructed loss-tolerantly via moment generating function}, journal = {New Journal of Physics}, year = {2019}, month = {10}, volume = {21}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {103025}, keywords = {factorial moment of photon number, photon-number parity, moment generating function, parametric down-conversion, Bragg-reflection waveguide, transition-edge sensor}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab42ae}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab42ae}, stag_bib_extends_levelofaccess = {NA}, author = {Laiho, K. and Schmidt, M. and Suchomel, H. and Kamp, M. and H{\"o}fling, S. and Schneider, C. and Beyer, J. and Weihs, G. and Reitzenstein, S.} } @Article { ToivonenK2019, subid = {1296}, title = {Dynamic Enhancement of Nitric Oxide Radioluminescence with Nitrogen Purge}, journal = {Scientific Reports}, year = {2019}, month = {9}, day = {25}, volume = {9}, number = {1}, number2 = {16ENV09: MetroDECOM II: In situ metrology for decommissioning nuclear facilities}, pages = {13884}, keywords = {Radioluminescence, nitric oxide, nitrogen purge}, web_url = {https://www.nature.com/articles/s41598-019-50396-6}, misc2 = {EMPIR 2016: Environment}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-50396-6}, stag_bib_extends_levelofaccess = {NA}, author = {Kerst, T. and Toivonen, J.} } @Article { HohlsBL2019, subid = {1310}, title = {Time-energy filtering of single electrons in ballistic waveguides}, journal = {New Journal of Physics}, year = {2019}, month = {9}, day = {19}, volume = {21}, number = {9}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {093042}, keywords = {Single electrons, time-energy filtering}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab3fbb}, stag_bib_extends_levelofaccess = {NA}, author = {Locane, E. and Brouwer, P.W. and Kashcheyevs, V.} } @Article { BlakesleyK2019, subid = {1951}, title = {Energy Rating for Evaluating Performance of Perovskite and Perovskite-on-Silicon Tandem Devices in Real-World Conditions}, journal = {36th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2019}, month = {9}, day = {13}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {623 - 628}, keywords = {Energy Rating Perovskite Based Photovoltaics}, web_url = {https://zenodo.org/record/4055579}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {3-936338-60-4}, author = {Blakesley, J.C. and Koutsourakis, G. } } @Article { PalonenOKBLGG2019, subid = {1293}, title = {Laser Spectroscopy for Monitoring of Radiocarbon in Atmospheric Samples}, journal = {Analytical Chemistry}, year = {2019}, month = {9}, day = {10}, volume = {91}, number = {19}, number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities}, pages = {12315-12320}, keywords = {Radiocarbon, Laser spectroscopy}, web_url = {https://pubs.acs.org/doi/10.1021/acs.analchem.9b02496}, misc2 = {EMPIR 2016: Environment}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0003-2700, 1520-6882}, DOI = {10.1021/acs.analchem.9b02496}, stag_bib_extends_levelofaccess = {NA}, author = {Genoud, G. and Genoud, G. and Lehmuskoski, J. and Bell, S. and Palonen, V. and Oinonen, M. and Koskinen-Soivi, M.L.} } @Proceedings { MarrowsKGDCCBSK2019, subid = {1428}, title = {Measuring Interfacial Dzyaloshinskii-Moriya Interaction: A Review}, journal = {Proceedings}, year = {2019}, month = {9}, volume = {26}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {41}, keywords = {Dzyaloshinskii-Moriya interaction}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, event_place = {Ferrara}, event_name = {XXXVII International Symposium on Dynamical Properties of Solids}, event_date = {08-09-2019 to 12-09-2019}, language = {30}, ISSN = {2504-3900}, DOI = {10.3390/proceedings2019026041}, stag_bib_extends_levelofaccess = {NA}, author = {Back, C. and Carlotti, G. and Casiraghi, A. and Durin, G. and Garcia-Sanchez, F. and Kuepferling, M. and Marrows, C. and Soares, G. and Tacchi, S.} } @Proceedings { KehrtJS2019, subid = {1445}, title = {Comparison of Waveguide and Free-Space Power Measurement in the Millimeter-Wave Range}, journal = {2019 44th International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz)}, year = {2019}, month = {9}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, keywords = {Optical waveguides, Power measurement, Detectors, Antenna measurements, Horn antennas}, web_url = {https://oar.ptb.de/files/download/5e5d0f6f4c93903e3800394c}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Paris}, event_name = {2019 44th International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz)}, event_date = {01-09-2019 to 06-09-2019}, language = {30}, stag_bib_extends_levelofaccess = {NA}, author = {Kehrt, M. and Judaschke, R. and Steiger, A.} } @Article { KorpelainenGKAS2019, subid = {1298}, title = {Atomic force microscope with an adjustable probe direction and piezoresistive cantilevers operated in tapping-mode / Im Tapping-Modus betriebenes Rasterkraftmikroskop mit einstellbarer Antastrichtung und piezoresistiven Cantilevern}, journal = {tm - Technisches Messen}, year = {2019}, month = {9}, volume = {86}, number = {s1}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {12-16}, keywords = {Rasterkraftmikroskopie; piezoresistive Cantilever; Nanomessmaschine}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2196-7113, 0171-8096}, DOI = {10.1515/teme-2019-0035}, stag_bib_extends_levelofaccess = {NA}, author = {Schaude, J. and Albrecht, J. and Kl{\"o}pzig, U. and Gr{\"o}schl, A.C. and Hausotte, Tino} } @Article { KokHvvR2019, subid = {1380}, title = {Current waveforms of household appliances for advanced meter testing}, journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {Electromagnetic compatibility , static meters , interference , accuracy , testing , household appliances}, web_url = {https://zenodo.org/record/3582391\#.XiG1P3u7KUl}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/AMPS.2019.8897771}, stag_bib_extends_levelofaccess = {NA}, author = {van Leeuwen, R. and van den Brom, H. and Hoogenboom, D. and Kok, G. and Rietveld, G.} } @Proceedings { KrokerWSKB2019, subid = {1282}, title = {Sub-Wavelength Features in Spectroscopic Mueller Matrix Ellipsometry}, journal = {Deutsche Gesellschaft f{\"u}r angewandte Optik Proceedings 2019}, year = {2019}, month = {9}, volume = {120}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Gratings, Measurement Technology, Scatterometry}, web_url = {https://www.dgao-proceedings.de/download/120/120_p9.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Deutsche Gesellschaft f{\"u}r angewandte Optik e.V. (DGaO)}, event_place = {Darmstadt}, event_name = {120. Jahrestagung der Deutschen Gesellschaft f{\"u}r angewandte Optik}, event_date = {11-06-2019 to 15-06-2019}, language = {30}, ISSN = {1614-8436}, stag_bib_extends_levelofaccess = {NA}, author = {Kroker, Stefanie and Wurm, Matthias and Siefke, Thomas and K{\"a}seberg, Tim and Bodermann, Bernd} } @Article { ReitzensteinSZBRDDDMWPOMKSSGSMoU2019, subid = {1363}, title = {Method for direct coupling of a semiconductor quantum dot to an optical fiber for single-photon source applications}, journal = {Optics Express}, year = {2019}, month = {9}, volume = {27}, number = {19}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {26772}, keywords = {semiconductor quantum dot, single-photon source}, web_url = {https://www.osapublishing.org/DirectPDFAccess/08FE2392-996C-94FE-814D27FFE5E6D46E_418606/oe-27-19-26772.pdf?da=1\&id=418606\&seq=0\&mobile=no}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.026772}, stag_bib_extends_levelofaccess = {NA}, author = {Żołnacz, K. and Musiał, A. and Srocka, N. and Gro{\ss}e, J. and Schl{\"o}singer, M.J. and Schneider, P-I. and Kravets, O. and Mikulicz, M. and Olszewski, J. and Poturaj, K. and W{\'o}jcik, G. and Mergo, P. and Dybka, K. and Dyrkacz, M. and Dłubek, M. and Rodt, S. and Burger, S. and Zschiedrich, L. and Sęk, G. and Reitzenstein, S. and Urbańczyk, W.} } @Article { RietveldKvWB2019, subid = {1377}, title = {Detection Methods for Current Signals Causing Errors in Static Electricity Meters}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {Power Quality Electricity Meters Short Time Fourier Transform Wavelet Transform Multiresolution Signal Decomposition Wavelets Smart Meters}, web_url = {https://zenodo.org/record/3582153\#.XiGzUXu7KUm}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/EMCEurope.2019.8872120}, stag_bib_extends_levelofaccess = {NA}, author = {Barakou, F. and Wright, P.S. and van den Brom, H.E. and Kok, G.J.P and Rietveld, G.} } @Article { KellmanMRSBXORNIRMGNPC2019, subid = {1474}, title = {Simultaneous 13N-Ammonia and gadolinium first-pass myocardial perfusion with quantitative hybrid PET-MR imaging: a phantom and clinical feasibility study}, journal = {European Journal of Hybrid Imaging}, year = {2019}, month = {9}, volume = {3}, number = {1}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, keywords = {myocardial perfusion, hybrid PET-MR}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2510-3636}, DOI = {10.1186/s41824-019-0062-6}, stag_bib_extends_levelofaccess = {NA}, author = {Nazir, M.S. and Gould, S-M. and Milidonis, X. and Reyes, E. and Ismail, T.F. and Neji, R. and Roujol, S. and O’Doherty, J. and Xue, H. and Barrington, S.F. and Schaeffter, T. and Razavi, R. and Marsden, P. and Kellman, P. and Plein, S. and Chiribiri, A.} } @Proceedings { CastroVWKHS2019, subid = {1202}, title = {Stability of the surface passivation properties of atomic layer deposited aluminum oxide in damp heat conditions}, journal = {AIP Conference Proceedings}, year = {2019}, month = {8}, day = {27}, volume = {2147}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {050003}, keywords = {Aluminium oxide, surface passivation, damp heat exposure, atomic layer deposition, degradation}, web_url = {https://aip.scitation.org/doi/pdf/10.1063/1.5123852?class=pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, event_place = {Leuven, Belgium}, event_name = {SiliconPV 2019, THE 9TH INTERNATIONAL CONFERENCE ON CRYSTALLINE SILICON PHOTOVOLTAICS}, event_date = {08-04-2019 to 10-04-2019}, language = {30}, ISBN = {978-0-7354-1892-9}, ISSN = {1551-7616}, DOI = {10.1063/1.5123852}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, I.T.S. and Koutsourakis, G. and Wood, S. and V{\"a}h{\"a}nissi, V. and Castro, F.A. and Savin, H.} } @Proceedings { KaramanDMEBHHRGG2019, subid = {1186}, title = {Comparison of PD calibration capabilities in four National Metrology Institutes down to 0.1 pC}, journal = {Proceedings of ISH2019}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {partial discharge, calibration}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3243449}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Bergman, A.E. and Elg, A-P. and Merev, A. and Dedeoğlu, S. and Karaman, I. and Rovira, J. and Garcia, T. and Garnacho, F.} } @Proceedings { KhamlichiG2015, subid = {1097}, title = {Calibration Setup For Traceable Measurements Of Very Fast Transients}, journal = {Proceedings of IHS2019}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {Calibration, setup, transients}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {International Symposium on High Voltage Engineering 2019}, language = {30}, DOI = {10.5281/zenodo.3238169}, stag_bib_extends_levelofaccess = {NA}, author = {Khamlichi, A. and Garnacho, F. and H{\"a}llstr{\"o}m, J. and Elg, A.P.} } @Inbook { RuttingerPGCPSKBJSBSWWS2019, subid = {1193}, title = {European Research on Magnetic Nanoparticles for Biomedical Applications: Standardisation Aspects}, year = {2019}, month = {8}, day = {23}, volume = {Advances i}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {316-326}, keywords = {magnetic nanoparticles, standardisation European research}, web_url = {https://arxiv.org/abs/1905.08791}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer International Publishing}, address = {Cham}, booktitle = {Current Trends in Biomedical Engineering and Bioimages Analysis. PCBEE 2019.}, language = {30}, ISBN = {978-3-030-29884-5}, DOI = {10.1007/978-3-030-29885-2_29}, stag_bib_extends_levelofaccess = {NA}, author = {Schier, Peter and Barton, Craig and Spassov, Simo and Johansson, Christer and Baumgarten, Daniel and Kazakova, Olga and Southern, Paul and Pankhurst, Quentin and Coisson, Marco and Gr{\"u}ttner, Cordula and Price, Alex and R{\"u}ttinger, Roman and Wiekhorst, Frank and Wells, James and Steinhoff, Uwe} } @Proceedings { VentreMDBCFPPRSTBASSGHBZFDKL2019, subid = {1200}, title = {Metrology for Inductive Charging of Electric Vehicles (MICEV)}, journal = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, year = {2019}, month = {8}, day = {19}, volume = {Electrical}, number = {2019 AEIT}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {6 pages}, keywords = {Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety}, web_url = {http://arxiv.org/abs/1908.11108}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Turin (Italy)}, event_name = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, event_date = {02-07-2019 to 04-07-2019}, language = {30}, ISBN = {978-8-8872-3743-6}, ISSN = {0018-9219}, DOI = {10.23919/EETA.2019.8804498}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Bottauscio, O. and Harmon, S. and Guilizzoni, R. and Schilling, F. and Schmidt, M. and Ankarson, P. and Bergsten, T. and Tammi, K. and Sainio, P. and Romero, J.B. and Puyal, E.L. and Pichon, L. and Freschi, F. and Cirimele, V. and Bauer, P. and Dong, J. and Maffucci, A. and Ventre, S. and Femia, N. and Di Capua, G. and Kuster, N. and Liorni, I.} } @Manual { WattsRKP2009, subid = {1199}, title = {Good Practice Guide on Making Rectangular Waveguide Connections at Frequencies above 100 GHz}, year = {2019}, month = {8}, day = {9}, number2 = {17SIP08: NeWITT: New Waveguide Interfaces for Terahertz Technologies}, keywords = {INSPEC B1310 Waveguides and microwave transmission lines, INSPEC B1320 Waveguide and microwave transmission line components, INSPEC B2180E Connectors, INSPEC B5210C Radiowave propagation,INSPEC B7130 Measurement standards and calibration}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, address = {Braunschweig}, language = {30}, DOI = {10.7795/530.20190805}, stag_bib_extends_levelofaccess = {NA}, author = {Watts, J. and Ridler, N. and Kuhlmann, K. and Probst, T.} } @Article { NahleMLKKEBBPRR2019, subid = {1235}, title = {Development of a beta spectrometry setup using metallic magnetic calorimeters}, journal = {Journal of Instrumentation}, year = {2019}, month = {8}, volume = {14}, number = {08}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {P08012-P08012}, keywords = {Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/14/08/P08012}, stag_bib_extends_levelofaccess = {NA}, author = {Paulsen, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Loidl, M. and Mariam, R. and N{\"a}hle, O. and Ranitzsch, P. and Rodrigues, M.} } @Article { NahleMLKKEBBPRR20190, subid = {1235}, title = {Development of a beta spectrometry setup using metallic magnetic calorimeters}, journal = {Journal of Instrumentation}, year = {2019}, month = {8}, volume = {14}, number = {08}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {P08012-P08012}, keywords = {Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/14/08/P08012}, stag_bib_extends_levelofaccess = {NA}, author = {Paulsen, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Loidl, M. and Mariam, R. and N{\"a}hle, O. and Ranitzsch, P. and Rodrigues, M.} } @Article { WendischPMWIBABOKK2019, subid = {1057}, title = {Optical Pulse-Drive for the Pulse-Driven AC Josephson Voltage Standard}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2019}, month = {8}, volume = {29}, number = {5}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {1200205}, keywords = {Optical pulses, Optical fibers, Optical distortion, High-speed optical techniques, Optical attenuators, Optical crosstalk}, web_url = {https://ieeexplore.ieee.org/document/8643521}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2019.2899851}, stag_bib_extends_levelofaccess = {NA}, author = {Kieler, O. and Karlsen, B. and Ohlckers, P.A. and Bardalen, E. and Akram, M.N. and Behr, R. and Ireland, J. and Williams, J. and Malmbekk, H. and Palafox, L. and Wendisch, R.} } @Article { RunzEMDKK2019, subid = {1205}, title = {Polymer gel-based measurements of the isocenter accuracy in an MR-LINAC}, journal = {Journal of Physics: Conference Series}, year = {2019}, month = {8}, volume = {1305}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {012007}, keywords = {MRgRT, dosimetry}, web_url = {https://doi.org/10.1088/1742-6596/1305/1/012007}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1305/1/012007}, stag_bib_extends_levelofaccess = {NA}, author = {Dorsch, S. and Mann, P. and Elter, A. and Runz, A. and Kl{\"u}ter, S. and Karger, C.P.} } @Article { KotilHHSK2019, subid = {1242}, title = {Analysis of elemental composition and porosity of mesoporous iridium-titanium mixed oxide thin films for energy application by SEM/EDS}, journal = {Microscopy and Microanalysis}, year = {2019}, month = {8}, volume = {25}, number = {S2}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {1770-1771}, keywords = {oxide thin films}, misc2 = {EMPIR 2016: Energy}, publisher = {Cambridge University Press (CUP)}, language = {30}, ISSN = {1431-9276, 1435-8115}, DOI = {10.1017/S1431927619009589}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Hodoroaba, V.-D. and Hertwig, A. and Kotil, L. and Kraehnert, R.} } @Article { KajolinnaPP2019, subid = {1190}, title = {SO2 emission measurement with the European standard reference method, EN 14791, and alternative methods – observations from laboratory and field studies}, journal = {Journal of the Air \& Waste Management Association}, year = {2019}, month = {8}, volume = {69}, number = {9}, number2 = {15NRM01: Sulf-Norm: Metrology for sampling and conditioning SO2 emissions from stacks}, pages = {1122-1131}, keywords = {SO2 emission measurement, European standard reference method, EN 14791, alternative methods}, web_url = {https://doi.org/10.1080/10962247.2019.1640809}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1096-2247, 2162-2906}, DOI = {10.1080/10962247.2019.1640809}, stag_bib_extends_levelofaccess = {NA}, author = {Pellikka, T. and Kajolinna, T. and Per{\"a}l{\"a}, M.} } @Article { BausiKBC2019, subid = {1736}, title = {High-speed digital light source photocurrent mapping system}, journal = {Measurement Science and Technology}, year = {2019}, month = {7}, day = {30}, volume = {30}, number = {9}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {095902}, keywords = {High-speed digital light source photocurrent mapping system}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab1f40}, stag_bib_extends_levelofaccess = {NA}, author = {Bausi, F. and Koutsourakis, G. and Blakesley, J.C. and Castro, F.A.} } @Article { GennserCPBBMCKCRMBJDH2019, subid = {1311}, title = {Quantum tomography of electrical currents}, journal = {Nature Communications}, year = {2019}, month = {7}, day = {29}, volume = {10}, number = {1}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, keywords = {Electronic wavefunction, Quantum tomography}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-11369-5}, stag_bib_extends_levelofaccess = {NA}, author = {Bisognin, R. and Marguerite, A. and Roussel, B. and Kumar, M. and Cabart, C. and Chapdelaine, C. and Mohammad-Djafari, A. and Berroir, J.-M. and Bocquillon, E. and Pla\c{c}ais, B. and Cavanna, A. and Gennser, U. and Jin, Y. and Degiovanni, P. and F{\`e}ve, G.} } @Article { SOCHOROVARLLKFDCCBBT2019, subid = {1285}, title = {Activity measurements and determination of nuclear decay data of 166Ho in the MRTDosimetry project}, journal = {Applied Radiation and Isotopes}, year = {2019}, month = {7}, day = {20}, volume = {153}, number = {November 2}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {1-11}, keywords = {Ho166, Activity standardization, gamma-spectrometry, Half-life measurements, Molecular radiotherapy, MRTDosimetry}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2019.108826}, stag_bib_extends_levelofaccess = {NA}, author = {Bobin, C. and BOUCHARD, J. and CHISTE, V. and COLLINS, S. and Dry{\'a}k, P. and FENWICK, A. and Keightley, J. and L{\'e}py, M.C. and Lourenco, V. and Robinson, A. and Sochorov{\'a}, J. and THIAM, C.} } @Article { SchmidtCOHBMLK2019, subid = {1340}, title = {A cryogenic radio-frequency ion trap for quantum logic spectroscopy of highly charged ions}, journal = {Review of Scientific Instruments}, year = {2019}, month = {7}, volume = {90}, number = {7}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {073201}, keywords = {Optical ClocksTrapped Ions}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5100594}, stag_bib_extends_levelofaccess = {NA}, author = {Leopold, T. and King, S. A. and Micke, P. and Bautista-Salvador, A. and Heip, J. C. and Ospelkaus, C. and Crespo L{\'o}pez-Urrutia, J. R. and Schmidt, P. O.} } @Article { PollakowskiMKNDHB2019, subid = {1267}, title = {Reference-free grazing incidence x-ray fluorescence and reflectometry as a methodology for independent validation of x-ray reflectometry on ultrathin layer stacks and a depth-dependent characterization}, journal = {Journal of Vacuum Science \& Technology A}, year = {2019}, month = {7}, volume = {37}, number = {4}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {041502}, keywords = {XRR, GIXRF, nanolayers}, web_url = {https://arxiv.org/abs/1903.01196}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5094891}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Detlefs, B. and Nolot, E. and Kayser, Y. and M{\"u}hle, U. and Pollakowski, B. and Beckhoff, B.} } @Article { HonickeKMBPD2019, subid = {1270}, title = {Reference-free grazing incidence x-ray fluorescence and reflectometry as a methodology for independent validation of x-ray reflectometry on ultrathin layer stacks and a depth-dependent characterization}, journal = {Journal of Vacuum Science \& Technology A}, year = {2019}, month = {7}, volume = {37}, number = {4}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {041502}, keywords = {nanolayer stacks}, web_url = {https://arxiv.org/abs/1903.01196}, misc2 = {EMPIR 2016: Environment}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5094891}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Detlefs, B. and Kayser, Y. and M{\"u}hle, U. and Pollakowski, B. and Beckhoff, B.} } @Article { KeyerMHtL2019, subid = {1319}, title = {Faulty Readings of Static Energy Meters Caused by Conducted Electromagnetic Interference from a Water Pump}, journal = {Renewable Energy and Power Quality Journal}, year = {2019}, month = {7}, volume = {17}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {15-19}, keywords = {Static Meter, Smart Meter, Electronic Meter, Conducted Interference, Electromagnetic Compatibility}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {AEDERMACP (European Association for the Development of Renewable Energies and Power Quality)}, language = {30}, ISSN = {2172-038X}, DOI = {10.24084/repqj17.205}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Hartman, T. and Moonen, N. and Keyer, C. and Leferink, F.} } @Article { StollWerianFRNKP2019, subid = {1563}, title = {Absolute isotope ratios – Analytical solution for the determination of calibration factors for any number of isotopes and isotopologues}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2019}, month = {7}, volume = {157}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {76-83}, keywords = {Mass bias correction, Absolute isotope ratio, SI traceability, Metrology, Isotopic composition}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2019.04.008}, stag_bib_extends_levelofaccess = {NA}, author = {Stoll-Werian, Anne and Flierl, Lukas and Rienitz, Olaf and Noordmann, Janine and Kessel, R{\"u}diger and Pramann, Axel} } @Article { KoutsourakisBC2019, subid = {1735}, title = {Signal Amplification Gains of Compressive Sampling for Photocurrent Response Mapping of Optoelectronic Devices}, journal = {Sensors}, year = {2019}, month = {6}, day = {28}, volume = {19}, number = {13}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {2870}, keywords = {non-destructive testing, current mapping, digital micromirror device, compressed sensing}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s19132870}, stag_bib_extends_levelofaccess = {NA}, author = {Koutsourakis, G. and Blakesley, J.C. and Castro, F.A.} } @Article { AdibekyanKMH2019, subid = {1287}, title = {Characterization, calibration and validation of an industrial emissometer}, journal = {Journal of Sensors and Sensor Systems}, year = {2019}, month = {6}, day = {27}, volume = {8}, number = {1}, number2 = {16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials}, pages = {233-242}, keywords = {emissivity, TIR 100-2 emissometer, characterization, calibration, reflective foils}, web_url = {https://www.j-sens-sens-syst.net/8/233/2019/}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-8-233-2019}, stag_bib_extends_levelofaccess = {NA}, author = {Kononogova, Elena and Adibekyan, Albert and Monte, Christian and Hollandt, J{\"o}rg} } @Article { LeitoK2019, subid = {1408}, title = {Generalization of Acid‐Base Diagrams Based on the Unified pH‐Scale}, journal = {ChemPhysChem}, year = {2019}, month = {6}, day = {26}, volume = {20}, number = {14}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1779-1785}, keywords = {electrochemistry nonaqueous solventspH-lgci diagramsproton transfer reactionsunified pH scale}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {1439-4235, 1439-7641}, DOI = {10.1002/cphc.201900388}, stag_bib_extends_levelofaccess = {NA}, author = {Kahlert, H. and Leito, I.} } @Article { BrinkmannMSBLI2019, subid = {1322}, title = {3D nonrigid motion correction for quantitative assessment of hepatic lesions in DCE‐MRI}, journal = {Magnetic Resonance in Medicine}, year = {2019}, month = {6}, day = {22}, volume = {82}, number = {5}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, pages = {1753-1766}, keywords = {quantification, nonrigid motion correction, hepatic lesions, DCE-MRI}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.27867}, stag_bib_extends_levelofaccess = {NA}, author = {Ippoliti, M. and Lukas, M. and Brenner, W. and Schaeffter, T. and Makowski, M. R. and Kolbitsch, C.} } @Proceedings { KrokerWSDKB2019, subid = {1281}, title = {Mueller matrix ellipsometry for enhanced optical form metrology of sub-lambda structures}, journal = {Modeling Aspects in Optical Metrology VII}, year = {2019}, month = {6}, day = {21}, volume = {11057}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {155-165}, keywords = {Plasmonics, Ellipsometry, Scanning electron microscopy, Numerical simulations, Metrology, Nanostructures, Near field optics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {SPIE}, event_place = {Munich}, event_name = {International Society for Optics and Photonics Optical Metrology}, event_date = {24-06-2019 to 27-06-2019}, language = {30}, DOI = {10.1117/12.2527419}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}seberg, T. and Dickmann, J. and Siefke, T. and Wurm, M. and Kroker, S. and Bodermann, B.} } @Article { PoikonenLGKKTDFPKI2019, subid = {1201}, title = {Validation of the fisheye camera method for spatial non-uniformity corrections in luminous flux measurements with integrating spheres}, journal = {Metrologia}, year = {2019}, month = {6}, day = {18}, volume = {56}, number = {4}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {045002}, keywords = {fisheye camera method, integrating sphere, luminous flux, spatial correction, angular intensity distribution, photometry, measurement uncertainty}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {-}, DOI = {10.1088/1681-7575/ab17fe}, stag_bib_extends_levelofaccess = {NA}, author = {Kokka, A. and Pulli, T. and Ferrero, A. and Dekker, P. and Thorseth, A. and Kliment, P. and Klej, A. and Gerloff, T. and Ludwig, K. and Poikonen, T. and Ikonen, E.} } @Article { MottonenRKBYFGK2019, subid = {1110}, title = {Evidence for universality of tunable-barrier electron pumps}, journal = {Metrologia}, year = {2019}, month = {6}, day = {13}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Single electron pumps, electrical metrology, quantum electrical standards}, web_url = {https://arxiv.org/abs/1901.05218}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab29a5}, stag_bib_extends_levelofaccess = {NA}, author = {Giblin, S. and Fujiwara, A. and Yamahata, G. and Bae, M.H. and Kim, N. and Rossi, A. and M{\"o}tt{\"o}nen, M. and Kataoka, M.} } @Article { HannNFSTK2019, subid = {1196}, title = {FI-ICP-TOFMS for quantification of biologically essential trace elements in cerebrospinal fluid – high-throughput at low sample volume}, journal = {The Analyst}, year = {2019}, month = {6}, day = {11}, volume = {144}, number = {15}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {4653-4660}, keywords = {cerebrospinal fluid, FI-ICP-TOFMS, quantification of biologically essential trace elements}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2019/AN/C9AN00039A\#!divAbstract}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0003-2654, 1364-5528}, DOI = {10.1039/C9AN00039A}, stag_bib_extends_levelofaccess = {NA}, author = {Theiner, S. and Schoeberl, A. and Fischer, L. and Neumayer, S. and Hann, S. and Koellensperger, G.} } @Article { ThorwarthDKP2019, subid = {1141}, title = {A finite element method for the determination of the relative response of ionization chambers in MR-linacs: simulation and experimental validation up to 1.5 T}, journal = {Physics in Medicine and Biology}, year = {2019}, month = {6}, day = {10}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, keywords = {MRgRT, reference dosimetry, magnetic field}, web_url = {https://doi.org/10.1088/1361-6560/ab2837}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ab2837}, stag_bib_extends_levelofaccess = {NA}, author = {Pojtinger, S. and Kapsch, R.P. and Dohm, O.S. and Thorwarth, D.} } @Article { BursikovaKC2019, subid = {1250}, title = {Fast mechanical model for probe–sample elastic deformation estimation in scanning probe microscopy}, journal = {Ultramicroscopy}, year = {2019}, month = {6}, volume = {201}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {18-27}, keywords = {Scanning Probe Microscopy,Uncertainty,Elastic deformation}, web_url = {https://www.sciencedirect.com/science/article/pii/S0304399118302638}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2019.03.010}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P. and Charv{\'a}tov{\'a} Campbell, A. and Burš{\'i}kov{\'a}, V. } } @Article { KorpelainenBDS2019, subid = {1297}, title = {Tip wear and tip breakage in high-speed atomic force microscopes}, journal = {Ultramicroscopy}, year = {2019}, month = {6}, volume = {201}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {28-37}, keywords = {Atomic force microscopy (AFM), High-speed AFM, Tip wear, Tip breakage, Tip characterization, Tip-sample interaction}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2019.03.013}, stag_bib_extends_levelofaccess = {NA}, author = {Strahlendorff, T. and Dai, G. and Bergmann, D. and Tutsch, R.} } @Article { vandenBromHHBKWI2019, subid = {1154}, title = {An Optoelectronic Pulse Drive for Quantum Voltage Synthesizer}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {2066-2071}, keywords = {Josephson arbitrary waveform synthesizer, Josephson arrays, measurement, metrology, optoelectronics, voltage measurement}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2877562}, stag_bib_extends_levelofaccess = {NA}, author = {Ireland, J. and Williams, J. and Kieler, O. and Behr, R. and Houtzager, E. and Hornecker, R. and van den Brom, H.E.} } @Article { BeckerGKDS2019, subid = {1104}, title = {Electrometer Calibration With Sub-Part-Per-Million Uncertainty}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {1887-1894}, keywords = {Ammeters, calibration, current measurement, measurement standards, measurement uncertainty, precisionmeasurements}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2019.2900129}, stag_bib_extends_levelofaccess = {NA}, author = {Scherer, H. and Drung, D. and Krause, C. and G{\"o}tz, M. and Becker, U.} } @Article { HohlsKGHKW2019, subid = {1126}, title = {Quantum dot state initialization by control of tunneling rates}, journal = {Physical Review B}, year = {2019}, month = {5}, day = {20}, volume = {99}, number = {20}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {201409(R)}, keywords = {quantum dot, single-electron, quantum state, electron quantum optics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/physrevb.99.201409}, stag_bib_extends_levelofaccess = {NA}, author = {Wenz, T. and Klochan, J. and Hohls, F. and Gerster, T. and Kashcheyevs, V. and Schumacher, H. W.} } @Article { HohlsKGHKW20190, subid = {1126}, title = {Quantum dot state initialization by control of tunneling rates}, journal = {Physical Review B}, year = {2019}, month = {5}, day = {20}, volume = {99}, number = {20}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {201409(R)}, keywords = {quantum dot, single-electron, quantum state, electron quantum optics}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/physrevb.99.201409}, stag_bib_extends_levelofaccess = {NA}, author = {Wenz, T. and Klochan, J. and Hohls, F. and Hohls, F. and Gerster, T. and Kashcheyevs, V.} } @Article { HeinrichPSDKFA2019, subid = {1067}, title = {Influence of Microwave Probes on Calibrated On-Wafer Measurements}, journal = {IEEE Transactions on Microwave Theory and Techniques}, year = {2019}, month = {5}, volume = {67}, number = {5}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1892-1900}, keywords = {Calibration, coplanar waveguide, electromagnetic field simulation, multiline-thru-reflect-line, on-wafer probing, probes}, web_url = {https://www.fbh-berlin.de/fileadmin/downloads/Publications/2019/FINAL_VERSION_repository.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9480, 1557-9670}, DOI = {10.1109/TMTT.2019.2903400}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Kahne, B. and Fritzsch, T. and Arz, U. and Heinrich, W.} } @Manual { HaddadiDLHGLHPZWHMSRKPASC2019, subid = {1085}, title = {Best Practice Guide for Planar S-Parameter Measurements using Vector Network Analysers}, year = {2019}, month = {4}, day = {24}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), microwave probes, extreme impedance measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise, vector network analyzer (VNA)}, web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424B}, misc2 = {EMPIR 2014: Industry}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, language = {30}, DOI = {10.7795/530.20190424B}, stag_bib_extends_levelofaccess = {NA}, author = {Haddadi, K. and Dambrine, G. and Lozar, R. and Helmreich, K. and Gold, G. and Lomakin, K. and Heinrich, W. and Phung, G.N. and Zeier, M. and Wollensack, M. and Hoffmann, J. and Mubarak, F. and Shang, X. and Ridler, N. and Kuhlmann, K. and Probst, T. and Arz, U. and Spirito, M. and Clarke, R.} } @Article { RosendahlBBKSKS2019, subid = {1550}, title = {CT beam dosimetric characterization procedure for personalized dosimetry}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {3}, day = {29}, volume = {64}, number = {7}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, pages = {075009}, keywords = {CT beam dosimetric characterization procedure for personalized dosimetry}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab0e97}, stag_bib_extends_levelofaccess = {NA}, author = {Rosendahl, S. and B{\"u}ermann, L. and Borowski, M. and Kortesniemi, M. and Sundell, V-M. and Kosunen, A. and Siiskonen, T.} } @Article { KoellenspergerNST2019, subid = {1195}, title = {FI-ICP-TOFMS for high-throughput and low volume multi-element analysis in environmental and biological matrices}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2019}, month = {3}, day = {28}, volume = {34}, number = {6}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {1272-1278}, keywords = {low volume multi-element analysis, FI-ICP-TOFMS, analysis in environmental and biological matrices}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2019/JA/C9JA00022D\#!divAbstract}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/C9JA00022D}, stag_bib_extends_levelofaccess = {NA}, author = {Theiner, S. and Schoeberl, A. and Neumayer, S. and Koellensperger, G.} } @Article { KiselevDMFVPABBLXBHD2019, subid = {1024}, title = {Long Slender Piezo-Resistive Silicon Microprobes for Fast Measurements of Roughness and Mechanical Properties inside Micro-Holes with Diameters below 100 µm}, journal = {Sensors 2019}, year = {2019}, month = {3}, day = {22}, volume = {19(6)}, number = {1410}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {cantilever microprobe; high-speed; contact resonance; tip wear; piezo-resistive; mechanical damping; tip-testing standard}, web_url = {https://www.mdpi.com/1424-8220/19/6/1410}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, address = {Basel}, language = {30}, DOI = {10.3390/s19061410}, stag_bib_extends_levelofaccess = {NA}, author = {Brand, U. and XU, M. and Doering, L. and Langfahl-Klabes, J. and Behle, H. and B{\"u}tefisch, S. and Ahbe, T. and Peiner, E. and V{\"o}llmeke, S. and Frank, T. and Mickan, B. and Kiselev, I. and Hauptmannl, M. and Drexel, M.} } @Article { HuKPHNKNC2019, subid = {1306}, title = {Determination of tip transfer function for quantitative MFM using frequency domain filtering and least squares method}, journal = {Scientific Reports}, year = {2019}, month = {3}, volume = {9}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, keywords = {quantitative MFM}, web_url = {https://www.nature.com/articles/s41598-019-40477-x\#additional-information}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-40477-x}, stag_bib_extends_levelofaccess = {NA}, author = {Nečas, D. and Klapetek, P. and Neu, V. and Havl{\'i}ček, M. and Puttock, R. and Kazakova, O. and Hu, X. and Zaj{\'i}čkov{\'a}, L.} } @Proceedings { ThalmannMBK2019, subid = {1030}, title = {CT machine geometry changes under thermal load}, journal = {Nondestructive Testing}, year = {2019}, month = {3}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {23681}, keywords = {CT machine geometry, thermal influences, geometry measurement system, metrology}, web_url = {http://www.ndt.net/?id=23681}, misc2 = {EMPIR 2017: Industry}, publisher = {NDT.net}, event_place = {Padova}, event_name = {9th Conference on Industrial Computed Tomography (iCT) 2019}, event_date = {13-02-2019 to 15-02-2019}, language = {30}, ISSN = {1435-4934}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2019/papers/iCT2019_Full_paper_47.pdf}, author = {Thalmann, R. and Meli, F. and Bircher, B.A. and K{\"u}ng, A.} } @Proceedings { ThalmannMBK2019_2, subid = {1029}, title = {CT geometry determination using individual radiographsof calibrated multi-sphere standards}, journal = {Nondestructive Testing}, year = {2019}, month = {3}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {23677}, keywords = {CT machine geometry, correction, multi-sphere standard, metrology}, web_url = {https://www.ndt.net/search/docs.php3?showForm=off\&id=23677}, misc2 = {EMPIR 2017: Industry}, publisher = {NDT.net}, event_place = {Padova}, event_name = {9th Conference on Industrial Computed Tomography (iCT) 2019}, event_date = {13-02-2019 to 15-02-2019}, language = {30}, ISSN = {1435-4934}, stag_bib_extends_levelofaccess = {NA}, author = {Thalmann, R. and Meli, F. and Bircher, B.A. and K{\"u}ng, A.} } @Article { KurlyandskayaSCMBACT2019, subid = {944}, title = {Specific loss power measurements by calorimetric and thermal methods on \(\gamma\)-Fe2O3 nanoparticles for magnetic hyperthermia}, journal = {Journal of Magnetism and Magnetic Materials}, year = {2019}, month = {3}, volume = {473}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {403-409}, keywords = {Magnetic hyperthermia, Fe-oxide, Magnetic nanoparticles}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-8853}, DOI = {10.1016/j.jmmm.2018.10.107}, stag_bib_extends_levelofaccess = {NA}, author = {Co{\"i}sson, M. and Barrera, G. and Appino, C. and Celegato, F. and Martino, L. and Safronov, A.P. and Kurlyandskaya, G.V. and Tiberto, P.} } @Article { ChunnilallKBGRKLPRGD2019, subid = {1012}, title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source}, journal = {Metrologia}, year = {2019}, month = {2}, day = {22}, volume = {56}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {025004}, keywords = {single-photon sources, quantum technologies, quantum characterization}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab022e}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.} } @Article { ChunnilallKBGRKLPRGD20190, subid = {1012}, title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source}, journal = {Metrologia}, year = {2019}, month = {2}, day = {22}, volume = {56}, number = {2}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {025004}, keywords = {single-photon sources, quantum technologies, quantum characterization}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab022e}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.} } @Article { ChunnilallKBGRKLPRGD20191, subid = {1012}, title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source}, journal = {Metrologia}, year = {2019}, month = {2}, day = {22}, volume = {56}, number = {2}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {025004}, keywords = {single-photon sources, quantum technologies, quantum characterization}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab022e}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.} } @Inbook { SanderTK2019, subid = {1131}, title = {Optically Pumped Magnetometers for MEG}, year = {2019}, month = {2}, day = {21}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {1-12}, keywords = {Optically pumped magnetometer, Magnetoencephalography, Superconducting quantum interference device, Magnetocardiography, Multichannel, Electron spin resonance, Microelectromechanical system, Alkali-metal vapor cell, Atomic magnetometer, Optical magnetometer}, misc2 = {EMPIR 2015: Health}, publisher = {Springer International Publishing}, booktitle = {Magnetoencephalography}, language = {30}, ISBN = {978-3-319-62657-4}, DOI = {10.1007/978-3-319-62657-4_49-1}, stag_bib_extends_levelofaccess = {NA}, author = {Knappe, S. and Sander, T. and Trahms, L.} } @Article { NeuCJBPKC2019, subid = {1305}, title = {Frontiers of magnetic force microscopy}, journal = {Journal of Applied Physics}, year = {2019}, month = {2}, day = {14}, volume = {125}, number = {6}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {060901}, keywords = {MFM}, web_url = {https://aip.scitation.org/doi/10.1063/1.5050712}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979, 1089-7550}, DOI = {10.1063/1.5050712}, stag_bib_extends_levelofaccess = {NA}, author = {Kazakova, O. and Puttock, R. and Barton, C. and Corte-Le{\'o}n, H. and Corte-Leon, Hector and Jaafar, M. and Neu, V.} } @Article { MendezSBCKSD2019, subid = {1021}, title = {Characterization of an analog-to-digital converter frequency response by a Josephson arbitrary waveform synthesizer}, journal = {Measurement Science and Technology}, year = {2019}, month = {2}, day = {11}, volume = {30}, number = {3}, number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements}, pages = {035006}, keywords = {quantum standard, digital converter, Josephson arbitrary waveform synthesizer, programmable Josephson voltage standard, Monte Carlo method, Sine fitting algorithms, artificial neural network (ANN)}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/aafb27/meta}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aafb27}, stag_bib_extends_levelofaccess = {NA}, author = {Diaz de Aguilar, J. and Salinas, J.R. and Kieler, O. and Caballero, R. and Behr, R. and Sanmamed, Y.A. and M{\'e}ndez, A.} } @Article { KargerSM2019, subid = {1044}, title = {Absolute dosimetry with polymer gels—a TLD reference system}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {2}, day = {11}, volume = {64}, number = {4}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {045010}, keywords = {radiation dosimeters, absolute dosimetry, 3D dosimetry, polymer gel, thermoluminescence dosimetry, TLD}, web_url = {https://doi.org/10.1088/1361-6560/aafd41}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aafd41}, stag_bib_extends_levelofaccess = {NA}, author = {Mann, P. and Schwahofer, A. and Karger, C.P.} } @Article { LazzeriniDGVKYB2019, subid = {1074}, title = {Design and performance of a test rig for evaluation of nanopositioning stages}, journal = {Measurement Science and Technology}, year = {2019}, month = {2}, volume = {30}, number = {3}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {035002}, keywords = {multi-axis positioning stages, traceability, nanopositioning, dimensional metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aafd03}, stag_bib_extends_levelofaccess = {NA}, author = {Yacoot, Andrew and Klapetek, Petr and Valtr, Miroslav and Grolich, Petr and Dongmo, Herve and Lazzerini, Giovanni M and Bridges, Angus} } @Article { DittmannFHGBHKWPSDM2019, subid = {1001}, title = {Results of four European round-robins on short-circuit current temperature coefficient measurements of photovoltaic devices of different size}, journal = {Solar Energy}, year = {2019}, month = {2}, volume = {179}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {424-436}, keywords = {Photovoltaics, Short-circuit current temperature coefficient intercomparisons, Spectral temperature coefficients, Bare cells to full-size modules}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2018.10.051}, stag_bib_extends_levelofaccess = {NA}, author = {Salis, E. and Pavanello, D. and Kr{\"o}ger, I. and Winter, S. and Bothe, K. and Hinken, D. and Gandy, T. and Hohl-Ebinger, J. and Friesen, G. and Dittmann, S. and Dubard, J. and M{\"u}llejans, H.} } @Article { JohnenRMDEK2019, subid = {1052}, title = {Compatibility of 3D printing materials and printing techniques with PAGAT gel dosimetry}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {2}, volume = {64}, number = {4}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {04NT02}, keywords = {MRgRT}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aafef0}, stag_bib_extends_levelofaccess = {NA}, author = {Elter, A. and Dorsch, S. and Mann, P. and Runz, A. and Johnen, W. and Karger, C.P.} } @Article { KokvvWWJddR2019, subid = {1045}, title = {Commissioning of a water calorimeter as a primary standard for absorbed dose to water in magnetic fields}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {1}, day = {29}, volume = {64}, number = {3}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {035013}, keywords = {dosimetry, MRgRT, primary standard, magnetic field, MRI-linac, calorimetry}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/aaf975}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aaf975}, stag_bib_extends_levelofaccess = {NA}, author = {de Prez, L. and de Pooter, J. and Jansen, B. and Woodings, S. and Wolthaus, J. and van Asselen, B. and van Soest, T. and Kok, J. and Raaymakers, B.} } @Article { HarrisDBSKDS2019, subid = {1160}, title = {Children With Cystic Fibrosis Are Infected With Multiple Subpopulations of Mycobacterium abscessus With Different Antimicrobial Resistance Profiles}, journal = {Clinical Infectious Diseases}, year = {2019}, month = {1}, day = {26}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, keywords = {lung transplant, whole-genome sequencing, within-patient diversity, macrolides, physiological niches}, misc2 = {EMPIR 2015: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {1058-4838, 1537-6591}, DOI = {10.1093/cid/ciz069}, stag_bib_extends_levelofaccess = {NA}, author = {Shaw, L.P. and Doyle, R.M. and Kavaliunaite, E. and Spencer, H. and Balloux, F. and Dixon, G. and Harris, K.A.} } @Article { JohnsonKCE2019, subid = {1148}, title = {Energy relaxation in hot electron quantum optics via acoustic and optical phonon emission}, journal = {Physical Review B}, year = {2019}, month = {1}, day = {22}, volume = {99}, number = {4}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {045306}, keywords = {electron quantum optics, hot electron, energy relaxation, phonon}, web_url = {https://arxiv.org/abs/1807.11814}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.99.045306}, stag_bib_extends_levelofaccess = {NA}, author = {Emary, C. and Clark, L.A. and Kataoka, M. and Johnson, N.} } @Article { KochKBWHBISIK2019, title = {Does airborne ultrasound lead to activation of the auditory cortex?}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2019}, month = {1}, day = {18}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, keywords = {airborne ultrasound; brain imaging; hearingthreshold}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {1862-278X, 0013-5585}, DOI = {10.1515/bmt-2018-0048}, stag_bib_extends_levelofaccess = {NA}, author = {Koch, C. and K{\"u}hler, R. and Bauer, M. and Weichenberger, M. and Hensel, J. and Br{\"u}hl, R. and Ihlenfeld, A. and Sander, T. and Ittermann, B. and K{\"u}hn, S.} } @Article { SchererGDK2019, subid = {1106}, title = {Noise-optimized ultrastable low-noise current amplifier}, journal = {Review of Scientific Instruments}, year = {2019}, month = {1}, day = {11}, volume = {90}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {014706}, keywords = {Transimpedance amplifier, noise, metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.5078572}, stag_bib_extends_levelofaccess = {NA}, author = {Krause, C. and Drung, D. and G{\"o}tz, M. and Scherer, H.} } @Article { OliveroDFGRBLKTMCKGD2019, subid = {1007}, title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range}, journal = {Metrologia}, year = {2019}, month = {1}, volume = {56}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {015016}, keywords = {colour centers, single-photon source, metrology for quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf6c8}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.} } @Article { OliveroDFGRBLKTMCKGD20190, subid = {1007}, title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range}, journal = {Metrologia}, year = {2019}, month = {1}, volume = {56}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {015016}, keywords = {colour centers, single-photon source, metrology for quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf6c8}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.} } @Article { OliveroDFGRBLKTMCKGD20191, subid = {1007}, title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range}, journal = {Metrologia}, year = {2019}, month = {1}, volume = {56}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {015016}, keywords = {colour centers, single-photon source, metrology for quantum technologies}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf6c8}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.} } @Article { JarosovaKBPN2019, subid = {975}, title = {Intraocular Pressure Response to Short-Term Extreme Normobaric Hypoxia Exposure}, journal = {Frontiers in Endocrinology}, year = {2019}, month = {1}, volume = {9}, number = {785}, number2 = {16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements}, pages = {1-7}, keywords = {intraocular pressure, hypoxia, normobaric hypoxia, glaucoma, oxygen saturation}, web_url = {https://www.frontiersin.org/research-topics/6935/the-role-of-hypoxia-in-the-regulation-of-metabolism}, misc2 = {EMPIR 2016: Research Potential}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {1664-2392}, DOI = {10.3389/fendo.2018.00785}, stag_bib_extends_levelofaccess = {NA}, author = {Najmanov{\'a}, E. and Pluh{\'a}ček, F. and Botek, M. and Krejč{\'i}, J. and Jarošov{\'a}, J.} } @Article { ElsterSCWKL2019, subid = {1324}, title = {Large-Scale Bayesian Spatial-Temporal Regression with Application to Cardiac MR-Perfusion Imaging}, journal = {SIAM Journal on Imaging Sciences}, year = {2019}, month = {1}, volume = {12}, number = {4}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, pages = {2035-2062}, keywords = {Bayesian spatial-temporal regression, cardiac MR, uncertainty quantification}, misc2 = {EMPIR 2015: Health}, publisher = {Society for Industrial \& Applied Mathematics (SIAM)}, language = {30}, ISSN = {1936-4954}, DOI = {10.1137/19M1246274}, stag_bib_extends_levelofaccess = {NA}, author = {Lehnert, J. and Kolbitsch, C. and W{\"u}bbeler, G. and Chiribiri, A. and Schaeffter, T. and Elster, C.} } @Proceedings { SPINELLICTVDKWMDDD2019, subid = {1405}, title = {EURAMET EMPIR 18HLT06 RaCHy Project: Radiotherapy coupled with Hyperthermia (Induced by HITU)}, journal = {unavailable}, year = {2019}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {1032-1036}, keywords = {External beam radiotherapy, EBRT, HITU, Ultrasound, Hyperthermia}, web_url = {http://publications.rwth-aachen.de/record/767416}, misc2 = {EMPIR 2018: Health}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik}, event_place = {Aachen, Germany}, event_name = {23rd International Congress on Acoustics : integrating 4th EAA Euroregio}, event_date = {09-09-2019 to 13-09-2019}, language = {30}, ISBN = {978-3-939296-15-7}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.18154/RWTH-CONV-238838}, author = {SPINELLI, A. and CACCIA, B. and TER HAAR, G. and VAN RHOON, G. and de Pooter, J. and Karab{\"o}ce, B. and Wilkens, V. and MILORO, P. and Durando, G. and DENKOWA, A. and DIJKEMA, R.} } @Article { ZhuKPRLP2019, subid = {1456}, title = {Combining Harmonic Laser Beams by Fiber Components for Refractivity-Compensating Two-Color Interferometry}, journal = {Journal of Lightwave Technology}, year = {2019}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {1-1}, keywords = {Wavelength division multiplexing (WDM), Photonics crystal fiber (PCF), Beam properties, Two–color interferometry}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=8936353}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0733-8724, 1558-2213}, DOI = {10.1109/JLT.2019.2960473}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, Y. and Rose, A. and Prellinger, G. and K{\"o}chert, P. and Zhu, J. and Pollinger, F.} } @Article { AkramMNBKKO2019, subid = {1056}, title = {Pulsation of InGaAs photodiodes in liquid helium for driving Josephson arrays in ac voltage realization}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2019}, volume = {29}, number = {7}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {1200308}, keywords = {Photodiodes, Integrated circuits, Josephson junctions, Optical distortion, Junctions, Bit rate, Optical pulses}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2019.2901573}, stag_bib_extends_levelofaccess = {NA}, author = {Karlsen, B. and Kieler, O. and Behr, R. and Tuan Nguyen, T.A. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.A.} } @Thesis { Kokka2019, subid = {1318}, title = {Spatial and Spectral Corrections for Integrating Sphere Photometry and Radiometry}, year = {2019}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, keywords = {metrology, integrating sphere, camera, photometry, radiometry}, web_url = {https://aaltodoc.aalto.fi/handle/123456789/37563}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Aalto University}, school = {Aalto University}, language = {30}, ISBN = {978-952-60-8541-8}, ISSN = {1799-4942}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://aaltodoc.aalto.fi/handle/123456789/37563}, author = {Kokka, A.} } @Article { NeufeldKCLLK2019, subid = {1304}, title = {Novel Method and Procedure for Evaluating Compliance of Sources With Strong Gradient Magnetic Fields Such as Wireless Power Transfer Systems}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2019}, volume = {ea}, number = {ea}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-10}, keywords = {Basic restrictions, compliance testing, magnetic field (MF) gradient, near-field source, standards, wireless power transfers (WPTs)}, web_url = {https://ieeexplore.ieee.org/document/8789646}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2019.2924519}, stag_bib_extends_levelofaccess = {NA}, author = {Liorni, I. and Lisewski, T. and Capstick, M.H. and Kuehn, S. and Neufeld, E. and Kuster, N.} } @Article { SchererBKDG2018, subid = {1105}, title = {Calibrating Ultrastable Low-Noise Current Amplifiers of the Second Generation With a Cryogenic Current Comparator}, journal = {IEEE TRANSACTIONS ON INSTRUMENTATION AND MEASUREMENT}, year = {2018}, month = {12}, day = {21}, volume = {68}, number = {6}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {2027-2033}, keywords = {Calibration, current comparator, current measurement, low-noise amplifiers, measurement uncertainty.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2018.2884060}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}tz, M. and Drung, D. and Krause, C. and Becker, U. and Scherer, H.} } @Techreport { KleinHDBBK2018, subid = {1413}, title = {NanoWorkshop 2018: Workshop on Reference Nanomaterials; Current Situation and needs: development, measurement, Standardization}, journal = {PTB bericht}, year = {2018}, month = {12}, volume = {F-61}, number = {F-61}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {1-315}, keywords = {Comparability of Measurement Results;Nanomaterial Properties;Nanometrology;Nanoparticle Characterization;Reference Nanomaterials;Standardization}, web_url = {https://oar.ptb.de/resources/show/10.7795/110.20190412}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Physikalisch-Technische Bundesanstalt}, language = {30}, ISBN = {78-3-95606-440-1}, ISSN = {0179-0609}, DOI = {10.7795/110.20190412}, stag_bib_extends_levelofaccess = {NA}, author = {Klein, T. and Hodoroaba, V.-D. and Dziomba, T. and Buhr, E. and Bosse, H. and Krumrey, M.} } @Article { CrespoLopezUrrutiaKSS2018, subid = {980}, title = {Highly charged ions: Optical clocks and applications in fundamental physics}, journal = {Reviews of Modern Physics}, year = {2018}, month = {12}, volume = {90}, number = {4}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {optical clocks}, web_url = {https://arxiv.org/abs/1803.06532}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {0034-6861, 1539-0756}, DOI = {10.1103/RevModPhys.90.045005}, stag_bib_extends_levelofaccess = {NA}, author = {Kozlov, M.G. and Safronova, M.S. and Crespo L{\'o}pez-Urrutia, J.R. and Schmidt, P. O.} } @Article { ColemanGKBDR2018, subid = {970}, title = {Flow rate measurement in stacks with cyclonic flow – Error estimations using CFD modelling}, journal = {Measurement}, year = {2018}, month = {12}, volume = {129}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, pages = {167-183}, keywords = {flow measurement, cyclonic flow, velocity measurements, standard reference method, ultrasonic flow measurement, EN ISO 16911-2, validated computational fluid dynamics (CFD) modelling, OpenFoam software, Emissions Trading System}, web_url = {https://arxiv.org/ftp/arxiv/papers/1808/1808.10159.pdf}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2018.06.032}, stag_bib_extends_levelofaccess = {NA}, author = {Gersl, J. and Knotek, S. and Belligoli, Z. and Dwight, R.P. and Robinson, R.A. and Coleman, M.D.} } @Proceedings { PeinerXBVKF2018, subid = {1025}, title = {Optimizing a Cantilever Measurement System towards High Speed, Nonreactive Contact-Resonance-Profilometry}, journal = {Proceedings}, year = {2018}, month = {11}, day = {21}, volume = {2}, number = {13}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {889}, keywords = {contact resonance spectroscopy; layer analysis; piezoresistive; tactile cantilever;automatic gain control; phase-locked-loop}, web_url = {https://www.mdpi.com/2504-3900/2/13/889}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, event_place = {Graz, Austria}, event_name = {Eurosensors 2018}, event_date = {09-09-2018 to 12-09-2018}, language = {30}, ISSN = {2504-3900}, DOI = {10.3390/proceedings2130889}, stag_bib_extends_levelofaccess = {NA}, author = {Fahrbach, M. and Krieg, L. and Voss, T. and Bertke, M. and Xu, J. and Peiner, E.} } @Article { NewellHMRLKHCPYKE2018, subid = {994}, title = {Confocal laser scanning microscopy for rapid optical characterization of graphene}, journal = {Communications Physics}, year = {2018}, month = {11}, day = {20}, volume = {1}, number = {1}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, keywords = {Confocal microscopy, graphene.}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-018-0084-6}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, V. and Yang, Y. and Cheng, G. and Hu, J. and Kruskopf, M. and Liu, C.I. and Rigosi, A.F. and Melios, C. and Hight Walker, A.R. and Newell, D.B. and Kazakova, O. and Elmquist, R.E.} } @Article { KainzZMKNL2018, subid = {938}, title = {Novel mechanistic model and computational approximation for electromagnetic safety evaluations of electrically short implants}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {11}, day = {12}, volume = {63}, number = {22}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {225015}, keywords = {implants, safety, mechanistic model, electromagnetic fields, numerical dosimetry, standardization activities}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aae94c/pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aae94c}, stag_bib_extends_levelofaccess = {NA}, author = {Liorni, I. and Neufeld, E. and K{\"u}hn, S. and Murbach, M. and Zastrow, E. and Kainz, W.} } @Article { JaksiMODPCMTSSKDHLDGF2018, subid = {1009}, title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond}, journal = {ACS Photonics}, year = {2018}, month = {11}, day = {12}, volume = {5}, number = {12}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4864-4871}, keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.8b01013}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Herzig, T. and K{\"u}pper, J. and Damin, A. and Santonocito, S. and Signorile, M. and Traina, P. and Moreva, E. and Celegato, F. and Pezzagna, S. and Degiovanni, I. P. and Olivero, P. and Jakšić, M. and Meijer, J. and Genovese, P. M. and Forneris, J.} } @Article { JaksiMODPCMTSSKDHLDGF20180, subid = {1009}, title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond}, journal = {ACS Photonics}, year = {2018}, month = {11}, day = {12}, volume = {5}, number = {12}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {4864-4871}, keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.8b01013}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Herzig, T. and K{\"u}pper, J. and Damin, A. and Santonocito, S. and Signorile, M. and Traina, P. and Moreva, E. and Celegato, F. and Pezzagna, S. and Degiovanni, I. P. and Olivero, P. and Jakšić, M. and Meijer, J. and Genovese, P. M. and Forneris, J.} } @Article { WinterRKP2018, title = {Multidimensional model to correct PV device performance measurements taken under diffuse irradiation to reference conditions}, journal = {Solar Energy}, year = {2018}, month = {11}, volume = {174}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {431-444}, keywords = {Modeling; PV metrology; Calibration; Angle of incidence; Diffuse irradiance; Optical losses; Numerical method}, web_url = {https://www.sciencedirect.com/science/article/pii/S0038092X18308429?via\%3Dihub}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2018.08.072}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, S. and Riechelmann, S. and Kr{\"o}ger, I. and Plag, F.} } @Article { JakubowskiLKNPTRES2018, subid = {937}, title = {Gadolinium in human brain sections and colocalization with other elements}, journal = {Neurology - Neuroimmunology Neuroinflammation}, year = {2018}, month = {10}, day = {19}, volume = {6}, number = {1}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {e515}, keywords = {Gadolinium, Gadolinium-based contrast agents, Human brain, MRI, LA-ICP-MS, Iron, Copper, Phosphorus}, web_url = {http://nn.neurology.org/content/6/1/e515/}, misc2 = {EMPIR 2015: Health}, publisher = {Ovid Technologies (Wolters Kluwer Health)}, language = {30}, ISSN = {2332-7812}, DOI = {10.1212/NXI.0000000000000515}, stag_bib_extends_levelofaccess = {NA}, author = {El-Khatib, A.H. and Radbruch, H. and Trog, S. and Neumann, B. and Paul, F. and Koch, A. and Linscheid, M.W. and Jakubowski, N. and Schellenberger, E.} } @Article { KuosmanenTHWV2018, title = {Uncertainty analysis of phase and amplitude of harmonic components of bearing inner ring four-point roundness measurement}, journal = {Precision Engineering}, year = {2018}, month = {10}, volume = {54}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {118-130}, keywords = {Monte-Carlo simulation, Phase uncertainty, Harmonic component uncertainty, Uncertainty evaluation, Bearing excitation, Odd and even harmonic components, Four-point method, Three-point method}, web_url = {https://www.sciencedirect.com/science/article/pii/S0141635918302368}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2018.05.008}, stag_bib_extends_levelofaccess = {NA}, author = {Kuosmanen, P. and Tammi, K. and Hemming, B. and Widmaier, T. and Viitala, R.} } @Article { PepperRFJGFSSREJJK2018, subid = {1113}, title = {LO-Phonon Emission Rate of Hot Electrons from an On-Demand Single-Electron Source in a GaAs/AlGaAs Heterostructure}, journal = {Physical Review Letters}, year = {2018}, month = {9}, day = {26}, volume = {121}, number = {13}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Single electron pumps, hot electron transport, phonon emission, phonon relaxation, optical phonons, edge states, electron optics, electron quantum optics}, web_url = {https://arxiv.org/abs/1712.09031}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.121.137703}, stag_bib_extends_levelofaccess = {NA}, author = {Johnson, N. and Emary, C. and Ryu, S. and Sim, H.S. and See, P. and Fletcher, J.D. and Griffiths, J.P. and Jones, G.A.C. and Farrer, I. and Ritchie, D.A. and Pepper, M. and Janssen, T.J.B.M. and Kataoka, M.} } @Article { HisamotoRHLASTYTLSK2018, subid = {595}, title = {Quantum Dipole Effects in a Silicon Transistor under High Electric Fields}, journal = {Journal of the Physical Society of Japan}, year = {2018}, month = {9}, day = {15}, volume = {87}, number = {9}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {094801}, keywords = {Si, CMOS, transistor, quantum dipole, Heisenberg model}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Physical Society of Japan}, language = {30}, ISSN = {0031-9015, 1347-4073}, DOI = {10.7566/jpsJ.87.094801}, stag_bib_extends_levelofaccess = {NA}, author = {Saito, S. and Li, Z. and Yoshimoto, H, and Tomita, I. and Tsuchiya, Y. and Sasago, Y. and Arimoto, H. and Liu, F. and Husain, M.K. and Hisamoto, D. and Rutt, H.N. and Kurihara, S.} } @Article { KonijnenbergGMGGCGR2018, subid = {825}, title = {EANM practical guidance on uncertainty analysis for molecular radiotherapy absorbed dose calculations}, journal = {European Journal of Nuclear Medicine and Molecular Imaging}, year = {2018}, month = {9}, day = {14}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, keywords = {Dosimetry, Absorbed Dose}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {1619-7070, 1619-7089}, DOI = {10.1007/s00259-018-4136-7}, stag_bib_extends_levelofaccess = {NA}, author = {Gear, J.I. and Cox, M.G. and Gustafsson, J. and Gleisner, K.S. and Murray, I. and Glatting, G. and Konijnenberg, M. and Flux, G. D.} } @Article { KuosmanenWV2018, title = {Subcritical vibrations of a large flexible rotor efficiently reduced by modifying the bearing inner ring roundness profile}, journal = {Mechanical Systems and Signal Processing}, year = {2018}, month = {9}, volume = {110}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {42-58}, keywords = {Rotor dynamics, Dynamic run-out, Low-order bearing waviness, Four-point method}, web_url = {https://www.sciencedirect.com/science/article/pii/S0888327018301298}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0888-3270}, DOI = {10.1016/j.ymssp.2018.03.010}, stag_bib_extends_levelofaccess = {NA}, author = {Kuosmanen, P. and Widmaier, T. and Viitala, R.} } @Article { KonemannOWESFS2018, subid = {806}, title = {Selection and Characterization of Liquids for a Low Pressure Interferometric Liquid Column Manometer}, journal = {Measurement}, year = {2018}, month = {9}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, keywords = {primary pressure standard, low pressure, liquid column manometer, vacuum oil, gas saturation}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2018.09.017}, stag_bib_extends_levelofaccess = {NA}, author = {Ehlers, S. and K{\"o}nemann, J. and Ott, O. and Wolf, H. and Šetina, J. and Furtado, A. and Sabuga, W.} } @Article { StrupinskiUOGPMPMPWKB2018, subid = {992}, title = {Electrical Homogeneity Mapping of Epitaxial Graphene on Silicon Carbide}, journal = {ACS Applied Materials \& Interfaces}, year = {2018}, month = {8}, day = {21}, volume = {10}, number = {37}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, pages = {31641-31647}, keywords = {conductivity; graphene; metrology; micro four-point probe; SiC; terahertz spectroscopy}, web_url = {https://pubs.acs.org/doi/10.1021/acsami.8b11428}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1944-8244, 1944-8252}, DOI = {10.1021/acsami.8b11428}, stag_bib_extends_levelofaccess = {NA}, author = {Whelan, P.R. and Panchal, V. and Petersen, D.H. and Mackenzie, D.M.A. and Melios, C. and Pasternak, I. and Gallop, J. and {\O}sterberg, F.W. and U. Jepsen, P. and Strupinski, W. and Kazakova, O. and B{\o}ggild, P.} } @Article { KoppmannHGRAMO2018, title = {A large-area blackbody for in-flight calibration of an infrared interferometer deployed on board a long-duration balloon for stratospheric research}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {8}, day = {14}, volume = {11}, number = {8}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {4757-4762}, keywords = {GLORIA, Calibration}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-4757-2018}, stag_bib_extends_levelofaccess = {NA}, author = {Koppmann, R. and Hollandt, J. and Gutschwager, B. and Reiniger, M. and Adibekyan, A. and Monte, C. and Olschewski, F.} } @Article { UllischNelkenWK2018, subid = {718}, title = {Analysis of the noise exposure and the distribution of machine types at ultrasound related industrial workplaces in Germany}, journal = {Acta Acustica united with Acustica}, year = {2018}, month = {8}, day = {14}, volume = {104}, number = {2018}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {733-736}, keywords = {German national guidelines; Machine categories; airborne ultrasound exposure; threshold transgression; ultrasonic appliances}, web_url = {http://www.ingentaconnect.com/search/article?option1=tka\&value1=Analysis+of+the+noise+exposure+and+the+distribution+of+machine+types+at+ultrasound+related+industrial\&pageSize=10\&index=1\#Refs}, misc2 = {EMPIR 2015: Health}, publisher = {S. Hirzel Verlag}, language = {30}, ISSN = {1610-1928}, DOI = {10.3813/AAA.919212}, stag_bib_extends_levelofaccess = {NA}, author = {Ullisch-Nelken, C. and Kusserow, H. and Wolff, A.} } @Article { YooSWWIAKR2018, subid = {842}, title = {Extrusion 3D Printing of Paracetamol Tablets from a Single Formulation with Tunable Release Profiles Through Control of Tablet Geometry}, journal = {AAPS PharmSciTech}, year = {2018}, month = {8}, day = {10}, volume = {19}, number = {11}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, keywords = {3D printing; paracetamol; sustained release; immediate release; personalised medicine; geometry}, web_url = {https://link.springer.com/article/10.1208/s12249-018-1107-z}, misc2 = {EMPIR 2015: Health}, publisher = {American Association of Pharmaceutical Scientists (AAPS)}, language = {30}, ISSN = {1530-9932}, DOI = {10.1208/s12249-018-1107-z}, stag_bib_extends_levelofaccess = {NA}, author = {Khaled, S.A. and Alexander, M.R. and Irvine, D.J. and Wildman, R.D. and Wallace, M.J. and Sharpe, S. and Yoo, J. and Roberts, C.J.} } @Article { HaileLGK2018, subid = {962}, title = {Characterizing the operating conditions of bifacial modules}, journal = {AIP Conference Proceedings 1999, 020014 (2018)}, year = {2018}, month = {8}, day = {10}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Si bifacial PV module}, web_url = {https://aip.scitation.org/doi/10.1063/1.5049253}, misc2 = {EMPIR 2016: Energy}, publisher = {Author(s)}, language = {30}, DOI = {10.1063/1.5049253}, stag_bib_extends_levelofaccess = {NA}, author = {Kenny, R.P. and Garcia Menendez, E. and Lopez-Garcia, J. and Haile, B.} } @Miscellaneous { Klein, subid = {1018}, title = {Sensor data set, electromechanical cylinder at ZeMA testbed (2kHz)}, journal = {Zenodo Community}, year = {2018}, month = {8}, day = {2}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {acceleration, microphone, velocity, sensor network, condition monitoring}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.1326277}, stag_bib_extends_levelofaccess = {NA}, author = {Klein, S.} } @Article { KazakovaMYEPL2018, subid = {991}, title = {Detection of Ultralow Concentration NO2 in Complex Environment Using Epitaxial Graphene Sensors}, journal = {ACS Sensors}, year = {2018}, month = {8}, volume = {3}, number = {9}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, pages = {1666-1674}, keywords = {air quality; environmental monitoring; epitaxial graphene; graphene sensors; Hall effect; nitrogen dioxide}, web_url = {https://arxiv.org/abs/1808.09776}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2379-3694, 2379-3694}, DOI = {10.1021/acssensors.8b00364}, stag_bib_extends_levelofaccess = {NA}, author = {Melios, C. and Panchal, V. and Edmonds, K. and Lartsev, A. and Yakimova, R. and Kazakova, O.} } @Article { SaxholmSHHSK2018, title = {Low-Pressure and Low-Temperature Dew/Frost-Point Generator}, journal = {International Journal of Thermophysics}, year = {2018}, month = {8}, volume = {39}, number = {9}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Dew-point generator, Frost-point generator, Humidity, Low pressure, Uncertainty}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-018-2425-9}, stag_bib_extends_levelofaccess = {NA}, author = {Saxholm, S. and Salminen, J. and H{\"o}gstr{\"o}m, R. and Heinonen, M. and Sairanen, H. and Kajastie, H.} } @Proceedings { HodoroabaKHS2018, subid = {954}, title = {Analysis of Mesoporous Iridium Oxide Thin Films by the Combined Methodical Approach SEM/EDS/STRATAGem}, journal = {Proceedings of Microscopy \& Microanalysis 2018}, year = {2018}, month = {8}, volume = {24}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {762-763}, keywords = {Electron probe microanalysis (EPMA); Iridium oxide; Porous thin films; Spectroscopic ellipsometry}, misc2 = {EMPIR 2016: Energy}, publisher = {Cambridge University Press (CUP)}, event_place = {Baltimore, Maryland, USA}, event_name = {Microscopy \& Microanalysis 2018}, event_date = {05-08-2018 to 09-08-2018}, language = {30}, ISSN = {1431-9276, 1435-8115}, DOI = {10.1017/S1431927618004300}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Hertwig, A. and Kraehnert, R. and Hodoroaba, V.D.} } @Article { OguzAytekinKMSISFSZSJoHBHPV2018, subid = {1086}, title = {Improving emerging European NMIs’ capabilities in humidity measurement}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {122019}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/12/122019}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Zvizdić, D. and Sestan, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Article { KuuskABVF2018, subid = {2453}, title = {Implication of Illumination Beam Geometry on Stray Light and Bandpass Characteristics of Diode Array Spectrometer}, journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing}, year = {2018}, month = {8}, volume = {11}, number = {8}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {2925-2932}, keywords = {Optical fibre devices, Optical spectroscopy, stray light, laser measurement, Illumination beam geometry}, misc2 = {EMPIR 2016: Environment}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1939-1404, 2151-1535}, DOI = {10.1109/JSTARS.2018.2841772}, stag_bib_extends_levelofaccess = {NA}, author = {Kuusk, J. and Ansko, I. and Bialek, A. and Vendt, R. and Fox, N.} } @Article { HoflingSBBHSGLFSKRS2018_2, subid = {696}, title = {Photon-Number-Resolved Measurement of an Exciton-Polariton Condensate}, journal = {Physical Review Letters}, year = {2018}, month = {7}, day = {25}, volume = {121}, number = {4}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {047401}, keywords = {Exciton Polariton, Photon Statistics}, web_url = {https://arxiv.org/abs/1805.02959}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.121.047401}, stag_bib_extends_levelofaccess = {NA}, author = {Klaas, M. and Schlottmann, E. and Flayac, H. and Laussy, F. P. and Gericke, F. and Schmidt, M. and Helversen, M. v. and Beyer, J. and Brodbeck, S. and Suchomel, H. and H{\"o}fling, S. and Reitzenstein, S. and Schneider, C.} } @Article { MonteGAUKK2018, title = {Characterization of blackbody inhomogeneity and its effect on the retrieval results of the GLORIA instrument}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {7}, volume = {11}, number = {7}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {3871-3882}, keywords = {GLORIA,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-3871-2018}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Gutschwager, B. and Adibekyan, A. and Ungermann, J. and Krisch, I. and Kleinert, A.} } @Article { WeisbachKHDBALKHW2018, subid = {515}, title = {Development and characterization of sub-monolayer coatings as novel calibration samples for X-ray spectroscopy}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2018}, month = {7}, volume = {145}, number2 = {14IND07: 3D Stack: Metrology for manufacturing 3D stacked integrated circuits}, pages = {36-42}, keywords = {X-ray fluorescence, calibration samples}, web_url = {https://arxiv.org/abs/1801.04246}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2018.04.001}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Kr{\"a}mer, M. and L{\"u}hl, L. and Andrianov, K. and Beckhoff, B. and Dietsch, R. and Holz, T. and Kanngie{\ss}er, B. and Wei{\ss}bach, D. and Wilhein, T.} } @Article { RottgerDDBKN2018, title = {Novel spectrometers for environmental dose rate monitoring}, journal = {Journal of Environmental Radioactivity}, year = {2018}, month = {7}, volume = {187}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {115-121}, keywords = {Environmental dosimetry, Spectrometers, MetroERM, Early warning networks}, web_url = {https://www.sciencedirect.com/science/article/pii/S0265931X17304976?via\%3Dihub}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0265-931X}, DOI = {10.1016/j.jenvrad.2018.01.020}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and Dombrowski, H. and Dabrowski, R. and Behnke, B. and Kessler, P. and Neumaier, S.} } @Article { UngerDTSK2018, subid = {560}, title = {Surface characterisation of Escherichia coli under various conditions by near-ambient pressure XPS}, journal = {Surface and Interface Analysis}, year = {2018}, month = {7}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {1-5}, keywords = {bacteria, E.coli, NAP-XPS}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/sia.6480}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.6480}, stag_bib_extends_levelofaccess = {NA}, author = {Kjaervik, M. and Schwibbert, K. and Dietrich, P. and Thissen, A. and Unger, W.E.S.} } @Proceedings { ArifovicDKM2018, subid = {855}, title = {Performance of Reference Partial Discharge Measurement System}, journal = {Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, volume = {1}, number = {1}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, pages = {1-2}, keywords = {Calibration, charge measurement, partial discharge, PD measurement, uncertainty}, web_url = {https://zenodo.org/record/1343872\#.W9cMuNX7TIU\&\#10;https://ieeexplore.ieee.org/document/8500956/metrics\#metrics}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, event_place = {Paris, France}, event_name = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, event_date = {08-07-2018 to 13-07-2018}, language = {30}, ISBN = {978-1-5386-0973-6}, ISSN = {978-1-5386-0974-3}, DOI = {10.5281/zenodo.1343872}, stag_bib_extends_levelofaccess = {NA}, author = {Merev, A. and Karaman, I. and Dedeoğlu, S. and Arifovi\c{c}, M.} } @Article { SchaeffterTFSKWPW2018, subid = {942}, title = {Improved sensitivity and limit-of-detection using a receive-only coil in magnetic particle imaging}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {7}, volume = {63}, number = {13}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {13NT02}, keywords = {magnetic nanoparticles, magnetic particle imaging, magnetic measurements}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aacb87}, stag_bib_extends_levelofaccess = {NA}, author = {Paysen, H. and Wells, J. and Kosch, O. and Steinhoff, U. and Franke, J. and Trahms, L. and Schaeffter, T. and Wiekhorst, F.} } @Article { LudwigSKSDGTNPFJBPKRI2018, subid = {900}, title = {Development of white LED illuminants for colorimetry and recommendation of white LED reference spectrum for photometry}, journal = {Metrologia}, year = {2018}, month = {6}, day = {28}, volume = {55}, number = {4}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {526-534}, keywords = {Photometry, colorimetry, illuminant, reference spectrum, photometer, calibration, uncertainty}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aacae7}, stag_bib_extends_levelofaccess = {NA}, author = {Kokka, A. and Poikonen, T. and Blattner, P. and Jost, S. and Ferrero, A. and Pulli, T. and Ngo, M. and Thorseth, A. and Gerloff, T. and Dekker, P. and Stuker, F. and Klej, A. and Ludwig, K. and Schneider, M. and Reiners, T. and Ikonen, E.} } @Article { WubbelerRPKHUHSKZ2018, subid = {1114}, title = {Compressed sensing FTIR nano-spectroscopy and nano-imaging}, journal = {Optics Express}, year = {2018}, month = {6}, day = {28}, volume = {26}, number = {14}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {18115}, keywords = {Infrared scattering scanning near-field optical microscopy, Optical spectroscopy, Compressed sensing}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-14-18115}, misc2 = {EMPIR 2016: Energy}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.018115}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}stner, Bernd and Schm{\"a}hling, Franko and Hornemann, Andrea and Ulrich, Georg and Hoehl, Arne and Kruskopf, Mattias and Pierz, Klaus and Raschke, Markus B. and W{\"u}bbeler, Gerd and Elster, C.} } @Manual { KielerBWMRCSBSSCDOB2018, subid = {719}, title = {Good Practice Guide on the operation of AC quantum voltage standards}, year = {2018}, month = {6}, day = {21}, volume = {1}, number2 = {14RPT01: ACQ-PRO: Towards the propagation of ac quantum voltage standards}, note = {ISBN ok https://grp.isbn-international.org/search/piid_cineca_solr/978-80-905619\%2B\%2528ISBNPrefix\%2529?keys=978-80-905619\%2B\%2528ISBNPrefix\%2529}, keywords = {Good Practice Guide, quantum standards, alternating voltage, Josephson effect, measurement techniques, uncertainty estimation, software tools, safe operation, cryogenic equipment}, misc2 = {EMPIR 2014: Research Potential}, publisher = {Czech Metrology Institute}, address = {Brno}, language = {30}, ISBN = {978-80-905619-2-2}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://acqpro.cmi.cz/index.php/results/28-good-practice-guide}, author = {Kieler, O. and Behr, R. and Williams, J.M. and Malmbekk, H. and Ribeiro, L. and Cabral, V. and Sosso, A. and Bruszewski, P. and Š{\'i}ra, M. and Sanmamed, Y.A. and Caballero, R. and Diaz de Aguilar, J. and Orhan, R. and Bonfait, G.} } @Article { IkonenGEVK2018, title = {Uncertainty analysis of total ozone derived from direct solar irradiance spectra in the presence of unknown spectral deviations}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {6}, day = {20}, volume = {11}, number = {6}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {3595-3610}, keywords = {solar UV, spectral irradiance, total ozone column, systematic spectral deviations, spectral correlations, uncertainty}, web_url = {https://doi.org/10.5194/amt-11-3595-2018}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-3595-2018}, stag_bib_extends_levelofaccess = {NA}, author = {Ikonen, E. and Gr{\"o}bner, J. and Egli, L. and Vaskuri, A. and K{\"a}rh{\"a}, P.} } @Article { TettamanziKDRMHTRK2018, subid = {828}, title = {Gigahertz Single-Electron Pumping Mediated by Parasitic States}, journal = {Nano Letters}, year = {2018}, month = {6}, day = {19}, volume = {18}, number = {7}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {4141-4147}, keywords = {silicon electron pump}, web_url = {https://arxiv.org/abs/1803.00791}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1530-6984, 1530-6992}, DOI = {10.1021/acs.nanolett.8b00874}, stag_bib_extends_levelofaccess = {NA}, author = {Rossi, A. and Klochan, J. and Timoshenko, J. and Hudson, F.E. and M{\"o}tt{\"o}nen, M. and Rogge, S. and Dzurak, A.S. and Kashcheyevs, V. and Tettamanzi, G.C.} } @Article { RaaymakersKvHWvW2018, subid = {951}, title = {A formalism for reference dosimetry in photon beams in the presence of a magnetic field}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {6}, day = {11}, volume = {63}, number = {12}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {125008}, keywords = {Dosimetry, MRgRT, Radiotherapy, magnetic fields}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aac70e/meta}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aac70e}, stag_bib_extends_levelofaccess = {NA}, author = {van Asselen, B. and Woodings, S.J. and Hackett, S.L. and van Soest, T.L. and Kok, J.G.M and Raaymakers, B.W and Wolthaus, J.W.H} } @Article { OverneyMDCKPOG2018, title = {An international comparison of phase angle standards between the novel impedance bridges of CMI, INRIM and METAS}, journal = {Metrologia}, year = {2018}, month = {6}, volume = {55}, number = {4}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {499-512}, keywords = {impedance metrology, impedance bridges, impedance standards, digital instrumens, comparisons}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aabf24}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aabf24}, stag_bib_extends_levelofaccess = {NA}, author = {Overney, F. and Marzano, M. and D’Elia, V. and Callegaro, L. and Kucera, J. and Palafox, L. and Ortolano, M. and G{\"u}lmez, G.} } @Proceedings { FoyerWKGO2018, subid = {590}, title = {Development of a torque calibration procedure under rotation for nacelle test benches}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {6}, volume = {1037}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, pages = {052030}, keywords = {torque calibration, nacelle test benches, NTB, torque transfer standard, rotational zero point determination, rotational speed}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/1037/5/052030/pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, event_place = {Milano, Italy}, event_name = {TORQUE 2018}, event_date = {20-06-2018 to 22-06-2018}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1037/5/052030}, stag_bib_extends_levelofaccess = {NA}, author = {Weidinger, P and Foyer, G and Kock, S and Gnauert, J and Kumme, R.} } @Article { WidmaierVRLEHKL2018, title = {Interferometric step gauge for CMM verification}, journal = {Measurement Science and Technology}, year = {2018}, month = {6}, volume = {29}, number = {7}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {074012}, keywords = {CMM, verification, metrology}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aabd2b}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, DOI = {10.1088/1361-6501/aabd2b}, stag_bib_extends_levelofaccess = {NA}, author = {Widmaier, T. and Viitala, R. and Rantanen, A. and Laukkanen, P. and Esala, V.P. and Hemming, B. and Kuosmanen, P. and Lassila, A.} } @Article { ThorwarthKDP2018, subid = {839}, title = {Ionization chamber correction factors for MR-linacs}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {6}, volume = {63}, number = {11}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {11NT03}, keywords = {MRgRT, reference dosimetry}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aac4f2}, stag_bib_extends_levelofaccess = {NA}, author = {Pojtinger, S. and Dohm, O.S. and Kapsch, R.P. and Thorwarth, D.} } @Article { HaeringLMDRK2018, subid = {838}, title = {Feasibility of polymer gel-based measurements of radiation isocenter accuracy in magnetic fields}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {5}, day = {29}, volume = {63}, number = {11}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {11NT02}, keywords = {3D-dosimetry, MRgRT, gel-dosimetry}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aac228/meta}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aac228}, stag_bib_extends_levelofaccess = {NA}, author = {Dorsch, S. and Mann, P. and Lang, C. and Haering, P. and Runz, A. and Karger, C.P.} } @Article { vanSlagerenKFKPFKMPKBMP2018, subid = {898}, title = {Room Temperature Uniaxial Magnetic Anisotropy Induced By Fe-Islands in the InSe Semiconductor Van Der Waals Crystal}, journal = {Advanced Science}, year = {2018}, month = {5}, day = {11}, volume = {5}, number = {7}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {1800257}, keywords = {Magnetic Anisotropy, Nanotechnology, Nano-scale traceable magnetic field measurements}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Wiley}, language = {30}, ISSN = {2198-3844}, DOI = {10.1002/advs.201800257}, stag_bib_extends_levelofaccess = {NA}, author = {Moro, F. and Bhuiyan, M.A. and Kudrynskyi, Z.R. and Puttock, R. and Kazakova, O. and Makarovsky, O. and Fay, M.W. and Parmenter, C. and Kovalyuk, Z.D. and Fielding, A.J. and Kern, M. and van Slageren, J. and Patan{\`e}, A.} } @Article { BelenguerJKLA2018, subid = {796}, title = {Empty Substrate Integrated Waveguide-Fed MMW Aperture-Coupled Patch Antenna for 5G Applications}, journal = {EuCAP}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {5G, antennas, millimetre-wave, Empty Substrate Integrated Waveguide.}, web_url = {http://www.eucap.org/}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1809.07817}, author = {Belenguer, A. and Jilani, S.F. and Khan, Z.U. and Loh, T. H. and Alomainy, A.} } @Article { KimBBWLAM2018, subid = {843}, title = {Improved Extraction Repeatability and Spectral Reproducibility for Liquid Extraction Surface Analysis–Mass Spectrometry Using Superhydrophobic–Superhydrophilic Patterning}, journal = {Analytical Chemistry}, year = {2018}, month = {4}, day = {27}, volume = {90}, number = {10}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {6001-6005}, keywords = {liquid extraction surface analysis (LESA); Droplet Microarray (DMA); extraction solvent; mass spectrometry}, web_url = {https://pubs.acs.org/doi/pdf/10.1021/acs.analchem.8b00973}, misc2 = {EMPIR 2015: Health}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0003-2700, 1520-6882}, DOI = {10.1021/acs.analchem.8b00973}, stag_bib_extends_levelofaccess = {NA}, author = {Meurs, J. and Alexander, M.R. and Levkin, P.A. and Widmaier, S. and Bunch, J. and Barrett, D.A. and Kim, D.H.} } @Miscellaneous { BastuckKS, subid = {1019}, title = {Condition monitoring of hydraulic systems Data Set}, journal = {Zenodo Community}, year = {2018}, month = {4}, day = {26}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {sensor network, condition monitoring, hydraulic}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.1323610}, stag_bib_extends_levelofaccess = {NA}, author = {Bastuck, M. and Klein, S. and Schneider, T.} } @Article { HeinrichSPHDKA2018, subid = {1053}, title = {Traceable Coplanar Waveguide Calibrations on Fused Silica Substrates up to 110 GHz}, journal = {IEEE TRANSACTIONS ON MICROWAVE THEORY AND TECHNIQUES}, year = {2018}, month = {4}, day = {19}, volume = {t.b.d.}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1-10}, keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=8693763}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TMTT.2019.2908857}, stag_bib_extends_levelofaccess = {NA}, author = {Arz, U. and Kuhlmann, K. and Dziomba, T. and Hechtfischer, G. and Phung, G. and Schm{\"u}ckle, F. and Heinrich, W.} } @Article { KastnerJHKPHHUFPRU2018, subid = {1690}, title = {Infrared Nanospectroscopy of Phospholipid and Surfactin Monolayer Domains}, journal = {ACS Omega}, year = {2018}, month = {4}, day = {12}, volume = {3}, number = {4}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {4141-4147}, keywords = {-}, misc2 = {EMPIR 2016: Energy}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2470-1343, 2470-1343}, DOI = {10.1021/acsomega.7b01931}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}stner, B. and Johnson, C.M. and Hermann, P. and Kruskopf, M. and Pierz, K. and Hoehl, A. and Hornemann, A. and Ulrich, G. and Fehmel, J. and Patoka, P. and Ruhl, E. and Ulm, G.} } @Article { KovaS2018, title = {Subtraction of natural radiation contribution from gamma-ray spectra measured by HPGe detector}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {4}, volume = {134}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {167-171}, keywords = {HPGe detectors, Monte Carlo simulations, Airborne radioactivity measurement, Early warning networks,, Natural radionuclides subtraction}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.07.024}, stag_bib_extends_levelofaccess = {NA}, author = {Kov{\'a}ř, P. and Solc, J.} } @Article { KajastieOPSSPH2018, title = {Effects of Sample Handling and Transportation on the Moisture Content of Biomass Samples}, journal = {International Journal of Thermophysics}, year = {2018}, month = {4}, volume = {39}, number = {5}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Biomass, Moisture content, Sample handling, Transportation}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-018-2382-3}, stag_bib_extends_levelofaccess = {NA}, author = {Kajastie, H. and Ojanen-Saloranta, M. and Patel, S. and Sairanen, H. and Salminen, J. and Palkova, Z. and Heinonen, M.} } @Article { RedondasSSEMNKS2018, title = {Optical characterisation of three reference Dobsons in the ATMOZ Project – verification of G. M. B. Dobson's original specifications}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {4}, volume = {11}, number = {4}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {1989-1999}, keywords = {Total Ozone Column, spectrophotometers, Dobson, slit function, effective absorption coefficents}, web_url = {https://www.atmos-meas-tech.net/11/1989/2018/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-1989-2018}, stag_bib_extends_levelofaccess = {NA}, author = {Redondas, A. and Stanek, M. and Smid, M. and Evans, R. and McConville, G. and Nevas, S. and K{\"o}hler, U. and Sch{\"o}nenborn, F.} } @Proceedings { BlissBKG2018, subid = {1096}, title = {Accessing the Performance of Individual Cells of Fully Encapsulated PV Modules Using a Commercial Digital Light Processing Projector}, journal = {PVSAT proceedings}, year = {2018}, month = {4}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Photovoltaic}, web_url = {https://hdl.handle.net/2134/34784}, misc2 = {EMPIR 2016: Energy}, event_place = {London}, event_name = {PVSAT-14}, event_date = {18-04-2018 to 20-04-2018}, language = {30}, ISBN = {0904963845}, stag_bib_extends_levelofaccess = {NA}, author = {Bliss, Martin and Betts, Thomas Richard and Koutsourakis, George and Gottschalg, Ralph} } @Article { ShardKGSGSM2018, subid = {568}, title = {Measuring the size and density of nanoparticles by centrifugal sedimentation and flotation}, journal = {Analytical Methods}, year = {2018}, month = {3}, day = {29}, volume = {2018}, number = {10}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {1725-1732}, keywords = {nanoparticles, centrifugal, sedimentation, flotation, SAXS, measurement, characterisation}, web_url = {http://pubs.rsc.org/en/content/articlelanding/2018/ay/c8ay00237a\#!divAbstract}, misc2 = {EMPIR 2014: Industry}, publisher = {Royal Society of Chemistry}, language = {30}, ISSN = {ISSN 1759-9679}, DOI = {10.1039/c8ay00237a}, stag_bib_extends_levelofaccess = {NA}, author = {Minelli, C. and Sikora, A. and Garcia-Diez, R. and Sparnacci, K. and Gollwitzer, C. and Krumrey, M. and Shard, A.} } @Article { ChudnovskyPGWKGWHZBNZZZZ2018, subid = {582}, title = {Direct writing of room temperature and zero field skyrmion lattices by a scanning local magnetic field}, journal = {Applied Physics Letters}, year = {2018}, month = {3}, day = {26}, volume = {112}, number = {13}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {132405}, keywords = {magnetic skyrmion, magnetic force microscopy, stray field, perpendicular magnetic anisotropy}, web_url = {http://hdl.handle.net/10754/627497}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/1.5021172}, stag_bib_extends_levelofaccess = {NA}, author = {Zhang, X, and Zhang, S. and Zhang, J. and Zhang, Q. and Barton, C. and Neu, V. and Zhao, Y. and Hou, Z. and Wen, Y. and Gong, C. and Kazakova, O. and Wang, W. and Peng, Y. and Garanin, D.A. and Chudnovsky, E.M.} } @Article { PoutanenNLKK2018, title = {Validating and comparing GNSS antenna calibrations}, journal = {Journal of Geodesy}, year = {2018}, month = {3}, day = {22}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {1-18}, keywords = {GNSS, Antenna calibration tables, Test field, Validation, Comparison, Residual offset}, web_url = {https://link.springer.com/article/10.1007\%2Fs00190-018-1134-2}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-7714, 1432-1394}, DOI = {10.1007/s00190-018-1134-2}, stag_bib_extends_levelofaccess = {NA}, author = {Poutanen, M. and Nikkonen, V. and Lahtinen, S. and Koivula, H. and Kallio, U.} } @Article { BarlowK2018, subid = {829}, title = {Cross-correlation limit of a SQUID-based noise thermometer of the pMFFT type}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {3}, volume = {969}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {012083}, keywords = {primary magnetic field fluctuation thermometer, SQUID-based, noise thermometer, low temperature}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/969/1/012083}, stag_bib_extends_levelofaccess = {NA}, author = {Kirste, A. and Engert, J} } @Article { CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018, subid = {812}, title = {Geodesy and metrology with a transportable optical clock}, journal = {Nature Physics}, year = {2018}, month = {2}, day = {12}, volume = {14}, number = {5}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {437-441}, keywords = {optical fiber, optical frequency transfer}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-017-0042-3}, stag_bib_extends_levelofaccess = {NA}, author = {Costanzo, G.A. and Zucco, M. and Barbieri, P. and Tampellini, A. and Bregolin, F. and Rauf, B. and Pizzocaro, M. and Thoumany, P. and Margolis, H.S. and Zampaolo, M. and Rolland, A. and Baynes, F.N. and Timmen, L. and Denker, H. and Voigt, C. and Lisdat, C. and H{\"a}fner, S. and Sterr, U. and Vogt, S. and Koller, S. and Grotti, J. and Clivati, C. and Levi, F. and Calonico, D.} } @Article { HoferLRK2018, subid = {588}, title = {The absolutely characterized nitrogen vacancy center-based single-photon source – measurement uncertainty of photon flux and angular emission properties}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {2}, volume = {972}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {012008}, keywords = {single-photon source, Photon f,lux, measurement uncertainty, emission characterisitics}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/972/1/012008/pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/972/1/012008}, stag_bib_extends_levelofaccess = {NA}, author = {Rodiek, B and L{\'o}pez, M and Hofer, H and K{\"u}ck, S} } @Article { HauerSQK2018, subid = {1016}, title = {Polarization properties and microfacet-based modelling of white, grey and coloured matte diffuse reflection standards}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {2}, volume = {972}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {012024}, keywords = {Polarization, BRDF, Microfacet model, diffuse reflection Standards, BiRD-Project}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/972/1/012024}, stag_bib_extends_levelofaccess = {NA}, author = {Quast, T. and Schirmacher, A. and Hauer, K.O. and Koo, A.} } @Article { OhlckersAMKB2018, subid = {455}, title = {Reliability study of fiber-coupled photodiode module for operation at 4 K}, journal = {Microelectronics Reliability}, year = {2018}, month = {2}, volume = {81}, number = {February 2}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {362-367}, keywords = {Optoelectronic packaging, Cryogenics, Voltage standards}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0026-2714}, DOI = {10.1016/j.microrel.2017.10.034}, stag_bib_extends_levelofaccess = {NA}, author = {Bardalen, E. and Karlsen, B. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.} } @Article { BarlowKGAWIOS2018, subid = {830}, title = {Development of large-area high-temperature fixed-point blackbodies for photometry and radiometry}, journal = {Metrologia}, year = {2018}, month = {2}, volume = {55}, number = {2}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {S43-S51}, keywords = {large-area high-temperature fixed point, blackbody, rhenium–carbon,tungsten carbide–carbon, photometry}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://link.springer.com/article/10.1007\%2Fs10765-017-2273-z}, author = {Barlow, C. and Khlevnoy, B. and Grigoryeva, I. and Anhalt, K. and Waehmer, M. and Ivashin, E. and Otryaskin, D. and Solodilov, M.} } @Article { NovotnyDSKV2018, subid = {987}, title = {Characterization of the Si(Li) detector for Monte Carlo calculations of beta spectra}, journal = {Journal of Instrumentation}, year = {2018}, month = {1}, day = {24}, volume = {13}, number = {01}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {P01021-P01021}, keywords = {Si(Li) detector, beta spectrometry, beta spectra, Monte Carlo simulations}, web_url = {https://arxiv.org/abs/1904.01294}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/13/01/P01021}, stag_bib_extends_levelofaccess = {NA}, author = {Novotny, P. and Dry{\'a}k, P. and Solc, J. and Kov{\'a}ř, P. and Vykydal, Z.} } @Article { ReitzensteinHRSKSFS2018_2, subid = {695}, title = {A stand-alone fiber-coupled single-photon source}, journal = {Scientific Reports}, year = {2018}, month = {1}, day = {22}, volume = {8}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1340}, keywords = {quantum-light source, semiconductor quantum dots}, web_url = {https://www.nature.com/articles/s41598-017-19049-4}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-19049-4}, stag_bib_extends_levelofaccess = {NA}, author = {Schlehahn, A. and Fischbach, S. and Schmidt, R. and Kaganskiy, A. and Strittmatter, A. and Rodt, S. and Heindel, T. and Reitzenstein, S.} } @Article { GiuscaPKM2018, subid = {993}, title = {Water on graphene: review of recent progress}, journal = {2D Materials}, year = {2018}, month = {1}, day = {11}, volume = {5}, number = {2}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, pages = {022001}, keywords = {graphene, water, interaction}, web_url = {https://arxiv.org/abs/1804.09518}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/aa9ea9}, stag_bib_extends_levelofaccess = {NA}, author = {Melios, C. and Giusca, C.E. and Panchal, V. and Kazakova, O.} } @Proceedings { KummeSAFW2018, subid = {882}, title = {Investigations towards extrapolation approaches for torque transducer characteristics}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {torque transducers, traceable measurement, extrapolation, partial full range measurement, 20kN}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042057}, stag_bib_extends_levelofaccess = {NA}, author = {Weidinger, P. and Foyer, G. and Ala-Hiiro, J. and Schlegel, C. and Kumme, R.} } @Article { SliwczynskiKT2018, subid = {527}, title = {Long haul time and frequency distribution in different DWDM systems}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2018}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {1-1}, keywords = {time and frequency transfer, DWDM network, optical fiber, alien wavelength}, web_url = {https://ieeexplore.ieee.org/document/8340172/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2018.2827178}, stag_bib_extends_levelofaccess = {NA}, author = {Turza, K. and Krehlik, P. and Śliwczyński, L.} } @Proceedings { BosseKJG2018, subid = {879}, title = {Measurement uncertainty estimation of a novel torque transducer for wind turbine test benches}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {torque transducer, force lever, wind turbine, test benches, multiaxial loads, rotational speed}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042050}, stag_bib_extends_levelofaccess = {NA}, author = {Gnauert, J. and Jacobs, G. and Kock, S. and Bosse, D.} } @Proceedings { GowerBMHLKB2018, title = {Quantitative comparison of different non-destructive techniques for the detection of artificial defects in GFRP}, journal = {Proceedings of 12th European Conference on NDT}, year = {2018}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, keywords = {composites, non-destructive testing, defects}, web_url = {http://www.ndt.net/?id=22834}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Gothenburg}, event_name = {12th European Conference on Non Destructive Testing}, event_date = {11-06-2018 to 15-06-2018}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ecndt2018/papers/ecndt-0297-2018.pdf}, author = {Gower, M. and Brackrock, D. and Maierhofer, C. and Heckel, T. and Lodeiro, M. and Krankenhagen, R. and Baker, G.} } @Article { OhlckersAMKB2018_2, subid = {1183}, title = {Evaluation of InGaAs/InP photodiode for high-speed operation at 4 K}, journal = {International Journal of Metrology and Quality Engineering}, year = {2018}, volume = {9}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {13}, keywords = {optoelectronics / cryogenics / voltage standards}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {EDP Sciences}, language = {30}, ISSN = {2107-6847}, DOI = {10.1051/ijmqe/2018015}, stag_bib_extends_levelofaccess = {NA}, author = {Bardalen, E. and Karlsen, B. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.} } @Article { ScholzePEKHSB2018, subid = {478}, title = {Element sensitive reconstruction of nanostructured surfaces with finite elements and grazing incidence soft X-ray fluorescence}, journal = {Nanoscale}, year = {2018}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, keywords = {GIXRF, nanostructure characterization, FEM}, web_url = {https://arxiv.org/abs/1801.04157}, misc2 = {EMPIR 2014: Industry}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/C8NR00328A}, stag_bib_extends_levelofaccess = {NA}, author = {Soltwisch, V. and Honicke, P. and Kayser, Y. and Eilbracht, J. and Probst, J. and Scholze, F. and Beckhoff, B.} } @Proceedings { KahmannF2018, subid = {877}, title = {A finite element analysis of effects on force lever systems under nacelle test bench conditions}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {international torque standard, force lever system, traceability force and length measurement, nacelle test benches, rotation, mechanical loads}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042006}, stag_bib_extends_levelofaccess = {NA}, author = {Foyer, G. and Kahmann, H.} } @Proceedings { StrangfeldBJK2018, subid = {880}, title = {Simulation method for the characterisation of the torque transducers in MN·m range}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {wind turbine test benches, torque measurement, multi-axial operation, rotational speed}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042014}, stag_bib_extends_levelofaccess = {NA}, author = {Kock, S. and Jacobs, G. and Bosse, D. and Strangfeld, F.} } @Proceedings { GottschalgBBK2018, subid = {965}, title = {Utilising Digital Light Processing and Compressed Sensing for Photocurrent Mapping of Encapsulated Photovoltaic Modules}, journal = {Proceedings of EUPVSEC}, year = {2018}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Non-Destructive Testing, PV Modules, Compressed Sensing, Current Mapping}, web_url = {https://www.eupvsec-proceedings.com/proceedings?paper=44865}, misc2 = {EMPIR 2016: Energy}, event_place = {Brussels}, event_name = {35th European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {24-09-2018 to 27-09-2018}, language = {30}, ISBN = {3-936338-50-7}, DOI = {10.4229/35thEUPVSEC20182018-5BO.11.6}, stag_bib_extends_levelofaccess = {NA}, author = {Gottschalg, R. and Betts, T. and Bliss, M. and Koutsourakis, G. } } @Article { KoblarFSJPH2018, subid = {1156}, title = {Distribution and Accumulation of Major and Trace Elements in Gypsum Samples from Lignite Combustion Power Plant}, journal = {American Journal of Analytical Chemistry}, year = {2018}, volume = {09}, number = {12}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {602-621}, keywords = {Trace and Major Elements, Wet Flue Gas Desulphurization Gypsum, Particle Size Fractions, Mercury and Selenium, Sample Preparation}, misc2 = {EMPIR 2016: Environment}, publisher = {Scientific Research Publishing, Inc,}, language = {30}, ISSN = {2156-8251, 2156-8278}, DOI = {10.4236/ajac.2018.912044}, stag_bib_extends_levelofaccess = {NA}, author = {Pavlin, M. and Jaćimović, R. and Stergaršek, A. and Frkal, P. and Koblar, M. and Horvat, M.} } @Article { BorkowskiKMuC2017, subid = {594}, title = {Optical Feshbach resonances and ground-state-molecule production in the RbHg system}, journal = {Physical Review A}, year = {2017}, month = {12}, day = {15}, volume = {96}, number = {6}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {063411}, keywords = {Optical Feshbach resonances, ultra-cold molecules}, web_url = {https://arxiv.org/abs/1708.05403}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.96.063411}, stag_bib_extends_levelofaccess = {NA}, author = {Borkowski, M. and Mu{\~n}oz Rodriguez, R. and Kosicki, M.B. and Ciuryło, R. and Żuchowski, P.S.} } @Article { SliwczynskiSK2017, subid = {417}, title = {A Hybrid Solution for Simultaneous Transfer of Ultrastable Optical Frequency, RF Frequency, and UTC Time-Tags Over Optical Fiber}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2017}, month = {12}, volume = {64}, number = {12}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {1884-1890}, keywords = {Optical fibers, Optical variables control, Atom optics, Optical filters, Optical fiber communication, Time-frequency analysis}, web_url = {http://ieeexplore.ieee.org/document/8066317/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2017.2759001}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Schnatz, H. and Śliwczyński, L.} } @Article { PivacPSDVFWKBHFDDB2017, subid = {544}, title = {Development and Synchrotron-Based Characterization of Al and Cr Nanostructures as Potential Calibration Samples for 3D Analytical Techniques}, journal = {physica status solidi (a)}, year = {2017}, month = {12}, volume = {215}, number = {6}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {1700866}, keywords = {SIMS, APT, GISAXS, 3D nanostructures, di-block copolymers}, misc2 = {EMPIR 2014: Industry}, publisher = {Wiley}, language = {30}, ISSN = {1862-6300}, DOI = {10.1002/pssa.201700866}, stag_bib_extends_levelofaccess = {NA}, author = {Dialameh, M. and Ferrarese Lupi, F. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Weimann, T. and Fleischmann, C. and Vandervorst, W. and Dubček, P. and Pivac, B. and Perego, M. and Seguini, G. and De Leo, N. and Boarino, L.} } @Article { NielsenAKKIIHGFCCBHOOSS2017, title = {New Primary Standards for Establishing SI Traceability for Moisture Measurements in Solid Materials}, journal = {International Journal of Thermophysics}, year = {2017}, month = {12}, volume = {39}, number = {1}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Karl Fischer, Loss-on-drying, Moisture, Oven drying, Traceability}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2340-5}, stag_bib_extends_levelofaccess = {NA}, author = {Nielsen, J. and Aro, R. and Krasheninina, M. and Keawprasert, T. and Ismail, N. and Ionescu, G.V. and Hudoklin, D. and Georgin, E. and Fernicola, V. and Cortellessa, G. and Choi, B.I. and Bell, S. and Heinonen, M. and Oguz Aytekin, S. and {\"O}sterberg, P. and Skabar, J. and Strnad, R.} } @Article { TakasuBBCJYKTT2017, subid = {775}, title = {Beyond-Born-Oppenheimer effects in sub-kHz-precision photoassociation spectroscopy of ytterbium atoms}, journal = {Physical Review A}, year = {2017}, month = {12}, volume = {96}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {063405}, keywords = {photoassociation, spectroscopy, ytterbium,}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.96.063405}, stag_bib_extends_levelofaccess = {NA}, author = {Borkowski, M. and Buchachenko, A.A. and Ciuryło, R. and Julienne, P.S. and Yamada, H. and Kikuchi, Y. and Takahashi, K. and Takahashi, Y. and Takasu, Y.} } @Article { SassiLGWTMPLBPDCESK2017, title = {Preparation and analysis of zero gases for the measurement of trace VOCs in air monitoring}, journal = {Atmospheric Measurement Techniques Discussions}, year = {2017}, month = {11}, day = {28}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {1-17}, keywords = {zero gas, VOC measurements}, web_url = {https://www.atmos-meas-tech-discuss.net/amt-2017-412/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8610}, DOI = {10.5194/amt-2017-412}, stag_bib_extends_levelofaccess = {NA}, author = {Sassi, G. and Lecuna, M. and Ghorafi, Y. and Wortmann, R. and Tensing, E. and Michl, K. and Plass-Duelmer, C. and Li, J. and Baldan, A. and Persijn, S. and Demichelis, A. and Claude, A. and Englert, J. and Sassi, M.P. and Kubistin, D.} } @Article { WittFKPW2017, title = {Angular-dependent spectral responsivity-Traceable measurements on optical losses in PV devices}, journal = {Progress in Photovoltaics: Research and Applications}, year = {2017}, month = {11}, day = {27}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, keywords = {angle of incidence, calibration, diffuse light, energy rating, optical losses, spectral responsivity}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Wiley}, language = {30}, ISSN = {1062-7995}, DOI = {10.1002/pip.2957}, stag_bib_extends_levelofaccess = {NA}, author = {Witt, F. and Fey, T. and Kr{\"o}ger, I. and Plag, F. and Winter, S.} } @Article { NordlundKRR2017, title = {Atomistic simulation of the measurement of mechanical properties of gold nanorods by AFM}, journal = {Scientific Reports}, year = {2017}, month = {11}, day = {24}, volume = {7}, number = {1}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, keywords = {AFM, gold nanorods, nanowires}, web_url = {https://www.nature.com/articles/s41598-017-16460-9}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-16460-9}, stag_bib_extends_levelofaccess = {NA}, author = {Nordlund, K. and Kuronen, A. and Rohl, A.L. and Reischl, B} } @Article { FountoulakisFGKKKHFDBBLRF2017, title = {Temperature dependence of the Brewer global UV measurements}, journal = {Atmospheric Measurement Techniques}, year = {2017}, month = {11}, day = {22}, volume = {10}, number = {11}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {4491-4505}, keywords = {Brewer spectrophotometer, temperature characterization, UV radiation}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-10-4491-2017}, stag_bib_extends_levelofaccess = {NA}, author = {Fountoulakis, I. and Fragkos, K. and Garane, K. and Koskela, T. and Karhu, J.M. and Karppinen, T. and Heikkila, A. and Feister, U. and Doppler, L. and Bais, A.F. and Berjon, A. and Lakkala, K. and Redondas, A. and Fountoulakis, I.} } @Article { BaeHCGHAK2017, subid = {414}, title = {Upper frequency limit depending on potential shape in a QD-based single electron pump}, journal = {Journal of Applied Physics}, year = {2017}, month = {11}, day = {21}, volume = {122}, number = {19}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {194502}, keywords = {single electron pump, quantum dot, single electron tunneling}, web_url = {http://aip.scitation.org/doi/abs/10.1063/1.5000319}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979, 1089-7550}, DOI = {10.1063/1.5000319}, stag_bib_extends_levelofaccess = {NA}, author = {Ahn, Y.H. and Hong, Y.P. and Hong, C. and Ghee, Y.S. and Chung, Y. and Bae, M.H. and Kim, N.} } @Article { EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017, subid = {602}, title = {First patients treated with a 1.5 T MRI-Linac: clinical proof of concept of a high-precision, high-field MRI guided radiotherapy treatment}, journal = {Physics in Medicine \& Biology}, year = {2017}, month = {11}, day = {14}, volume = {62}, number = {23}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {L41-L50}, keywords = {MRgRT, Radiotherapy, MRI}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aa9517}, stag_bib_extends_levelofaccess = {NA}, author = {Raaymakers, B W and J{\"u}rgenliemk-Schulz, I M and Bol, G H and Glitzner, M and Kotte, A N T J and van Asselen, B and de Boer, J C J and Bluemink, J J and Hackett, S L and Moerland, M A and Woodings, S J and Wolthaus, J W H and van Zijp, H M and Philippens, M E P and Tijssen, R and Kok, J G M and de Groot-van Breugel, E N and Kiekebosch, I and Meijers, L T C and Nomden, C N and Sikkes, G G and Doornaert, P A H and Eppinga, W S C and Kasperts, N and Kerkmeijer, L G W and Tersteeg, J H A and Brown, K J and Pais, B and Woodhead, P and Lagendijk, J J W} } @Article { SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017, title = {The MeteoMet2 project – Highlights and results}, journal = {Measurement Science and Technology}, year = {2017}, month = {11}, day = {13}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa99fc}, stag_bib_extends_levelofaccess = {NA}, author = {Šindel{\'a}rov{\'a}, L. and Sestan, D. and Salminen, J. and Sairanen, H. and Rosso, L. and del Rio, J. and Rasmussen, M.K. and Oguz Aytekin, S. and de Podesta, M. and Pavlasek, P. and Nogueras Cervera, M. and Nielsen, J. and Musacchio, C. and Miao, P. and Lanza, L.G. and Kowal, A. and Kalemci, M. and Hudoklin, D. and H{\"o}gstr{\"o}m, R. and Hernandez de la Villa, S. and Heinonen, M. and Groselj, D. and Gonzalez Calvo, A. and Georgin, E. and Gardiner, T. and Garc{\'i}a Izquierdo, C. and Garcia-Benad{\'i}, A. and Fernicola, V and Ebert, V. and Drnovsek, J. and Dobre, M. and Cuccaro, R. and Coppa, G. and Colli, M. and Chiodo, N. and Castrillo, A. and del Campo, D. and Brunet, M. and Bojkovski, J. and Beltramino, G. and Bell, S.A. and Beges, G. and Sanna, F. and Merlone, A. and Smorgon, D. and Sparasci, F. and Strnad, R. and Vold{\'a}n, M. and Underwood, R.J. and Mana, G.} } @Proceedings { PavanelloZKMSG2017, title = {Comparison of Traceable Calibrations for Filtered Reference Cells}, journal = {EUPVSEC}, year = {2017}, month = {11}, volume = {33rd}, number = {33rd}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {1354-1358}, keywords = {Calibration, Reference Cell, Traceability, World Photovoltaic Scale (WPVS)}, web_url = {https://www.eupvsec-proceedings.com/proceedings?fulltext=Comparison+of+Traceable+Calibrations+for+Filtered+Reference+Cells\&paper=40434}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {WIP}, event_place = {Amsterdam}, event_name = {EU PVSEC}, event_date = {25-09-2017 to 29-09-2017}, language = {30}, ISBN = {3-936338-47-7}, DOI = {10.4229/EUPVSEC20172017-5BO.6.1}, stag_bib_extends_levelofaccess = {NA}, author = {Pavanello, D. and Zaaiman, W. and Kr{\"o}ger, I. and M{\"u}llejans, H. and Salis, E. and Galleano, R.} } @Article { ZhaoRGFHMKF2017, subid = {405}, title = {Thermal-Error Regime in High-Accuracy Gigahertz Single-Electron Pumping}, journal = {Physical Review Applied}, year = {2017}, month = {10}, day = {30}, volume = {8}, number = {4}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Single electron pumps}, web_url = {https://arxiv.org/abs/1703.04795}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.8.044021}, stag_bib_extends_levelofaccess = {NA}, author = {Zhao, R. and Rossi, A. and Giblin, S. P. and Fletcher, J. D. and Fletcher, J. and Hudson, F. E. and M{\"o}tt{\"o}nen, M. and Kataoka, M.} } @Article { UlmKECCSHFB2017, subid = {450}, title = {A pilot study on fingerprinting Leishmania species from the Old World using Fourier transform infrared spectroscopy}, journal = {Analytical \& Bioanalytical Chemistry}, year = {2017}, month = {10}, day = {28}, volume = {409}, number = {29}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {6907-6923}, keywords = {Fourier transforminfrared spectroscopy, Hierarchical cluster analysis (HCA), Principal componentsanalysis (PCA), Leishmania, DNA, Multivariate differentiation}, misc2 = {EMPIR 2015: Health}, publisher = {Springer}, language = {30}, ISSN = {1618-2642}, DOI = {10.1007/s00216-017-0655-5}, stag_bib_extends_levelofaccess = {NA}, author = {Hornemann, A. and Sinning, D. and Cortes, S. and Campino, L. and Emmer, P. and Kuhls, K. and Ulm, G. and Frohme, M. and Beckhoff, B.} } @Article { KesslerDDRN2017, title = {Detection of rain events in radiological early warning networks with spectro-dosimetric systems}, journal = {Journal of Instrumentation}, year = {2017}, month = {10}, day = {12}, volume = {12}, number = {10}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {P10005-P10005}, keywords = {gamma detectors (scintillators, CZT, HPG, HgI etc), models and simulations, radiation monitoring}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/12/10/P10005}, stag_bib_extends_levelofaccess = {NA}, author = {Kessler, P. and Dombrowski, H. and Dabrowski, R. and R{\"o}ttger, A. and Neumaier, S.} } @Article { LestremauLKvBMBCBRYAB2017, title = {Suitability of vessels and adsorbents for the short-term storage of biogas/biomethane for the determination of impurities – Siloxanes, sulfur compounds, halogenated hydrocarbons, BTEX}, journal = {Biomass and Bioenergy}, year = {2017}, month = {10}, volume = {105}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {127-135}, keywords = {BiogasCompositionImpuritiesVesselsSampling}, tags = {EnG}, web_url = {http://www.sciencedirect.com/science/article/pii/S0961953417302118}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, DOI = {10.1016/j.biombioe.2017.06.025}, stag_bib_extends_levelofaccess = {NA}, author = {Lestremau, F. and Li, J. and Krom, I. and van der Veen, A.M.H. and Brewer, B. and Murugan, A. and Bartlett, S. and Culleton, L. and B{\"u}ker, O. and Rosell, L. and Yaghooby, H. and Arrhenius, K. and Beranek, J.} } @Inbook { GillBRBBNKJGBM2017, subid = {379}, title = {Absolute frequency measurement of the optical clock transition in 171Yb+ with an uncertainty of 4E-16 using a frequency link to international atomic time}, year = {2017}, month = {10}, volume = {65}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {221-227}, keywords = {Frequency metrology, optical frequency standards, international atomic time}, web_url = {http://empir.npl.co.uk/oc18/wp-content/uploads/sites/13/2016/04/Yb_J_Mod_Op.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Informa UK Limited}, booktitle = {Journal of Modern Optics}, language = {30}, ISBN = {0950-0340, 1362-3044}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1707.00646v2}, author = {Gill, P. and Bongs, K. and Rolland, A. and Baird, P.E.G. and Baynes, F. and Nisbet-Jones, P.B.R. and King, S.A. and Jones, J.M. and Godun, R.M. and Baynham, C.F.A. and Margolis, H.S.} } @Article { ShawWFZK2017, title = {Improving applied roughness measurement of involute helical gears}, journal = {Measurement Science and Technology}, year = {2017}, month = {9}, day = {20}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, keywords = {roughness measurement, gear surface texture, contact fatigue testing, involute gears, micro pitting}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa8dd6}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa8dd6}, stag_bib_extends_levelofaccess = {NA}, author = {Shaw, B.A. and Wilson, S.J. and Frazer, R. and Zhang, J. and Koulin, G.} } @Article { KabrtSBMRW2017, title = {Production and characterization of a traceable NORM material and its use in proficiency testing of gamma-ray spectrometry laboratories}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, day = {18}, volume = {134}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {45-50}, keywords = {Environmental radioactivity; Gamma-ray spectrometry; NORM; Reference material; Intercomparison; Interlaboratory comparison; Proficiency testing; Quartz sand; Drinking water treatment; Natural radionuclides}, web_url = {https://www.sciencedirect.com/science/article/pii/S0969804317305158}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2017.09.025}, stag_bib_extends_levelofaccess = {NA}, author = {Kabrt, F. and Stietka, M. and Baumgartner, A. and Maringer, F.J. and Riedl, J. and Wiedner, H.} } @Article { RiechelmannHEKGS2017, title = {The high-resolution extraterrestrial solar spectrum (QASUMEFTS) determined from ground-based solar irradiance measurements}, journal = {Atmospheric Measurement Techniques}, year = {2017}, month = {9}, day = {15}, volume = {10}, number = {9}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {3375-3383}, keywords = {extraterrestrail spectrum, QASUMEFTS, QASUME}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-10-3375-2017}, stag_bib_extends_levelofaccess = {NA}, author = {Riechelmann, S. and H{\"u}lsen, G. and Egli, L. and Kr{\"o}ger, I. and Gr{\"o}bner, J. and Sperfeld, P.} } @Article { FailleauHHPSRBZARGVSSKSPLG2017, title = {Metrology for decommissioning nuclear facilities: Partial outcomes of joint research project within the European Metrology Research Program}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Decommissioning, Sample preparation, Metrology}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.032}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Hay, B. and Holm, P. and Per{\"a}j{\"a}rvi, K. and Sand, J. and Rogiers, B. and Boden, S. and Zapata-Garc{\'i}a, D. and Arnold, D. and Russell, B. and Garcia Miranda, M. and Van Ammel, R. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Plumeri, S. and Laurent Beck, Y. and Grisa, T.} } @Article { BogucarskaPdJASSSKSTv2017, title = {New high-throughput measurement systems for radioactive wastes segregation and free release}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {nuclear decommissioning, radioactive waste, free release, clearance level}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.09.043}, stag_bib_extends_levelofaccess = {NA}, author = {Bogucarska, T. and Pedersen, B. and De Felice, P. and Jerome, S. and Arnold, D. and Skala, L. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Tzika, F. and Van Ammel, R.} } @Article { AntonanzasTorresGPLRTHKGU2017, title = {Extensive validation of CM SAF surface radiation products over Europe}, journal = {Remote Sensing of Environment}, year = {2017}, month = {9}, volume = {199}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {171-186}, keywords = {Satellite-based models, Global horizontal irradiance, CM SAF, Solar radiation data, Pyranometer}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0034-4257}, DOI = {10.1016/j.rse.2017.07.013}, stag_bib_extends_levelofaccess = {NA}, author = {Antonanzas-Torres, F. and Gottschalg, R. and Palmer, D. and Lindfors, A. and Riihel{\"a}, A. and Trentmann, J. and Huld, T. and Koubli, E. and Gracia-Amillo, A.M. and Urraca, R.} } @Article { MullejansWPKG2017, title = {Traceable spectral irradiance measurements in photovoltaics: Results of the PTB and JRC spectroradiometer comparison using different light sources}, journal = {Measurement}, year = {2017}, month = {9}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, keywords = {Spectroradiometer, Spectral irradiance, Intercomparison, Calibration traceability, Solar simulator, Spectral responsivity}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2017.09.007}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}llejans, H. and Winter, S. and Plag, F. and Kr{\"o}ger, I. and Galleano, R.} } @Proceedings { KirkhamLMDRM2017, subid = {859}, title = {The Case for Redefinition of Frequency and ROCOF to Account for AC Power System Phase Steps}, journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2017}, month = {9}, number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids}, keywords = {Phasor measurement units, frequency control, circuit faults, relays, time-frequency analysis, time measurement}, web_url = {https://strathprints.strath.ac.uk/61522/}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Liverpool, United Kingdom}, event_name = {Applied Measurements for Power Systems}, event_date = {20-09-2017 to 22-09-2017}, language = {30}, ISBN = {978-1-5386-0343-7}, ISSN = {2475-2304}, DOI = {10.1109/AMPS.2017.8078330}, stag_bib_extends_levelofaccess = {NA}, author = {Roscoe, A.J. and Dysko, A. and Marshall, B. and Lee, M. and Kirkham, H. and Rietveld, G.} } @Proceedings { SauerwaldPKGS2017, title = {Performance Evaluation of Low-Cost BTEX Sensors and Devices within the EURAMET Key-VOCs Project}, journal = {Proceedings}, year = {2017}, month = {8}, day = {29}, volume = {1}, number = {4}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {425}, keywords = {PID based sensors, semiconductor and amperometric sensor, mini GC, portable on-line measuring devices, benzene, volatile organic compounds}, web_url = {http://www.mdpi.com/2504-3900/1/4/425}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {MDPI AG}, event_place = {Paris}, event_name = {Eurosensors2017}, event_date = {03-09-2017 to 06-09-2017}, language = {30}, ISSN = {2504-3900}, DOI = {10.3390/proceedings1040425}, stag_bib_extends_levelofaccess = {NA}, author = {Sauerwald, T. and Persijn, S. and Kok, G. and Gerboles, M. and Spinelle, L.} } @Proceedings { HilbertSKMP2017, subid = {464}, title = {PTB’s new standard impulse voltage divider for traceable calibrations up to 1 MV}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {reference measuring system, lightning impulse,}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_415-ptbs-new-standard-impulse-voltage-divider-for-traceable-calibrations-up-to-1-mv}, author = {Hilbert, M. and Schierding, C. and Kurrat, M. and Meisner, J. and Passon, S.} } @Proceedings { ZhouLLHBEK2017, subid = {463}, title = {Measurement of the Internal Inductance of Impulse Voltage Generators and the Limits of LI Front Times.}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {lightning impulse, time parameters, front time, impulse generator}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International conference on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_569-measurement-of-the-internal-inductance-of-impulse-voltage-generators-and-the-limits-of-li-front-times}, author = {Zhou, L. and Li, Y. and Larzelere, W. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Elg, A.P. and Kl{\"u}ss, J.} } @Proceedings { HallstromHPK2017, subid = {459}, title = {Design and performance of a fast divider for puncture testing}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Puncture testing, very fast transient}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_470-design-and-performance-of-a-fast-divider-for-puncture-testing}, author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Pyk{\"a}l{\"a}, M.L. and Kazmi, S.} } @Article { GrigoryevaGUTTKHAWKS2017, subid = {1175}, title = {Thermodynamic Temperature of High-Temperature Fixed Points Traceable to Blackbody Radiation and Synchrotron Radiation}, journal = {International Journal of Thermophysics}, year = {2017}, month = {8}, day = {16}, volume = {38}, number = {10}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, keywords = {Absolute radiometry, Blackbody radiation, Cryogenic substitution radiometer, Filter radiometer, High-temperature fixed points, Irradiance mode, Primary radiation standards, Ratio radiometry, Synchrotron radiation, Thermodynamic temperature}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2273-z}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}hmer, M. and Anhalt, K. and Hollandt, J. and Klein, R. and Taubert, R. D. and Thornagel, R. and Ulm, G. and Gavrilov, V. and Grigoryeva, I. and Khlevnoy, B. and Sapritsky, V.} } @Article { SuterSSPOMKHGFBAKLWS2017, title = {The CLARA/NORSAT-1 solar absolute radiometer: instrument design, characterization and calibration}, journal = {Metrologia}, year = {2017}, month = {8}, day = {10}, volume = {54}, number = {5}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {674-682}, keywords = {solar irradiance, satellite measurements, electrical substitution radiometer, cavity detector, sun}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa7a63}, stag_bib_extends_levelofaccess = {NA}, author = {Suter, M. and Spescha, M. and Soder, R. and Pfiffner, D, and Oliva, A.R. and Mingard, N. and Koller, S. and Heuerman, K. and Gyo, M. and Finsterle, W. and Beck, I. and Andersen, B. and Kopp, G. and Levesque, P.L. and Walter, B. and Schmutz, W.} } @Article { KiriakopoulosLCMXGP2017, title = {Response Of The Greek Early Warning System Reuter-Stokes Ionization Chambers To Terrestrial And Cosmic Radiation Evaluated In Comparison With Spectroscopic Data And Time Series Analysis}, journal = {Radiation Protection Dosimetry}, year = {2017}, month = {8}, day = {10}, volume = {178}, number = {3}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {276-287}, keywords = {detector response, cosmic radiation, spectroscopy, time series}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncx107}, stag_bib_extends_levelofaccess = {NA}, author = {Kiriakopoulos, E and LEONTARIS, F and CLOUVAS, A and Maltezos, A and XANTHOS, S and Guilhot, J and Potiriadis, C} } @Article { KazakovaVGPW2017, subid = {253}, title = {Switchable bi-stable multilayer magnetic probes for imaging of soft magnetic structures}, journal = {Ultramicroscopy}, year = {2017}, month = {8}, volume = {179}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {41-46}, keywords = {MFM, Scanning probe microscopy, Magnetic probes}, web_url = {https://pure.royalholloway.ac.uk/portal/files/28310834/For_ResearchGate_Switchable_bi_stable_ML_probes.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2017.03.032}, stag_bib_extends_levelofaccess = {NA}, author = {Wren, T. and Puttock, R. and Gribkov, B. and Vdovichev, S. and Kazakova, O.} } @Article { NeuVSMSRGCPK2017, subid = {581}, title = {Calibration of multi-layered probes with low/high magnetic moments}, journal = {Scientific Reports}, year = {2017}, month = {8}, volume = {7}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {7224}, keywords = {Magnetic straz field, Magnetic force microscopy, multi-layered probe, Hall sensor.}, web_url = {https://www.nature.com/articles/s41598-017-07327-0}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-07327-0}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, V. and Corte-Le{\'o}n, H. and Gribkov, B. and Rodriguez, L.A. and Snoeck, E. and Manzin, A. and Simonetto, E. and Vock, S. and Neu, V. and Kazakova, O.} } @Article { GrisaSKS2017, title = {Monte Carlo optimization of shielding for novel industrial free release measurement facility}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, volume = {126}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {73-75}, keywords = {Decommissioning, Free release measurement, Monte Carlo simulations, Low level activity measurement}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804316305322?via\%3Dihub}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.12.032}, stag_bib_extends_levelofaccess = {NA}, author = {Grisa, T. and Šur{\'a}ň, J. and Kov{\'a}ř, P. and Solc, J.} } @Article { GreilichKBKBSSP2017, subid = {601}, title = {Radiation dosimetry in magnetic fields with Farmer-type ionization chambers: determination of magnetic field correction factors for different magnetic field strengths and field orientations}, journal = {Physics in Medicine \& Biology}, year = {2017}, month = {8}, volume = {62}, number = {16}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {6708-6728}, keywords = {Dosimetry, MRgRT, Radiotherapy, Magnetic fields}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aa7ae4}, stag_bib_extends_levelofaccess = {NA}, author = {Spindeldreier, C K and Schrenk, O and Bakenecker, A and Kawrakow, I and Burigo, L and Karger, C P and Greilich, S and Pfaffenberger, A} } @Article { KeightleyBPVPBGW2017, title = {Compact radioactive aerosol monitoring device for early warning networks}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, volume = {126}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {219-224}, keywords = {Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.12.036}, stag_bib_extends_levelofaccess = {NA}, author = {Keightley, L. and Bell, S.J. and Ponikvar, D. and Vencelj, M. and Petrovič, T. and Brodnik, D. and Glavič-Cindro, D. and Woods, S.} } @Article { VandervorstMAFDKBV2017, subid = {565}, title = {Atom probe tomography analysis of SiGe fins embedded in SiO 2 : Facts and artefacts}, journal = {Ultramicroscopy}, year = {2017}, month = {8}, volume = {179}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {100-107}, keywords = {Atom probe tomography, Tip shape, FinFET, Local magnification, Trajectory overlaps}, web_url = {https://lirias2repo.kuleuven.be/rest/bitstreams/515063/retrieve}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2017.04.006}, stag_bib_extends_levelofaccess = {NA}, author = {Melkonyan, D. and Fleischmann, C. and Arnoldi, L. and Demeulemeester, J. and Kumar, A. and Bogdanowicz, J. and Vurpillot, F. and Vandervorst, W.} } @Article { AntonovSMKCK2017, subid = {583}, title = {Hybrid normal metal/ferromagnetic nanojunctions for domain wall tracking}, journal = {Scientific Reports}, year = {2017}, month = {7}, day = {24}, volume = {7}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {6295}, keywords = {domain wall, magnetoresistance, permalloy}, web_url = {https://www.nature.com/articles/s41598-017-06292-y.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-06292-y}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Krzysteczko, P. and Manzin, A. and Schumacher, H.W. and Antonov, V. and Kazakova, O.} } @Article { IkonenAPPK2017, subid = {416}, title = {Fisheye camera method for spatial non-uniformity corrections in luminous flux measurements with integrating spheres}, journal = {Metrologia}, year = {2017}, month = {7}, day = {24}, volume = {54}, number = {4}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {577-583}, keywords = {fisheye camera, integrating sphere, luminous flux, spatial correction, angular intensity distribution, photometry, measurement uncertainty}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa7cb7}, stag_bib_extends_levelofaccess = {NA}, author = {Kokka, A. and Pulli, T. and Poikonen, T. and Askola, J. and Ikonen, E.} } @Article { MantynenVKMI2017, title = {Method for estimating effects of unknown correlations in spectral irradiance data on uncertainties of spectrally integrated colorimetric quantities}, journal = {Metrologia}, year = {2017}, month = {7}, day = {18}, volume = {54}, number = {4}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {524-534}, keywords = {uncertainty, color temperature, color coordinates, Monte Carlo, spectral irradiance}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa7b39/meta}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa7b39}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"a}ntynen, H. and Vaskuri, A and K{\"a}rh{\"a}, P. and Mikkonen, N. and Ikonen, E.} } @Article { RuhlBTRFUPKHKHU2017, subid = {848}, title = {Enhancing the sensitivity of nano-FTIR spectroscopy}, journal = {Optics Express}, year = {2017}, month = {7}, volume = {25}, number = {14}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {16574}, keywords = {Instrumentation, measurement, and metrology; Near-field microscopy}, web_url = {https://www.osapublishing.org/DirectPDFAccess/158D237A-A0E8-5960-84426107CE1CBCF4_369006/oe-25-14-16574.pdf?da=1\&id=369006\&seq=0\&mobile=no}, misc2 = {EMPIR 2015: Health}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.25.016574}, stag_bib_extends_levelofaccess = {NA}, author = {Hermann, P. and K{\"a}stner, B. and Hoehl, A. and Kashcheyevs, V. and Patoka, P. and Ulrich, G. and Feikes, J. and Ries, M. and Tydecks, T. and Beckhoff, B. and Ruhl, E. and Ulm, G.} } @Article { MasowskiLCCBAPMNNlLKBKMZCPBT2017, subid = {402}, title = {Fibre-optic delivery of time and frequency to VLBI station}, journal = {Astronomy \& Astrophysics}, year = {2017}, month = {7}, volume = {603}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {A48}, keywords = {high angular resolution instrumentation, interferometers}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {EDP Sciences}, language = {30}, ISSN = {0004-6361, 1432-0746}, DOI = {10.1051/0004-6361/201730615}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Buczek, L. and Kołodziej, J. and Lipiński, M. and Śliwczyński, Ł. and Nawrocki, J. and Nogaś, P. and Marecki, A. and Pazderski, E. and Ablewski, P. and Bober, M. and Ciuryło, R. and Cygan, A. and Lisak, D. and Masłowski, P. and Morzyński, P. and Zawada, M. and Campbell, R. M. and Pieczerak, J. and Binczewski, A. and Turza, K.} } @Proceedings { SliwczynskiKBBT2017, subid = {443}, title = {Time and frequency transfer in modern DWDM telecommunication networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/fcs.2017.8088894}, stag_bib_extends_levelofaccess = {NA}, author = {Turza, K. and Binczewski, A. and Bogacki, W. and Krehlik, P. and Śliwczyński, L.} } @Proceedings { SliwczynskiKKIPESB2017, subid = {444}, title = {Fiber optic time transfer between PTB and Deutsche Telekom using multi-link redundant topology}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/FCS.2017.8088999}, stag_bib_extends_levelofaccess = {NA}, author = {Śliwczyński, L. and Krehlik, P. and Kolodziej, J. and Imlau, H. and Ender, H. and Schnatz, H. and Piester, D. and Bauch, A.} } @Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017, subid = {477}, title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fibre, network, clock, time, dissemination, service}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/FCS.2017.8089004}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Dostal, J. and Radil, J. and Smotlacha, V. and Velc, R. and Vojtech, J. and Campanella, M. and Calonico, D. and Clivati, C. and Levi, F. and Č{\'i}p, O. and Rerucha, S. and Holzwarth, R. and Lessing, M. and Camargo, F. and Desruelle, B. and Lautier-Gaud, J. and English, E.L. and Kronj{\"a}ger, J. and Whibberley, P. and Pottie, P.E. and Tavares, R. and Tuckey, P. and John, F. and Snajder, M. and Stefl, J. and Nogaś, P. and Urbaniak, R. and Binczewski, A. and Bogacki, W. and Turza, K. and Grosche, G. and Schnatz, H. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.} } @Article { UnterumsbergerPLKHHWB2017, title = {Determination of SiO2 and C layers on a monocrystalline silicon sphere by reference-free x-ray fluorescence analysis}, journal = {Metrologia}, year = {2017}, month = {6}, day = {28}, volume = {54}, number = {4}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {481-486}, keywords = {Avogadro project, X-ray fluorescence, quantification}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa765f}, stag_bib_extends_levelofaccess = {NA}, author = {Unterumsberger, R. and Pollakowski-Herrmann, B. and Lubeck, J. and Kolbe, M. and Holfelder, I. and H{\"o}nicke, P and Weser, J. and Beckhoff, B.} } @Article { PersijnKGSS2017, title = {Review of Portable and Low-Cost Sensors for the Ambient Air Monitoring of Benzene and Other Volatile Organic Compounds}, journal = {Sensors}, year = {2017}, month = {6}, day = {28}, volume = {17}, number = {7}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {1520}, keywords = {PID based sensors; semiconductor and amperometric sensor; mini GC; portable on-line measuring devices; benzene; volatile organic compounds}, web_url = {http://www.mdpi.com/1424-8220/17/7/1520}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s17071520}, stag_bib_extends_levelofaccess = {NA}, author = {Persijn, S. and Kok, G. and Gerboles, M. and Spinelle, L. and Sauerwald, T.} } @Article { HughesCLLK2017_2, title = {Development of a high-accuracy multi-sensor, multi-target coordinate metrology system using frequency scanning interferometry and multilateration}, journal = {Proc. SPIE}, year = {2017}, month = {6}, day = {26}, volume = {10332}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {1033202}, keywords = {Interferometry, large volume metrology, sensors, distance measurement, calibration, traceability}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, language = {30}, DOI = {10.1117/12.2273644}, stag_bib_extends_levelofaccess = {NA}, author = {Hughes, B. and Campbell, M. A. and Lewis, A. J. and Lazzarini, G. M. and Kay, N.} } @Article { KazakovaKCMMI2017, subid = {899}, title = {Angular Magnetoresistance of Nanowires with Alternating Cobalt and Nickel Segments}, journal = {IEEE Transactions on Magnetics}, year = {2017}, month = {6}, day = {22}, volume = {53}, number = {11}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {1-5}, keywords = {Angular magnetoresistance (MR), cylindrical nanowires, domain-wall (DW) pinning, magnetic force microscopy (MFM)}, web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/angular-magnetoresistance-of-nanowires-with-alternating-cobalt-and-nickel-segments(95f3afd6-6bb1-4548-843d-66a03bd12b0d).html}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9464, 1941-0069}, DOI = {10.1109/TMAG.2017.2718623}, stag_bib_extends_levelofaccess = {NA}, author = {Mohammed, H. and Corte-Le{\'o}n, H. and Ivanov, Y. P. and Moreno, J. A. and Kazakova, O. and Kosel, J.} } @Proceedings { KummeFSW2017, subid = {246}, title = {D6.2 - Characterisation of a 5 MN·m Torque Transducer by Combining Traditional Calibration and Finite Element Method Simulations}, journal = {Proceedings Sensor 2017}, year = {2017}, month = {6}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, pages = {516 - 521}, keywords = {torque calibration in the MN·m range, torque transfer standard, strain gauge simulation,torque range extension}, misc2 = {EMPIR 2014: Industry}, publisher = {AMA Service GmbH}, event_place = {N{\"u}rnberg, Germany}, event_name = {AMA Conferences 2017}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, ISBN = {978-3-9816876-4-4}, DOI = {10.5162/sensor2017/D6.2}, stag_bib_extends_levelofaccess = {NA}, author = {Weidinger, P. and Foyer, G. and Schlegel, C. and Kumme, R.} } @Article { MougeotMKN2017, subid = {413}, title = {Activity determination of 60 Co and the importance of its beta spectrum}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {6}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, keywords = {60Co, activity standardization, coincidence counting, TDCR, CIEMAT/NIST efficiency tracing, beta spectrum}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.06.015}, stag_bib_extends_levelofaccess = {NA}, author = {Kossert, K. and Marganiec-Gałązka, J. and Mougeot, X. and N{\"a}hle, O.J.} } @Article { HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017, subid = {141}, title = {Test of Special Relativity Using a Fiber Network of Optical Clocks}, journal = {Physical Review Letters}, year = {2017}, month = {6}, volume = {118}, number = {22}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, web_url = {https://arxiv.org/abs/1703.04426}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.118.221102}, stag_bib_extends_levelofaccess = {NA}, author = {Delva, P. and Lodewyck, J. and Bilicki, S. and Bookjans, E. and Vallet, G. and Le Targat, R. and Pottie, P.-E. and Guerlin, C. and Meynadier, F. and Le Poncin-Lafitte, C. and Lopez, O. and Amy-Klein, A. and Lee, W.-K. and Quintin, N. and Lisdat, C. and Al-Masoudi, A. and D{\"o}rscher, S. and Grebing, C. and Grosche, G. and Kuhl, A. and Raupach, S. and Sterr, U. and Hill, I. R. and Hobson, R. and Bowden, W. and Kronj{\"a}ger, J. and Marra, G. and Rolland, A. and Baynes, F. N. and Margolis, H. S. and Gill, P.} } @Article { HoutzagerBKv2017, title = {AC–DC Calibrations With a Pulse-Driven AC Josephson Voltage Standard Operated in a Small Cryostat}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {6}, volume = {66}, number = {6}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1391-1396}, keywords = {AC–DC difference, Josephson voltage standard, measurement standards, measurement techniques, voltagemeasurement.}, web_url = {http://ieeexplore.ieee.org/document/7898429/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2662381}, stag_bib_extends_levelofaccess = {NA}, author = {Houtzager, E. and Bauer, S. and Kieler, O.F.O. and van den Brom, H.E.} } @Article { MonteALBGRRKMAG2017, title = {Defect characterisation of tensile loaded CFRP and GFRP laminates used in energy applications by means of infrared thermography}, journal = {Quantitative InfraRed Thermography Journal}, year = {2017}, month = {6}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-20}, keywords = {Defect characterisation CFRP and GFRP laminates energy applications infrared thermography}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1768-6733, 2116-7176}, DOI = {10.1080/17686733.2017.1334312}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Aktas, A. and Lodeiro, M. and Baker, G. and Gower, M. and Rehmer, B. and R{\"o}llig, M. and Krankenhagen, R. and Maierhofer, C. and Adibekyan, A. and Gutschwager, B.} } @Article { HerkommerRHSKTRGSTSFGR2017, subid = {412}, title = {Single Quantum Dot with Microlens and 3D-Printed Micro-objective as Integrated Bright Single-Photon Source}, journal = {ACS Photonics}, year = {2017}, month = {6}, volume = {4}, number = {6}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1327-1332}, keywords = {3D direct laser writing; 3D lithography; micro-objective; semiconductor quantum dot; single-photon source}, web_url = {http://pubs.acs.org/doi/ipdf/10.1021/acsphotonics.7b00253}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.7b00253}, stag_bib_extends_levelofaccess = {NA}, author = {Fischbach, S. and Schlehahn, A. and Thoma, A. and Srocka, N. and Gissibl, T. and Ristok, S. and Thiele, S. and Kaganskiy, A. and Strittmatter, A. and Heindel, T. and Rodt, S. and Herkommer, A. and Giessen, H. and Reitzenstein, S.} } @Proceedings { SchutzeKSGRSBL2017, title = {Highly sensitive benzene detection with MOS gas sensors}, journal = {Proceedings Sensor 2017}, year = {2017}, month = {6}, volume = {A4 - Gas S}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {92-97}, keywords = {metal oxide semiconductor, MOS, temperature-cycled operation, TCO, benzene}, web_url = {https://www.ama-science.org/proceedings/details/2498}, misc2 = {EMRP A169: Call 2013 Environment II}, event_place = {Nurember}, event_name = {AMA Conferences 2017 – SENSOR 2017}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, ISBN = {978-3-9816876-4-4}, DOI = {10.5162/sensor2017/A4.3}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}tze, Andreas and Kok, Gertjan and Spinelle, Laurent and Gerboles, Michel and Reimringer, Wolfhard and Sauerwald, Tilman and Baur, Tobias and Leidinger, Martin} } @Article { SchraderKSH2017, title = {Characterization of a 300-GHz Transmission System for Digital Communications}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2017}, month = {5}, day = {17}, volume = {38}, number = {8}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {1004-1018}, keywords = {Error vector magnitude, Waveform metrology, THz communication}, web_url = {https://link.springer.com/article/10.1007/s10762-017-0395-9}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {1866-6892, 1866-6906}, DOI = {10.1007/s10762-017-0395-9}, stag_bib_extends_levelofaccess = {NA}, author = {Schrader, T. and Kleine-Ostmann, T. and Salhi, M. and Hudlicka, M.} } @Article { CowburnMCSFWK2017, subid = {251}, title = {Detection of individual iron-oxide nanoparticles with vertical and lateral sensitivity using domain wall nucleation in CoFeB/Pt nanodevices}, journal = {AIP Advances}, year = {2017}, month = {5}, volume = {7}, number = {5}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {056715}, keywords = {We present new studies of the characteristics and detection ability of nanoscale sensors based on domain wall nucleation within perpendicularly magnetised ultrathin CoFeB/Pt films. A combination of MFM imaging and anomalous Hall effect transport measurements were used to verify and characterise the behaviour of fabricated devices. After initial characterisation, the influence of magnetic nanoparticles on device behaviour was studied using individual iron oxide (FeOx) particles mounted on modified atomic force microscopy probes. We demonstrate the successful detection of particles ranging in diameter between 2.8 \(\mu\)m and 100 nm. In the case of the 2.8 \(\mu\)m particle, we have mapped the signal amplitude produced at a variety of distances from the sensor. We find that the particle’s influence may be detected at separations up to 700 nm. Furthermore, we demonstrate a method for resolving the location of a particle with respect to the centre of the device, providing a lateral sensing ability.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/1.4975357}, stag_bib_extends_levelofaccess = {NA}, author = {Wells, J. and Fern{\'a}ndez Scarioni, A. and Schumacher, H.W. and Cox, D. and Mansell, R. and Cowburn, R. and Kazakova, O.} } @Article { SantarelliLLCCMWKKCSNRQDLBRGGAWGALLPG2017, subid = {138}, title = {First international comparison of fountain primary frequency standards via a long distance optical fiber link}, journal = {Metrologia}, year = {2017}, month = {5}, volume = {54}, number = {3}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {348-354}, keywords = {optical fiber frequency transfer, atomic fountain clocks, international fountain, clock comparison}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa65fe}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa65fe}, stag_bib_extends_levelofaccess = {NA}, author = {Guena, J and Weyers, S and Abgrall, M and Grebing, C and Gerginov, V and Rosenbusch, P and Bize, S and Lipphardt, B and Denker, H and Quintin, N and Raupach, S M F and Nicolodi, D and Stefani, F and Chiodo, N and Koke, S and Kuhl, A and Wiotte, F and Meynadier, F and Camisard, E and Chardonnet, C and Le Coq, Y and Lours, M and Santarelli, G and Amy-Klein, A and Le Targat, R and Lopez, O and Pottie, P E and Grosche, G} } @Article { SchmittWJRLSMK2017, subid = {604}, title = {Validation of 4D dose calculation using an independent motion monitoring by the calypso tracking system and 3D polymer gel dosimetry}, journal = {Journal of Physics: Conference Series}, year = {2017}, month = {5}, volume = {847}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {012040}, keywords = {3D dosimetry, gel dosimeter, radiotherapy, MRgRT}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/847/1/012040}, stag_bib_extends_levelofaccess = {NA}, author = {Mann, P and Saito, N and Lang, C and Runz, A and Johnen, W and Witte, M and Schmitt, D and Karger, C P} } @Article { SchlegelFWK2017, subid = {241}, title = {Extending the Torque Calibration Range – Necessity and Outline of a Mathematical Approach}, journal = {Ukrainian Metrological Journal}, year = {2017}, month = {4}, day = {20}, number = {1A}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, pages = {57-60}, keywords = {Calibration; Measurement; Mathematical methods}, misc2 = {EMPIR 2014: Industry}, publisher = {National Scientific Centre Institute of Metrology}, language = {30}, ISSN = {2306-7039}, DOI = {10.24027/2306-7039.1A.2017.99993}, stag_bib_extends_levelofaccess = {NA}, author = {Weidinger, P. and Foyer, G. and Schlegel, C. and Kumme, R.} } @Article { KochGIIGHKBWK2017, subid = {174}, title = {Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI}, journal = {PLOS ONE}, year = {2017}, month = {4}, day = {12}, volume = {12}, number = {4}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {1-19}, keywords = {Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI}, misc2 = {EMPIR 2015: Health}, address = {San Francisco, California, and Cambridge, United Kingdom.}, language = {30}, DOI = {10.1371/journal.pone.0174420}, stag_bib_extends_levelofaccess = {NA}, author = {Weichenberger, Markus and Bauer, Martin and K{\"u}hler, Robert and Hensel, Johannes and Forlim, C. G. and Ihlenfeld, Albrecht and Ittermann, Bernd and Gallinat, J{\"u}rgen and Koch, Christian and K{\"u}hn, Simone} } @Article { Ken2017, subid = {63}, title = {Robust and precise algorithm for aspheric surfaces characterization by the conic section}, journal = {Journal of the European Optical Society-Rapid Publications}, year = {2017}, month = {4}, day = {11}, volume = {13}, number = {11}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {1-7}, keywords = {aspheric lens, robust algorithm, least squares fitting, metrology, ISO 10110}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {233 Spring St, New York NY 10013, USA}, language = {30}, ISSN = {1990-2573}, DOI = {10.1186/s41476-017-0040-1}, stag_bib_extends_levelofaccess = {NA}, author = {Křen, Petr} } @Article { JehlBKCVSHLBKC2017, subid = {369}, title = {Design and Operation of CMOS-Compatible Electron Pumps Fabricated With Optical Lithography}, journal = {IEEE Electron Device Letters}, year = {2017}, month = {4}, volume = {38}, number = {4}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {414-417}, keywords = {Quantum dots, Quantum effect semiconductor devices, Quantization, Current control}, web_url = {https://arxiv.org/abs/1612.09547}, web_url2 = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0741-3106, 1558-0563}, DOI = {10.1109/LED.2017.2670680}, stag_bib_extends_levelofaccess = {NA}, author = {Clapera, P. and Klochan, J. and Lavieville, R. and Barraud, S. and Hutin, L. and Sanquer, M. and Vinet, M. and Cinins, A. and Barinovs, G. and Kashcheyevs, V. and Jehl, X.} } @Article { SchmidtSPKHSL2017, subid = {389}, title = {On-line estimation of local oscillator noise and optimisation of servo parameters in atomic clocks}, journal = {Metrologia}, year = {2017}, month = {4}, volume = {54}, number = {3}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {307-321}, keywords = {quantum projection noise, atomic frequency standards, local oscillator noise, servo optimisation}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa66e9}, stag_bib_extends_levelofaccess = {NA}, author = {Leroux, I.D. and Scharnhorst, N. and Hannig, S. and Kramer, J. and Pelzer, L. and Stepanova, M. and Schmidt, P.O.} } @Article { HemmingWLEKJHL2017, title = {Application of Monte Carlo simulation for estimation of uncertainty of four-point roundness measurements of rolls}, journal = {Precision Engineering}, year = {2017}, month = {4}, volume = {48}, number2 = {IND62: TIM: Traceable in-process dimensional measuremen}, pages = {181-190}, keywords = {Application of Monte Carlo simulation for estimation of uncertainty of four-point roundness measurements of rolls}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, address = {360 Park Ave S, New York, NY 10010, USA}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2016.12.001}, stag_bib_extends_levelofaccess = {NA}, author = {Hemming, B. and Widmaier, T. and Lassila, A. and Esala, V.-P. and Kuosmanen, P. and Juhanko, J. and Haikio, J. and Laukkanen, P.} } @Article { CarmeleRBSSSGSSvTHKR2017, subid = {234}, title = {A bright triggered twin-photon source in the solid state}, journal = {Nature Communications}, year = {2017}, month = {4}, volume = {8}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {14870}, keywords = {Quantum dots, Quantum optics, Single photons and quantum effects .}, web_url = {https://www.nature.com/articles/ncomms14870}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms14870}, stag_bib_extends_levelofaccess = {NA}, author = {Heindel, T. and Thoma, A. and von Helversen, M. and Schmidt, M. and Schlehahn, A. and Gschrey, M. and Schnauber, P. and Schulze, J. -H. and Strittmatter, A. and Beyer, J. and Rodt, S. and Carmele, A. and Knorr, A. and Reitzenstein, S.} } @Article { KataokaAKBG2017, subid = {313}, title = {Robust operation of a GaAs tunable barrier electron pump}, journal = {Metrologia}, year = {2017}, month = {4}, volume = {54}, number = {3}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {299-306}, keywords = {single-electron pumps, primary electrical metrology, current standards}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/54/1/S1/meta;jsessionid=4918445C3978B8F392DE6A658FA21463.ip-10-40-1-105}, web_url2 = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa634c}, stag_bib_extends_levelofaccess = {NA}, author = {Giblin, S P and Bae, M-H and Kim, N and Ahn, Ye-Hwan and Kataoka, M} } @Article { GolubevLKMLM2017, title = {Characterizing superconducting filters using residual microwave background}, journal = {Superconductor Science and Technology}, year = {2017}, month = {3}, day = {27}, volume = {30}, number = {5}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {055006}, keywords = {superconductivity, microwave propagation, single-electron trap, microwave photon detection, on-chip filters, Josephson array}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, language = {30}, ISSN = {0953-2048, 1361-6668}, DOI = {10.1088/1361-6668/aa63bc}, stag_bib_extends_levelofaccess = {NA}, author = {Lehtinen, J S and Mykk{\"a}nen, E and Kemppinen, A and Lotkhov, S V and Golubev, D and Manninen, A J} } @Article { HusainLTYBSSTKFH2017, subid = {30}, title = {Single Carrier Trapping and De-trapping in Scaled Silicon Complementary Metal-Oxide-Semiconductor Field-Effect Transistors at Low Temperatures}, journal = {Semiconductor Science and Technology}, year = {2017}, month = {3}, day = {24}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Coulomb blockade, MOSFETs, Carrier Trapping and De-trapping, quantum dots}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0268-1242, 1361-6641}, DOI = {10.1088/1361-6641/aa6910}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Zuo and Husain, Muhammad and Yoshimoto, Hiroyuki and Tani, Kazuki and Sasago, Yoshitaka and Hisamoto, Digh and Fletcher, Jonathan and Kataoka, Masaya and Tsuchiya, Yoshishige and Saito, Shinichi} } @Article { FujiwaraKKGY2017, subid = {407}, title = {High-accuracy current generation in the nanoampere regime from a silicon single-trap electron pump}, journal = {Scientific Reports}, year = {2017}, month = {3}, day = {21}, volume = {7}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {45137}, keywords = {Single-electron pump, silicon, trap level, current standard}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep45137}, stag_bib_extends_levelofaccess = {NA}, author = {Yamahata, G. and Giblin, S.P. and Kataoka, M. and Karasawa, T. and Fujiwara, A.} } @Article { SchumacherACMMCKMSCK2017, subid = {252}, title = {Magnetic scanning gate microscopy of CoFeB lateral spin valve}, journal = {AIP Advances}, year = {2017}, month = {3}, volume = {7}, number = {5}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {056808}, keywords = {AbstractDevices comprised of CoFeB nanostructures with perpendicular magnetic anisotropy and non-magnetic Ta channel were operated in thermal lateral spin valve (LSV) mode and studied by magnetotransport measurements and magnetic scanning gate microscopy (SGM). Due to the short spin diffusion length of Ta, the spin diffusion signal was suppressed, allowing the study of the contribution from the anomalous Nernst (ANE) and anomalous Hall effects (AHE). The magnetotransport measurements identified the switching fields of the CoFeB nanostructures and demonstrated a combination of AHE and ANE when the devices were operated in thermally-driven spin-injection mode. Modified scanning probe microscopy probes were fabricated by placing a NdFeB magnetic bead (MB) on the apex of a commercial Si probe. The dipole magnetic field distribution around the MB was characterized by using differential phase contrast technique and direct measurement of the switching field induced by the bead in the CoFeB nanodevices. Using SGM we demonstrate the influence of localized magnetic field on the CoFeB nanostructures near the non-magnetic channel. This approach provides a promising route towards the study of thermal and spin diffusion effects using local magnetic fields.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/1.4977891}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Scarioni, A.F. and Mansell, R. and Krzysteczko, P. and Cox, D. and McGrouther, D. and McVitie, S. and Cowburn, R. and Schumacher, H.W. and Antonov, V. and Kazakova, O.} } @Article { MartinezVerduLAKOGKJFSPSC2017, title = {Multilateral spectral radiance factor scale comparison}, journal = {Applied Optics}, year = {2017}, month = {3}, volume = {56}, number = {7}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1996}, keywords = {BSDF, BRDF, BTDF, Densitometers, reflectometers, Reflection.}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States}, language = {30}, ISSN = {0003-6935, 1539-4522}, DOI = {10.1364/AO.56.001996}, stag_bib_extends_levelofaccess = {NA}, author = {Mart{\'i}nez-Verd{\'u}, F. M. and Leloup, F. B. and Audenaert, J. and K{\"a}llberg, S. and Obein, G. and Ged, G. and Koo, A. and Jaanson, P. and Ferrero, A. and Strothk{\"a}mper, C. and Perales, E. and Schirmacher, A. and Campos, J.} } @Article { ZoladekLemanczykBNKCS2017, title = {Fabrication of air-stable, large-area, PCDTBT:PC70BM polymer solar cell modules using a custom built slot-die coater}, journal = {Solar Energy Materials and Solar Cells}, year = {2017}, month = {3}, volume = {161}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {388-396}, keywords = {Slot-die coating; Polymer Solar Cells (PSC); Large-area; Ambient stability; PCDTBT:PC70BM; Light beam induced current (LBIC); Photoluminescence (PL)}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York, United States}, language = {30}, ISSN = {0927-0248}, DOI = {10.1016/j.solmat.2016.12.019}, stag_bib_extends_levelofaccess = {NA}, author = {Zoladek-Lemanczyk, Alina and Bausi, Francesco and New, Edward and Kutsarov, Dimitar I. and Castro, Fernando A. and Silva, S. Ravi P.} } @Article { SewellSFZK2017, title = {A new profile roughness measurement approach for involute helical gears}, journal = {Measurement Science and Technology}, year = {2017}, month = {3}, volume = {28}, number = {5}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {055004}, keywords = {involute gear, roughness}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa5d96}, stag_bib_extends_levelofaccess = {NA}, author = {Sewell, I and Shaw, B A and Frazer, R C and Zhang, J and Koulin, G} } @Article { BettsBHCKG2017, title = {Compressed Sensing Current Mapping Spatial Characterization of Photovoltaic Devices}, journal = {IEEE Journal of Photovoltaics}, year = {2017}, month = {3}, volume = {7}, number = {2}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {486-492}, keywords = {Compressed sensing (CS), light beam induced current (LBIC)measurements, solar cells, spatial characterization}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {Piscataway, New Jersey}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2646900}, stag_bib_extends_levelofaccess = {NA}, author = {Betts, TR and Bliss, M and Hall, SRG and Cashmore, M and Koutsourakis, G and Gottschalg, R} } @Article { MottonenVPTGKL2017, title = {Microwave Admittance of Gold-Palladium Nanowires with Proximity-Induced Superconductivity}, journal = {Advanced Electronic Materials}, year = {2017}, month = {3}, volume = {3}, number = {6}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {1600227}, keywords = {proximity Josephson junction, microwave admittance}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/aelm.201600227/abstract}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {2199-160X}, DOI = {10.1002/aelm.201600227}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"o}tt{\"o}nen, M. and Virtanen, P. and Partanen, M. and Tan, K.Y. and Govenius, J. and Kokkoniemi, R. and Lake, R.E.} } @Article { SchaepmanSKDH2017, title = {Field and Airborne Spectroscopy Cross Validation—Some Considerations}, journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing}, year = {2017}, month = {3}, volume = {10}, number = {3}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {1117-1135}, keywords = {Spectroscopy, Atmospheric measurements, Uncertainty, Surface treatment, Vegetation mapping, Measurement uncertainty, Instruments}, web_url = {https://ieeexplore.ieee.org/document/7582439/keywords}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1939-1404, 2151-1535}, DOI = {10.1109/JSTARS.2016.2593984}, stag_bib_extends_levelofaccess = {NA}, author = {Schaepman, M.E. and Schlapfer, D. and Kneubuehler, M. and Damm, A. and Hueni, A.} } @Proceedings { LiSLHZYTSHTFKS2017, subid = {1123}, title = {Random-telegraph-noise by resonant tunnelling at low temperatures}, journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, year = {2017}, month = {2}, day = {28}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Random-telegraph-noise, charge trap, low temperatures}, web_url = {https://eprints.soton.ac.uk/418401/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Toyama}, event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, event_date = {28-02-2017 to 02-03-2017}, language = {30}, DOI = {10.1109/EDTM.2017.7947569}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Zeimpekis, I. and Yoshimoto, H. and Tani, K. and Sasago, Y. and Hisamoto, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.} } @Proceedings { LiSBFKHTLS2017, subid = {1124}, title = {Transport properties in silicon nanowire transistors with atomically flat interfaces}, journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, year = {2017}, month = {2}, day = {28}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {narrow channel effect, silicon nanowire, SOI, TMAH, self-limiting oxidation}, web_url = {https://eprints.soton.ac.uk/402316/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Toyama}, event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, event_date = {28-02-2017 to 02-03-2017}, language = {30}, DOI = {10.1109/EDTM.2017.7947561}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, F. and Husain, M.K. and Li, Z. and Sotto, M.S.H. and Burt, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.} } @Proceedings { GrobnerVKEI2017, title = {Monte Carlo analysis of uncertainty of total atmospheric ozone derived from measured spectra}, journal = {AIP Conference Proceedings}, year = {2017}, month = {2}, day = {22}, volume = {1810}, number = {1}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {110005}, keywords = {Monte Carlo, TOC, Ozone, Uncertainty, Spectral irradiance}, web_url = {http://aip.scitation.org/toc/apc/1810/1?size=all\&expanded=1810}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {American Institute of Physics}, event_place = {The University of Auckland}, event_name = {International Radiation Symposium}, event_date = {16-04-2016 to 22-04-2016}, language = {30}, ISBN = {978-0-7354-1478-5}, ISSN = {1551-7616}, DOI = {10.1063/1.4975567}, stag_bib_extends_levelofaccess = {NA}, author = {Gr{\"o}bner, J. and Vaskuri, A. and K{\"a}rh{\"a}, P. and Egli, L. and Ikonen, E.} } @Article { DrungSK2017, subid = {12}, title = {Measurement of sub-picoampere direct currents with uncertainties below ten attoamperes}, journal = {Review of Scientific Instruments}, year = {2017}, month = {2}, volume = {88}, number = {2}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {024711}, keywords = {ULCA, ultrastable low-noise current amplifier, single-electron transport pumps, measurement uncertainty}, web_url = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4975826}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Krause, C. and Drung, D. and Scherer, H.} } @Article { PavsiDBFVJSeHRKMAAM2017, subid = {2144}, title = {Inter-laboratory assessment of different digital PCR platforms for quantification of human cytomegalovirus DNA}, journal = {Analytical and Bioanalytical Chemistry}, year = {2017}, month = {1}, day = {26}, volume = {409}, number = {10}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {2601-2614}, keywords = {Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-017-0206-0}, stag_bib_extends_levelofaccess = {NA}, author = {Pavšič, J. and Devonshire, A. and Blejec, A. and Foy, C.A. and Van Heuverswyn, F. and Jones, G.M. and Schimmel, H. and Zel, J. and Huggett, J.F. and Redshaw, N. and Karczmarczyk, M. and Mozioglu, E. and Aky{\"u}rek, S. and Akg{\"o}z, M. and Milavec, M.} } @Article { JelinekKC2017, title = {Study of uncertainties of height measurements of monoatomic steps on Si 5 \(\times\) 5 using DFT}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {24}, volume = {28}, number = {3}, number2 = {SIB61: CRYSTAL: Crysalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {034005}, keywords = {density functional theory, atomic force microscopy, uncertainty}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa5075}, stag_bib_extends_levelofaccess = {NA}, author = {Jel{\'i}nek, Pavel and Klapetek, Petr and Campbell, Anna Charv{\'a}tov{\'a}} } @Article { KorpelainenLKLS2017, title = {DNA origami structures as calibration standards for nanometrology}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {23}, volume = {28}, number = {3}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {034001}, keywords = {atomic force microscopy, DNA nanotechnology, DNA origami, self-assembly}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/28/3/034001}, stag_bib_extends_levelofaccess = {NA}, author = {Korpelainen, Virpi and Lassila, Antti and Kostiainen, Mauri A and Linko, Veikko and Sepp{\"a}, Jeremias} } @Article { , title = {Atomic force microscope adhesion measurements and atomistic molecular dynamics simulations at different humidities}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {23}, volume = {28}, number = {3}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {034004 (10pp)}, keywords = {Atomic force microscopy, metrology, adhesion, capillary effects, humidity, force measurement}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034004/meta;jsessionid=1CDCAA65608F84971489636A33CB4FD2.c3.iopscience.cld.iop.org}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/1361-6501/28/3/034004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-1-23}, author = {Sepp{\"a}, J and Reischl, B and Sairanen, H and Korpelainen, V and Husu, H and Heinonen, M and Raiteri, P and Rohl, A and Nordlund, K and Lassila, A} } @Article { PfaffenbergerNJK2017, subid = {600}, title = {Generation of synthetic CT data using patient specific daily MR image data and image registration}, journal = {Physics in Medicine and Biology}, year = {2017}, month = {1}, day = {23}, volume = {62}, number = {4}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {1358-1377}, keywords = {MRgRT, synthetic CT data, MRI, CT, Radiotherapy}, web_url = {https://doi.org/10.1088/1361-6560/aa5200}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/aa5200}, stag_bib_extends_levelofaccess = {NA}, author = {Kraus, K.M. and J{\"a}kel, O. and Niebuhr, N.I. and Pfaffenberger, A.} } @Article { NovikovaKGBWLRBMNL2017, title = {CASTOR, a new instrument for combined XRR-GIXRF analysis at SOLEIL}, journal = {X-Ray Spectrometry}, year = {2017}, month = {1}, day = {13}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, keywords = {x-ray}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Wiley-Blackwell}, address = {111 River Street Hoboken, NJ 07030, USA}, language = {30}, ISSN = {0049-8246}, DOI = {10.1002/xrs.2742}, stag_bib_extends_levelofaccess = {NA}, author = {Novikova, A. and Kanngie{\ss}er, B. and Gr{\"o}tzsch, D. and Beckhoff, B. and Weser, J. and Lubeck, J. and Rotella, H. and Boyer, B. and M{\'e}nesguen, Y. and Nolot, E. and L{\'e}py, M.-C.} } @Article { BecherLSGCSPHLRK2017_2, title = {Experimental realization of an absolute single-photon source based on a single nitrogen vacancy center in a nanodiamond}, journal = {Optica}, year = {2017}, month = {1}, volume = {4}, number = {1}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {71}, keywords = {Metrology, Radiometry, Sources, Photon statistics}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.4.000071}, stag_bib_extends_levelofaccess = {NA}, author = {Becher, C. and Lindner, S. and Sandoghdar, V. and G{\"o}tzinger, S. and Chu, X.L. and Smid, M. and Porrovecchio, G. and Hofer, H. and L{\'o}pez, M. and Rodiek, B. and K{\"u}ck, S.} } @Article { , title = {Novel high-temperature ferroelectric domain morphology in PbTiO3 ultrathin films}, journal = {Physical Chemistry Chemical Physics}, year = {2017}, month = {1}, volume = {Issue 6, 2017}, number = {Issue 6, 2017}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {Phys. Chem. Chem. Phys., 2017,19, 4243-4250}, keywords = {high-temperature ferroelectric domain morphology PbTiO3 ultrathin films}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2017/CP/C6CP08157F\#!divAbstract}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {RSC}, address = {London}, language = {30}, ISSN = {Issue 6, 2017}, DOI = {10.1039/C6CP08157F}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Duffy, Dorothy M. and Kimmel, Anna V. and Chapman,, Jacob B. J.} } @Article { MihailescuBKC2017, subid = {497}, title = {Key comparison BIPM.RI(I)-K1 of the air-kerma standards of the SCK·CEN, Belgium and the BIPM in 60Co gamma radiation}, journal = {Metrologia}, year = {2017}, month = {1}, volume = {54}, number = {1A}, number2 = {14RPT04: Absorb: Absorbed dose in water and air}, pages = {06004-06004}, keywords = {cavity chamber, air kerma reference, comparison}, misc2 = {EMPIR 2014: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/54/1a/06004}, stag_bib_extends_levelofaccess = {NA}, author = {Kessler, C and Burns, D and Mihailescu, L C and Chiriotti, S} } @Article { VavassoriAMCNCPK2017, subid = {255}, title = {V-shaped domain wall probes for calibrated magnetic force microscopy}, journal = {IEEE Transactions on Magnetics}, year = {2017}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {1-1}, keywords = {Probes, Magnetic domains, Magnetic resonance imaging, Magnetic field measurement, Perpendicular magnetic anisotropy, Saturation magnetization}, web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/vshaped-domain-wall-probes-for-calibrated-magnetic-force-microscopy(9c2d50b1-9b1a-4aae-9b39-ca8c1864daf3).html}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9464, 1941-0069}, DOI = {10.1109/TMAG.2017.2694324}, stag_bib_extends_levelofaccess = {NA}, author = {Puttock, R. and Corte-Le{\'o}n, H. and Neu, V. and Cox, D. and Manzin, A. and Antonov, V. and Vavassori, P. and Kazakova, O.} } @Proceedings { KummeWKS2017, subid = {876}, title = {New perspectives for MN·m torque measurement in PTB}, journal = {Conference Proceedings IMEKO 23rd TC3, 13th TC5 and 4 th TC22 International Conference}, year = {2017}, number = {2017}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {torque, calibration, transfer standard, wind energy, nacelle test bench}, misc2 = {EMPIR 2014: Industry}, event_place = {Helsinki Finland}, event_name = {IMEKO 23rd TC3, 13th TC5 and 4th TC22 International Conference}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-045.pdf}, author = {Kumme, R. and Weidinger, P. and Kahmann, H. and Schlegel, C.} } @Inbook { , title = {Total Ozone Data Retrieval from the Phaethon DOAS System}, year = {2017}, volume = {2}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {989-994/141}, keywords = {total ozone, DOAS, Phaethon, Langley}, web_url = {http://link.springer.com/chapter/10.1007\%2F978-3-319-35095-0_141}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer International Publishing}, address = {Switzerland}, booktitle = {Perspectives on Atmospheric Sciences}, language = {30}, ISBN = {978-3-319-35094-3}, DOI = {10.1007/978-3-319-35095-0_141}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-12-31}, author = {Gkertsi, F. and Bais, A.F. and Drosoglou, Th. and Fragkos, K. and Fountoulakis, I. and Kouremeti, N.} } @Proceedings { WeidingerBJK2017, subid = {243}, title = {Torque measurement uncertainty in multi-MW nacelle test benches = Messunsicherheit des Drehmomentes in multi-MW Windenergieanlagen Pr{\"u}fst{\"a}nden}, journal = {3rd Conference for Wind Power Drives}, year = {2017}, volume = {1}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, pages = {1-14}, keywords = {nacelle test bench, FEM simulation, measurement uncertainty}, misc2 = {EMPIR 2014: Industry}, publisher = {Books on Demand}, address = {Norderstedt}, event_place = {Aachen, Germany}, event_name = {3rd Conference for Wind Power Drives , Aachen , Germany}, event_date = {07-03-2017 to 08-03-2017}, language = {30}, ISBN = {978-3-7431-3456-0}, DOI = {10.18154/RWTH-2017-02946}, stag_bib_extends_levelofaccess = {NA}, author = {Kock, S. and Jacobs, G. and Bosse, D. and Weidinger, P.} } @Proceedings { KockF2017, subid = {242}, title = {Measurement uncertainty evaluation of torque measurements in nacelle test benches}, journal = {Conference Proceedings IMEKO 23rd TC3, 13th TC5 and 4 th TC22 International Conference}, year = {2017}, number = {2017}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {torque measurement, measurement, uncertainty, nacelle test bench calibration, wind energy}, web_url = {https://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-010.pdf}, misc2 = {EMPIR 2014: Industry}, event_place = {Helsinki Finland}, event_name = {IMEKO 23rd TC3, 13th TC5 and 4 th TC22 International Conference}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-010.pdf}, author = {Kock, S. and Foyer, G.} } @Article { BojkovskiOKMSISFZSSJoHHPV2017, subid = {1095}, title = {Expansion of European research capabilities in humidity measurement}, journal = {18th International Congress of Metrology}, year = {2017}, number = {2017 18th}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {4/06006}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html}, misc2 = {EMPIR 2015: Research Potential}, publisher = {EDP Sciences}, language = {30}, DOI = {10.1051/metrology/201706006}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Sestan, D. and Zvizdić, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Article { NeumaierKBD2016, title = {Characterization of detector-systems based on CeBr3, LaBr3, SrI2 and CdZnTe for the use as dosemeters}, journal = {Radiation Physics and Chemistry}, year = {2016}, month = {12}, day = {31}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, keywords = {Environmental monitoring, Scintillation detectors, Monte-Carlo simulations}, misc2 = {EMRP A169: Call 2013 Environment II}, language = {30}, DOI = {10.1016/j.radphyschem.2016.12.015}, stag_bib_extends_levelofaccess = {NA}, author = {Neumaier, S. and Kessler, P. and Behnke, B. and Dombrowski, H.} } @Article { MaringerWKSB2016, title = {Study of particular problems appearing in NORM samples and recommendations for best practice gamma-ray spectrometry}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {12}, day = {28}, volume = {126}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {285-288}, keywords = {Gamma-ray spectrometry; NORM; Spectral interference; Radon tightness}, web_url = {https://www.sciencedirect.com/science/article/pii/S0969804316304961}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2016.12.035}, stag_bib_extends_levelofaccess = {NA}, author = {Maringer, F.J. and Wiedner, H. and Kabrt, F. and Stietka, M. and Baumgartner, A.} } @Article { CuenatCMSHKSWK2016, subid = {249}, title = {Combined anomalous Nernst effect and thermography studies of ultrathin CoFeB/Pt nanowires}, journal = {AIP Advances}, year = {2016}, month = {12}, day = {22}, volume = {7}, number = {5}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {055904}, keywords = {Abstract: Using electrical and thermal measurements, we present a method for characterising the anomalous Nernst effect (ANE) within nanoscale devices implementing perpendicular anisotropy materials. Perpendicularly magnetised CoFeB/Pt nanowires were fabricated in close proximity to Pt heater elements on an electrically insulating substrate. The voltages induced within the magnetic material as a result of the ANE were recorded for increasing heater powers, and for both out-of-plane saturated states of the device. Scanning thermal probe microscopy was used to map the temperature distribution within the region of the device at a range of heater powers. By analysing the results from each thermography measurement, it was possible to correlate the temperature gradient induced at the magnetic nanowire against the anomalous Nernst voltage measured within the device. For the particular material, geometry and substrate used, a Nernst coefficient value KN = 2.3 \(\mu\)V(K.T)-1 was calculated. This combination of measurements can provide a powerful tool to characterise the ANE within a number of nanoscale systems, a necessary task for the future implementation and optimisation of the effect within spin-caloritronic devices.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/1.4973196}, stag_bib_extends_levelofaccess = {NA}, author = {Wells, J. and Selezneva, E. and Krzysteczko, P. and Hu, X. and Schumacher, H.W. and Mansell, R. and Cowburn, R. and Cuenat, A. and Kazakova, O.} } @Article { PenttilaRGPMKMHP2016, subid = {94}, title = {Traceable Coulomb blockade thermometry}, journal = {Metrologia}, year = {2016}, month = {12}, day = {20}, volume = {54}, number = {1}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {69-76}, keywords = {Coulomb blockade thermometry, primary thermometer, traceability, thermodynamic temperature}, web_url = {https://arxiv.org/abs/1609.06943v2}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa4f84}, stag_bib_extends_levelofaccess = {NA}, author = {Hahtela, O and Mykk{\"a}nen, E and Kemppinen, A and Meschke, M and Prunnila, M and Gunnarsson, D and Roschier, L. and Penttil{\"a}, J and Pekola, J} } @Article { MillingtonKQWWKPW2016, title = {Experimental tomographic methods for analysing flow dynamics of gas-oil-water flows in horizontal pipeline}, journal = {Journal of Hydrodynamics, Ser. B}, year = {2016}, month = {12}, volume = {28}, number = {6}, number2 = {ENG58: MultiFlowMet: Multiphase flow metrology in oil and gas production}, pages = {1018-1021}, keywords = {Experimental tomographic methods for analysing flow dynamics of gas-oil-water flows in horizontal pipeline}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York, USA}, language = {30}, ISSN = {1001-6058}, DOI = {10.1016/S1001-6058(16)60704-7}, stag_bib_extends_levelofaccess = {NA}, author = {Millington, David and Kenibar, Asaad and Qui, Changhua and Wei, Kent and Wang, Mi and Karki, Bishal and Polansky, Jiri and Wang, Qiang} } @Article { , title = {MN·m torque calibration for nacelle test benches using transfer standards}, journal = {ACTA IMEKO}, year = {2016}, month = {12}, volume = {5}, number = {4}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, pages = {7}, keywords = {torque calibration; transfer standard; nacelle test bench}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-05\%20\%282016\%29-04-03}, misc2 = {EMPIR 2014: Industry}, publisher = {International Measurement Confederation}, address = {Budapest}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v5i4.414}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schlegel, C and Kahmann, H and Kumme, R} } @Article { FengKF2016, title = {Development of CO2 snow cleaning for in situ cleaning of µCMM stylus tips}, journal = {Measurement Science and Technology}, year = {2016}, month = {11}, day = {28}, volume = {28}, number = {1}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, pages = {015007}, keywords = {snow cleaning, µCMM, precision cleaning, cleaning force}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/28/1/015007}, stag_bib_extends_levelofaccess = {NA}, author = {Feng, X. and Kinnell, P.K. and Feng, X.} } @Article { ReitzensteinKLRSSKSMRWFDJK2016, subid = {336}, title = {Impact of Phonons on Dephasing of Individual Excitons in Deterministic Quantum Dot Microlenses}, journal = {ACS Photonics}, year = {2016}, month = {11}, day = {22}, volume = {3}, number = {12}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {2461-2466}, keywords = {single-photon source, 3D lithography, 3D direct laser writing, semiconductor quantum dot, micro-objective}, web_url = {http://pubs.acs.org/doi/pdf/10.1021/acsphotonics.7b00253}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.6b00707}, stag_bib_extends_levelofaccess = {NA}, author = {Jakubczyk, T. and Delmonte, V. and Fischbach, S. and Wigger, D. and Reiter, D.E. and Mermillod, Q. and Schnauber, P. and Kaganskiy, A. and Schulze, J.H. and Strittmatter, A. and Rodt, S. and Langbein, W. and Kuhn, T. and Reitzenstein, S. and Kasprzak, J.} } @Proceedings { , title = {New radiometric calibration site located at Gobabeb, Namib desert.}, journal = {Geoscience and Remote Sensing Symposium (IGARSS)}, year = {2016}, month = {11}, day = {3}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {6094 - 6097}, keywords = {vicarious calibration, RadCalNet, site characterisation, HDRF}, web_url = {http://ieeexplore.ieee.org/abstract/document/7730592/?reload=true}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Electrical and Electronics Engineers International}, event_place = {Beijing, China.}, event_name = {Geoscience and Remote Sensing Symposium (IGARSS)}, event_date = {10th-15th July 2016}, language = {30}, ISSN = {2153-7003}, DOI = {10.1109/IGARSS.2016.7730592}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/abstract/document/7730592/?reload=true}, author = {Bialek, AB and Greenwell, CG and Lamare, ML and Meygret, AM and Marcq, SM and Lacherade, SL and Woolliams, EW and Berthelot, BB and Bouvet, MB and King, MK and Underwood, CU and Fox, NF} } @Article { KraehnertHORH2016, title = {Ellipsometric porosimetry on pore-controlled TiO2 layers}, journal = {Applied Surface Science}, year = {2016}, month = {11}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, keywords = {Spectroscopic ellipsometry; Porous materials; Porosimetry; Multi-sample analysis; Thin film metrology}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York, USA}, language = {30}, ISSN = {0169-4332}, DOI = {10.1016/j.apsusc.2016.11.055}, stag_bib_extends_levelofaccess = {NA}, author = {Kraehnert, Ralph and Hodoroaba, Vasile-Dan and Ortel, Erik and Rosu, Dana-Maria and Hertwig, Andreas} } @Article { YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016, subid = {321}, title = {Versailles Project on Advanced Materials and Standards Interlaboratory Study on Measuring the Thickness and Chemistry of Nanoparticle Coatings Using XPS and LEIS}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {10}, day = {27}, volume = {120}, number = {42}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {24070-24079}, keywords = {VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory}, web_url = {https://spiral.imperial.ac.uk/handle/10044/1/40824}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b06713}, stag_bib_extends_levelofaccess = {NA}, author = {Belsey, N.A. and Cant, D. and Cant, D.J.H. and Minelli, C. and Araujo, J.R. and Bock, B. and Br{\"u}ner, P. and Castner, D.G. and Ceccone, G. and Counsell, J.D.P. and Dietrich, P.M. and Engelhard, M.H. and Fearn, S. and Galhardo, C.E. and Kalbe, H. and Kim, J.W. and Lartundo-Rojas, L. and Luftman, H.S. and Nunney, T.S. and Pseiner, J. and Smith, E.F. and Spampinato, V. and Sturm, J.M. and Thomas, A.G. and Treacy, J.P.W. and Veith, L. and Wagstaffe, M. and Wang, H. and Wang, M. and Wang, Y.C. and Werner, W. and Yang, L.} } @Article { EngertRGPMKHSCLSKMP2016, title = {New Evaluation of T − T2000 from 0.02K to 1K by Independent Thermodynamic Methods}, journal = {International Journal of Thermophysics}, year = {2016}, month = {10}, day = {20}, volume = {37}, number = {12}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, keywords = {Temperature, Thermodynamic Methods, Kelvin}, web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/new-evaluation-of-t-t2000-from-002k-to-1k-by-independent-thermodynamic-methods(dc393a64-8d59-4083-9435-f2bd70eea8ed).html}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-016-2123-4}, stag_bib_extends_levelofaccess = {NA}, author = {Engert, J and Kirste, A. and Shibahara, A. and Casey, A. and Levitin, L.V. and Saunders, J. and Hahtela, O. and Kemppinen, A. and Mykk{\"a}nen, E. and Prunnila, M. and Gunnarsson, D. and Roschier, L. and Meschke, M. and Pekola, J.} } @Article { YoshidaWDKLSGIHTGMB2016, title = {Reassessment of the NH4NO3thermal decomposition technique for calibration of the N2O isotopic composition}, journal = {Rapid Communications in Mass Spectrometry}, year = {2016}, month = {10}, day = {20}, volume = {30}, number = {23}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2487-2496}, keywords = {thermal decomposition, isotopic composition}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0951-4198}, DOI = {10.1002/rcm.7736}, stag_bib_extends_levelofaccess = {NA}, author = {Yoshida, N. and Werner, R.A. and Decock, C. and Kuhn, T. and Lehmann, M.F. and Schleppi, P. and Geilmann, H. and Ibraim, E. and Harris, E. and Toyoda, S. and Gutjahr, W. and Mohn, J. and Brand, W.A.} } @Article { KhoramshahiRVKHHNN2016, title = {Close-range environmental remote sensing with 3D hyperspectral technologies}, journal = {Earth Resources and Environmental Remote Sensing/GIS Applications VII}, year = {2016}, month = {10}, day = {18}, volume = {10005}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, keywords = {Remote sensing, Unmanned aerial vehicles, Clouds, Radiative energy transfer, Modeling, RGB color model, Radiation, Hyperspectral imaging, LIDAR, Anisotropy}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2571414\&resultClick=1}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {SPIE}, language = {30}, DOI = {10.1117/12.2240936}, stag_bib_extends_levelofaccess = {NA}, author = {Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Kaasalainen, S. and Hakala, T. and Honkavaara, E. and Nevalainen, O. and N{\"a}si, R.} } @Article { HuangGYKLZF2016, title = {Lumen degradation modeling of white-light LEDs in step stress accelerated degradation test}, journal = {Reliability Engineering \& System Safety}, year = {2016}, month = {10}, volume = {154}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {152-159}, keywords = {Accelerated test, Brownian motion, Degradation test, Light-emitting diodes, Step stress, Wiener process}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {Suite 800, 230 Park Avenue, New York, NY 10169, USA}, language = {30}, ISSN = {0951-8320}, DOI = {10.1016/j.ress.2016.06.002}, stag_bib_extends_levelofaccess = {NA}, author = {Huang, Jianlin and Golubović, Dušan S and Yang, Daoguo and Koh, Sau and Li, Xiupeng and Zhang, G.Q. and Fan, Xuejun} } @Article { DrungK2016, subid = {10}, title = {Ultrastable Low-Noise Current Amplifiers With Extended Range and Improved Accuracy}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2016}, month = {9}, day = {30}, volume = {PP}, number = {99}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {1-8}, keywords = {Resistors, Current measurement, Uncertainty, Standards, Temperature measurement, Measurement uncertainty, Resistance}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane, Piscataway, NJ 08855-1331, United States}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2016.2611298}, stag_bib_extends_levelofaccess = {NA}, author = {Drung, Dietmar and Krause, Christian} } @Article { , title = {Improvement of an Atomic Clock using Squeezed Vacuum}, journal = {Physical Review Letters}, year = {2016}, month = {9}, day = {28}, volume = {117}, number = {14}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {143004}, keywords = {clock, spin squeezing, squeezed vacuum}, web_url = {http://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.143004}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {Washington, DC, USA}, language = {30}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.117.143004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kruse, I and Lange, K and Peise, J and L{\"u}cke, B and Pezz{\`e}, L and Arlt, J and Ertmer, W and Lisdat, C and Santos, L and Smerzi, A and Klempt, C} } @Article { RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016, title = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, journal = {Atmospheric Chemistry and Physics}, year = {2016}, month = {9}, day = {23}, volume = {16}, number = {18}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {11915-11935}, keywords = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7324}, DOI = {10.5194/acp-16-11915-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Ramachandran, R. and Fu, X. and Zhang, H. and Feng, X.B. and Wip, D. and Obolkin, V. and Mashyanov, N. and Sena, F. and Gawlik, B.M. and Neves, L.M. and Read, K.A. and Kotnik, J. and Horvat, M. and Skov, H. and Magand, O. and Angot, H. and Dommergue, A. and Garcia, P.E. and Di{\'e}guez, M.D.C and Barbante, C. and Cairns, W. and Brito, J. and Barbosa, H.D.M.J and Morais, F. and Artaxo, P. and W{\"a}ngberg, I. and Munthe, J. and Martin, L. and Labuschagne, C. and Brunke, E.G. and Weigelt, A. and Ebinghaus, R. and Landis, M. and Mannarino, V. and Cinnirella, S. and Carbone, F. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Cossa, D. and Knoery, J. and Marusczak, Nicolas and Nerentorp, M. and Fisicaro, P.} } @Article { MartiUGKKTD2016, title = {Experimental determination of the effective attenuation length of palladium 3d 5/2 photoelectrons in a magnetron sputtered Pd nanolayer}, journal = {Surface and Interface Analysis}, year = {2016}, month = {9}, day = {15}, volume = {49}, number = {5}, number2 = {IND15: SurfChem: Traceable quantitative surface chemical analysis for industrial applications}, pages = {464-468}, keywords = {XPS, electron effective attenuation length, Pd 3d}, web_url = {https://onlinelibrary.wiley.com/doi/abs/10.1002/sia.6141}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.6141}, stag_bib_extends_levelofaccess = {NA}, author = {Marti, K. and Unger, W.E.S. and Gross, T. and Krumrey, M. and Kalbe, H. and Treu, D. and Dietrich, P.M.} } @Article { LegreKKJGCBMMS2016, subid = {751}, title = {Creation of backdoors in quantum communications via laser damage}, journal = {Physical Review A}, year = {2016}, month = {9}, day = {15}, volume = {94}, number = {3}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {030302(R)}, keywords = {Quantum Cryptography, Quantum Communication}, web_url = {https://link.aps.org/accepted/10.1103/PhysRevA.94.030302}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.94.030302}, stag_bib_extends_levelofaccess = {NA}, author = {Makarov, V. and Bourgoin, J.P. and Chaiwongkhot, P. and Gagn{\'e}, M. and Jennewein, T. and Kaiser, S. and Kashyap, R. and Legr{\'e}, M. and Minshull, C. and Sajeed, S.} } @Proceedings { , title = {Proficiency Testing for Conducted Immunity with a new Round Robin Test Device}, journal = {International Symposium and Exhibition on Electromagnetic Compatibility Proceedings}, year = {2016}, month = {9}, day = {10}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-100}, keywords = {Electromagnetic Compatibility (EMC), IEC 61000- 4-6, EN ISO 17025, EN ISO 17043, proficiency testing, round robin, test device, conducted immunity, common mode, disturbance signal, Coupling-Decoupling Network (CDN), inter-laboratory comparison, Equipment under Test (EUT), Auxiliary Equipment (AE).}, web_url = {http://www.emceurope.org/2016/index.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Wroclaw / Poland}, event_name = {EMC Europe 2016 Wroclaw International Symposium and Exhibition on Electromagnetic Compatibility}, event_date = {05-09-2016 to 09-09-2016}, language = {30}, ISBN = {978-1-4799-6615-8}, ISSN = {2158-110X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tas, Emrah and Cakir, Soydan and Cetintas, Mustafa and Hamouz, Pavel and Isbring, Thomas and Kokalj, Miha and Lopez, Daniel and Lundgren, Urban and Mandaris, Dwi and Pinter, Borut and Poriz, Martin and Pous, Marc and Pythoud, Fr{\'e}d{\'e}ric and Sen, Osman and Silva, Ferran and Svaboda, Marek and Trincaz, Braise and Zhao, Dongsheng} } @Article { , title = {Experimental Evaluation of Ball Bar Standard Thermal Properties by Simulating Real Shop Floor Conditions}, journal = {International Journal of Simulation Modelling}, year = {2016}, month = {9}, volume = {15}, number = {3}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {511-521}, keywords = {Traceability, Co-Ordinate Measurement, Measurement Standard, Thermal Expansion}, web_url = {http://www.ijsimm.com/Full_Papers/Fulltext2016/text15-3_511-521.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {DAAAM Internbational}, address = {Vienna}, language = {30}, ISSN = {1726-4529}, DOI = {10.2507/IJSIMM15(3)10.356}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.ijsimm.com/}, author = {Klobucar, R. and Acko, B.} } @Article { , title = {Modelling the structure of Zr-rich Pb(Zr1-xTix)O3, x=0.4 with a multiphase approach}, journal = {Physical Chemistry Chemical Physics · September 2016}, year = {2016}, month = {9}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, keywords = {Modelling Zr-rich Pb(Zr1- xTix)O3}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/CP/C6CP04976A\#!divAbstract}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Reasearch Gate}, language = {30}, DOI = {10.1039/C6CP04976A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kimmel, A. V. and Mysovsky, Andrey S.} } @Article { , title = {Reasons justifying a revision of the existing sound power measurement standards}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {29}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {sound power level, transfer standard source, sound power measurement standards , Traceability I-INCE Classifacation of Subjects Number(s): 72.4}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arendt, I. and Kurtz, P.} } @Article { , title = {Main achievements of the EMRP sound power project and future prospects}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound Power, Primary Standard I-INCE Classification of Subjects Number(s): 72.4}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Guglielmone, C. and Wittstock, V. and Kirbas, C. and Andersson, H.} } @Article { , title = {Dissemination of the unit watt in airborne sound: aerodynamic reference sound sources as transfer standards}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, dissemination, directivity, correction, substitution I-INCE Classification of Subjects Number(s): 72.4}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Brezas, S. and Cellard, P. and Andersson, H. and Guglielmone, C. and Kirbas, C.} } @Article { , title = {Primary sound power sources for the realisation of the unit watt in airborne sound}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound Power, Primary Sound Power Source, Rayleigh’s Integral}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kirbas, C. and Andersson, H. and Guglielmone, C. and Bilgi\c{c}, E.} } @Proceedings { , title = {Fabrication of graphene quantum Hall resistance standard in a cryogen-freee table-top system}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Epitaxial layers, Graphene, measurement standards, microfabrication, quantum hall effect}, web_url = {http://ieeexplore.ieee.org/document/7540516/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540516}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {He, H. and Janssen, T.J.B.M. and Rozhko, S. and Tzalenchuk, A. and Lara-Avila, S. and Yakimova, R. and Kubatkin, S.} } @Proceedings { , title = {Towards a cryogen-free table-top primary resistance standard}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {quantum Hall effect, graphene, primary resistance metrology, cryogenic current comparators.}, web_url = {http://ieeexplore.ieee.org/document/7540654/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540654}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Rhozhko, S. and Williams, J.M. and Ireland, J. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Tzalenchuk, A.} } @Proceedings { , title = {AC quantum Hall effect in epitaxial graphene}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Graphene, AC quantum Hall effect, quantum Hall resistance, frequency dependence, AC coaxial bridge, Resistance, Electrical resistance measurement, Bridge circuits, Frequency measurement, Standards}, web_url = {http://ieeexplore.ieee.org/document/7540655/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540655}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\"u}{\"o}nd, F. and Overney, F. and Jeanneret, B. and M{\"u}ller, A. and Kruskopf, M. and Pierz, K.} } @Proceedings { , title = {Convenient Graphene-Based Quantum Hall Resistance Standards}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Graphene, materials science and technology, measurement standards, metrology, quantum Hall effect devices}, web_url = {http://ieeexplore.ieee.org/document/7540650/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540650}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Brun-Pcard, J. and Ribeiro-Palau, R. and Lafont, F. and Kazazis, D. and Michon, A. and Cheynis, F. and Couturaud, O. and Consejo, C. and Jouault, B. and Poirier, W. and Schopfer, F.} } @Proceedings { , title = {Magnetocapacitance and Dissipation Factor of Epitaxial Graphene Hall Bars}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {graphene, quantum Hall effect, coaxial bridge circuit, magnetocapacitance, dissipation factor}, web_url = {http://ieeexplore.ieee.org/document/7540651/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540651}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schurr, J. and Kalmbach, C.C. and Kruskopf, M. and M{\"u}ller, A. and Pierz, K. and Ahlers, F.} } @Proceedings { , title = {Precision Measurements of Quantum Hall Resistance Plateau in Doping-Controlled Graphene Device}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Graphene, quantum Hall effect, precision measurement, resistance metrology, cryogenic current comparator}, web_url = {http://ieeexplore.ieee.org/document/7540495/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540495}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Chae, D.H. and Kim, W.S. and Satrapinski, A. and Novikov, S.} } @Article { , title = {Detector-device-independent QKD: security analysis and fast implementation}, journal = {Journal of Applied Physics}, year = {2016}, month = {8}, day = {9}, volume = {120}, number = {6}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {063101}, note = {Copyright was too long instead of that we will ise the link. (see copyright statment below) Subject to the rights herein granted to AIP Publishing, each Copyright Owner retains ownership of copyright and all other proprietary rights such as patent rights in the Work. Each Copyright Owner retains the following nonexclusive rights to use the Work, without obtaining permission from AIP Publishing, in keeping with professional publication ethics, and provided clear credit is given to its first publication in an AIP Publishing journal. Any reuse must include a full credit line acknowledging AIP Publishing’s publication and a link to the VOR on AIP Publishing’s site. Each Copyright Owner may: 1. Reprint portions of the Work (excerpts, figures, tables) in future works created by the Author, in keeping with professional publication ethics. 2. Post the Accepted Manuscript (AM) to their personal web page or their employer’s web page immediately after acceptance by AIP Publishing. 3. Deposit the AM in an institutional or funder-designated repository immediately after acceptance by AIP Publishing. 4. Use the AM for posting within scientific collaboration networks (SCNs). For a detailed description of our policy on posting to SCNs, please see our Web Posting Guidelines (https://publishing.aip.org/authors/web-posting-guidelines). 5. Reprint the Version of Record (VOR) in print collections written by the Author, or in the Author’s thesis or dissertation. It is understood and agreed that the thesis or dissertation may be made available electronically on the university’s site or in its repository and that copies may be offered for sale on demand. 6. Reproduce copies of the VOR for courses taught by the Author or offered at the institution where the Author is employed, provided no fee is charged for access to the Work. 7. Use the VOR for internal training and noncommercial business purposes by the Author’s employer. 8. Use the VOR in oral presentations made by the Author, such as at conferences, meetings, seminars, etc., provided those receiving copies are informed that they may not further copy or distribute the Work. 9. Distribute the VOR to colleagues for noncommercial scholarly use, provided those receiving copies are informed that they may not further copy or distribute the Work. 10. Post the VOR to their personal web page or their employer’s web page 12 months after publication by AIP Publishing. 11. Deposit the VOR in an institutional or funder-designated repository 12 months after publication by AIP Publishing. 12. Update a prior posting with the VOR on a noncommercial server such as arXiv, 12 months after publication by AIP Publishing.}, keywords = {Quantum cryptography, Polarization, Qubits, Photons, Modulators}, web_url = {https://arxiv.org/pdf/1607.05435.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {0021-8979}, DOI = {10.1063/1.4960093}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-8-10}, author = {Boaron, Alberto and Korzh, Boris and Houlmann, Raphael and Boso, Gianluca and Lim, Charles Ci Wen and Martin, Anthony and Zbinden, Hugo} } @Proceedings { , title = {Calibration of Si-SPAD detectors using the double attenuator technique and a low noise silicon photodiode}, journal = {DGaO Proceedings 2016}, year = {2016}, month = {8}, day = {8}, volume = {117}, number = {none}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {28-29}, keywords = {Calibration, SPAD}, web_url = {http://www.dgao-proceedings.de/download/117/117_p28.pdf}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {DGaO}, address = {Erlangen}, event_place = {Hannover}, event_name = {DGaO - Deutschen Gesellschaft f{\"u}r angewandte Optik}, event_date = {12-05-2016 to 17-05-2016}, language = {30}, ISSN = {1614-8436}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.dgao-proceedings.de/download/117/117_p28.pdf}, author = {Lopez, M. and Porrovecchio, G. and Hofer, H. and Rodiek, B. and Šmid, M. and K{\"u}ck, S.} } @Article { , title = {Characterisation of nitrogen-vacancy based single-photon sources}, journal = {DGaO Proceedings 2016}, year = {2016}, month = {8}, day = {8}, volume = {117}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {117_p32}, keywords = {single-photon source, nitrogen-vacancy in nanodiamonds, calibration, single-photon detectors, antibunching}, web_url = {http://www.dgao-proceedings.de/download/117/117_p32.pdf}, web_url2 = {http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Deutschen Gesellschaft f{\"u}r angewandte Optik e.V.}, address = {Erlangen}, language = {30}, ISSN = {1614-8436}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6}, author = {Rodiek, B. and L{\'o}pez, M. and Hofer, H. and Chu, X.-L. and G{\"o}tzinger, S. and K{\"u}ck, S.} } @Article { , title = {The calibration of a prototype occluded ear simulator designed for neonatal hearing assessment applications}, journal = {AIP Citation}, year = {2016}, month = {8}, day = {5}, volume = {140 (2016)}, number = {2}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {806–813}, keywords = {occluded ear simulator, prototype, neonatal hearing assessment applications, Microphones, Ears, Calibration, Acoustic impedance measurement, Sound pressure}, web_url = {http://scitation.aip.org/content/asa/journal/jasa/140/2/10.1121/1.4960517}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {The Journal of the Acoustical Society of America}, address = {Melville, NY}, language = {30}, DOI = {10.1121/1.4960517}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barham, R. and Olsen, E.S. and Rodrigues, D. and Barrera-Figueroa, S. and Sadikoğlu, E. and Karab{\"o}ce, B.} } @Article { SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016, subid = {135}, title = {A clock network for geodesy and fundamental science}, journal = {Nature Communications}, year = {2016}, month = {8}, volume = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {12443}, keywords = {Clock network; geodesy;}, web_url = {https://www.nature.com/articles/ncomms12443}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms12443}, stag_bib_extends_levelofaccess = {NA}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and Doerscher, S. and Haefner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G. and Amy-Klein, A. and Le Targat, R. and Lodewyck, J. and Lopez, O and Pottie, P.-E.} } @Article { SvecSSRPNMLKJGFFDMAHBTTVW2016_2, title = {60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {8}, volume = {114}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {167-172}, keywords = {Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.05.014}, stag_bib_extends_levelofaccess = {NA}, author = {Svec, A. and Solc, J. and Silva, L. and Reis, M. and Peyres, V. and Nečemer, M. and Moser, H. and Luca, A. and Klemola, S. and Javornik, A. and Garc{\'i}a-Tora{\~n}o, E. and Ferreux, L.. and Fazio, A. and Dry{\'a}k, P. and Marroyo, B.C. and Arnold, D. and Hult, M. and Burda, O. and Tzika, F. and Tyminski, Z. and Vodenik, B. and W{\"a}tjen, U.} } @Proceedings { , title = {First ac measurements of the quantum Hall effect in epitaxial graphene}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2016}, month = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {38--39}, keywords = {AC analysis technique,AC loss elimination,AC measurement,C,Electrical resistance measurement,Gallium arsenide,Graphene,Hall effect,Impedance,Noise,Resistance,electric current measurement,epitaxial graphene-based impedance standard,graphene,impedance,quantized Hall resistance,quantum Hall effect,spectral noise density}, web_url = {http://ieeexplore.ieee.org/articleDetails.jsp?arnumber=6898247}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898247}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kalmbach, C. and Schurr, J. and Ahlers, F.J. and M{\"u}ller, A. and Novikov, S. and Lebedeva, N. and Satrapinsky, A.} } @Article { , title = {Characterization of a Multi-Element Clinical HIFU System Using Acoustic Holography and Nonlinear Modeling}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2016}, month = {8}, volume = {60}, number = {8}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1683-98}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Institute of Electrical and Electronics Engineers}, language = {30}, ISSN = {0885–3010}, DOI = {10.1109/TUFFC.2013.2750}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Krieder, w and Yuldashev, P and Sapoznikov, OA and Farr, N and Partinen, A and Bailey, MR and Khokhlova, VA} } @Article { , title = {Advances in Large Scale Metrology – Review and Future Trends}, journal = {CIRP Annals Manufacturing Technology}, year = {2016}, month = {8}, volume = {65/I}, number = {2016}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {643-665}, keywords = {Metrology, Measuring Instrument, Uncertainty, Simulation, Modelling, Information}, web_url = {http://www.sciencedirect.com/science/article/pii/S0007850616301895}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Oxford}, language = {30}, DOI = {10.1016/j.cirp.2016.05.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Schmitt, R. and Peterek, M. and Morse, E. and Knapp, W. and Galetto, M. and H{\"a}rtig, F. and Goch, G. and Hughes, B. and Forbes, A. and Estler, W.T.} } @Article { ShortisRKMB2016_2, title = {Optimised multi-camera systems for dimensional control in factory environments}, journal = {Proceedings of the Institution of Mechanical Engineers, Part B: Journal of Engineering Manufacture}, year = {2016}, month = {8}, volume = {232}, number = {10}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {1707-1718}, keywords = {Industrial photogrammetry, camera calibration, refraction correction, manufacturing, part assembly}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SAGE Publications}, language = {30}, ISSN = {0954-4054, 2041-2975}, DOI = {10.1177/0954405416654936}, stag_bib_extends_levelofaccess = {NA}, author = {Shortis, M. and Robson, S. and Kyle, S. and MacDonald, L. and Boehm, J.} } @Article { , title = {Experimental determination of the oxygen K-shell fluorescence yield using thin SiO2 and Al2O3 foils}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2016}, month = {7}, day = {28}, volume = {124}, number = {1 Oct 2016}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {94-98}, keywords = {fundamental parameter, fluorescence yield, oxygen, XRS}, web_url = {http://www.sciencedirect.com/science/article/pii/S0584854716301732}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier B.V.}, address = {Amsterdam}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2016.08.024}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}nicke, P. and Kolbe, M. and Krumrey, M. and Unterumsberger, R. and Beckhoff, B.} } @Article { , title = {Giant quantum Hall plateaus generated by charge transfer in epitaxial graphene}, journal = {Nature: Scientific Reports}, year = {2016}, month = {7}, day = {26}, volume = {6}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {30296}, keywords = {graphene, measurement, QHE,}, web_url = {http://www.nature.com/articles/srep30296?WT.feed_name=subjects_physical-sciences}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Scientific reports}, language = {30}, DOI = {10.1038/srep30296}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Alexander-Webber, J.A. and Huang, J. and Maude, D.K. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.} } @Article { , title = {Accurate quantification of selenoproteins in human plasma/serum by isotope dilution ICP-MS: focus on selenoprotein P}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, month = {7}, day = {26}, volume = {31}, number = {09/2016}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1904-1912}, keywords = {selenoproteins, isotope dilution, ICP-MS,}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00122J\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {The Royal Society of Chemistry}, address = {Cambridge, United Kingdom}, language = {30}, DOI = {10.1039/c6ja00122j}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {del Castillo Busto, M. Estela and Oster, Caroline and Cuello-Nunez, Susana and Deitrich, Christian L. and Raab, Andrea and Konopka, Anna and Lehmann, Wolf D. and Goenaga-Infante, Heidi and Fisicaro, Paola} } @Article { WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016, title = {Five-year records of Total Mercury Deposition flux at GMOS sites in the Northern and Southern Hemispheres}, journal = {Atmospheric Chemistry and Physics Discussions}, year = {2016}, month = {7}, day = {20}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {1-33}, keywords = {mercury, wet deposition flux,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7375}, DOI = {10.5194/acp-2016-517}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}ngberg, I. and Walters, C. and Vard{\`e}, M. and Spandow, P. and Somerset, V. and Sena, F. and Islas, M.R. and Obolkin, V. and Munthe, J. and Mkololo, T. and Mashyanov, N. and Martin, L. and Magand, O. and Labuschagne, C. and Kotnik, J. and Horvat, M. and Hansson, K. and Hagestr{\"o}m, U. and Gawlik, B. and Garcia, P.E. and Fu, X. and Feng, X.B. and Ebinghaus, R. and Dommergue, A. and Di{\'e}guez, M.D.C. and Comero, S. and Cairns, W. and Arcega-Cabrera, F. and Brunke, E.G. and Barbante, C. and Angot, H. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Weigelt, A. and Yang, X. and Fisicaro, P.} } @Proceedings { , title = {Close range calibration of long focal length lenses in a changing environment}, journal = {The International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences}, year = {2016}, month = {7}, day = {19}, volume = {2016}, number = {XLI-B5}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {115-122}, keywords = {Camera, calibration, close range, physical parameter, correlation, temperature, wavelength}, web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B5/115/2016/isprs-archives-XLI-B5-115-2016.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {ISPRS}, address = {Hannover}, event_place = {Prague, Czech Republic}, event_name = {XXIII International Socirty of Photogrammetry and Remote Sensing Congress}, event_date = {12-19 July 2016}, language = {30}, DOI = {10.5194/isprs-archives-XLI-B5-115-2016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Robson, S and MacDonald, L and Kyle, S and Shortis, M R} } @Proceedings { , title = {Quasi coherent overlapping procedure to improve harmonics suppression using single tone estimation algorithms}, journal = {Proceedings CPEM 2016}, year = {2016}, month = {7}, day = {18}, volume = {54}, number = {12}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Measurement, sampling, estimation algorithms, harmonic distortion, estimation error, uncertainty}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540596}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Unknown}, event_place = {Ottawa}, event_name = {Conference on Precision Elexctromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {0018-9456}, ISSN = {0018-9456}, DOI = {10.1109/CPEM.2016.7540596}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lapuh, Rado and Voljč, Boštjan and Kokalj, Miha and Lindič, Matjaž and Svetik, Zoran} } @Proceedings { , title = {Verification concepts in S-parameter measurements}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, day = {15}, volume = {NA}, number = {NA}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {NA}, keywords = {Verification, scattering parameter, vector network analyzer.}, web_url = {http://ieeexplore.ieee.org/document/7540508/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {NA}, language = {30}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540508}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mubarak, F. and Zeier, M. and Hoffmann, J. and Ridler, N.M. and Salter, M.J. and Kuhlmann, K.} } @Article { , title = {[Sec-to-Cys]selenoprotein – a novel type of recombinant, full-length selenoprotein standard for quantitative proteomics}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, month = {7}, day = {14}, volume = {31}, number = {9/2016}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1929-1938}, keywords = {selenoproteins, glutathione peroxidase 3 (GPx3), (SEPP1), selenocysteine, cysteine codons}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00123H\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {The Royal Society of Chemistry}, address = {Cambridge, United Kingdom}, language = {30}, DOI = {10.1039/c6ja00123h}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Konopka, Anna and Winter, Dominic and Konopka, Witold and del Castillo Busto, M. Estela and Goenaga-Infante, Heidi and Nunez, Susana and Fisicaro, Paola and Lehmann, Wolf D.} } @Proceedings { BeckhoffPMHK2016, title = {Fundamental parameter determination to improve spectroscopical methods}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, month = {7}, day = {10}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, keywords = {X-ray fluorescence, atomic fundamental parameters, fluorescence yields, optical constants, spectroscopy}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Ottawa}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, DOI = {10.1109/CPEM.2016.7540520}, stag_bib_extends_levelofaccess = {NA}, author = {Beckhoff, B. and Pollakowski, B. and Muller, M. and Honicke, P. and Kolbe, M.} } @Article { , title = {Comparison at the sub-100 fW optical power level of calibrating a single-photon detector using a high-sensitive, low-noise silicon photodiode and the double attenuator technique}, journal = {Metrologia}, year = {2016}, month = {7}, day = {8}, volume = {53}, number = {4}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {1115-1122}, keywords = {detection efficiency, Si-SPAD, calibration, comparison}, web_url = {http://iopscience.iop.org/journal/0026-1394}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Oxford}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1115}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Porrovecchio, G. and Šmid, M. and Lopez, M. and Hofer, H. and Rodiek, B. and K{\"u}ck, S.} } @Article { , title = {Reference data sets for testing metrology software}, journal = {Metrologia}, year = {2016}, month = {7}, day = {6}, volume = {53}, number = {4}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {1091-1100}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1091}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1091}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kok, GJPK and Harris, PMH and Smith, IMS and Forbes, ABF} } @Article { , title = {Irradiation-induced degradation of PTB7 investigated by valence band and S 2p photoelectron spectroscopy}, journal = {Nanotechnology}, year = {2016}, month = {7}, day = {1}, volume = {27}, number = {32}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {324005}, keywords = {organic photo voltaics, XPS, UPS}, web_url = {http://iopscience.iop.org/article/10.1088/0957-4484/27/32/324005}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0957-4484}, DOI = {10.1088/0957-4484/27/32/324005}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Darlatt, E and Muhsin, B and Roesch, R and Lupulescu, C and Roth, F and Kolbe, M and Gottwald, A and Hoppe, H and Richter, M} } @Proceedings { ManninenKML2016, title = {Methods for characterization and minimization of microwave background in cryogenic environment}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, keywords = {Cryogenics, microwave filters, metrology, single electron transistors}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, DOI = {10.1109/CPEM.2016.7540789}, stag_bib_extends_levelofaccess = {NA}, author = {Manninen, A. and Kemppinen, A. and Mykk{\"a}nen, E. and Lehtinen, J. S.} } @Article { KielerMNBO2016, title = {Packaging of fiber-coupled module for Josephson junction array voltage standards}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, keywords = {Optical fibers, Photodiodes, Silicon, Cryogenics, Bonding, Stress, Flip-chip devices}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, DOI = {10.1109/CPEM.2016.7540561}, stag_bib_extends_levelofaccess = {NA}, author = {Kieler, O. and Malmbekk, H. and Tuan Nguyen, T.A. and Bardalen, E. and Ohlckers, P.} } @Article { GiuscaSPZCMSK2016, title = {Effects of humidity on the electronic properties of graphene prepared by chemical vapour deposition}, journal = {Carbon}, year = {2016}, month = {7}, volume = {103}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {273-280}, keywords = {Chemical vapour deposition, Graphene, Kelvin probe force microscopy, Raman spectroscopy}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {New York, USA}, language = {30}, DOI = {10.1016/j.carbon.2016.03.018}, stag_bib_extends_levelofaccess = {NA}, author = {Giusca, Christina E. and Spencer, Steve and Panchal, Vishal and Zurutuza, Amaia and Centeno, Alba and Melios, Christos and Silva, S. Ravi P. and Kazakova, Olga} } @Article { MerimaaWWMJGKNTLHLGP2016, title = {Frequency Comparison of171Yb+Ion Optical Clocks at PTB and NPL via GPS PPP}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2016}, month = {7}, volume = {63}, number = {7}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {981-985}, keywords = {Frequency transfer, GPS precise point positioning (PPP), optical clock}, web_url = {https://ieeexplore.ieee.org/document/7398135/keywords}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2016.2524988}, stag_bib_extends_levelofaccess = {NA}, author = {Merimaa, M. and Wallin, A. and Whibberley, P. B. and Margolis, H. S. and Jones, J. M. and Godun, R. M. and King, S. A. and Nisbet-Jones, P. B. R. and Tamm, C. and Lipphardt, B. and Huntemann, N. and Leute, J. and Gill, P. and Peik, E.} } @Proceedings { , title = {Realization of Quantum Hall Effect in Closed Cycle Refrigerators}, journal = {Conference Digest}, year = {2016}, month = {7}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {2}, keywords = {Cryogen-free, measurement standards, quantum Hall effect, graphene, resistance}, web_url = {http://cpem2016.com/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Danvers}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9133-7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Kučera, J. and Š{\'i}ra, M. and Svoboda, P. and Kaštil, J.} } @Proceedings { , title = {Characterisation of Artificial and Natural Defects in Fibre Reinforced Plastics Designed for Energy Applications Using Active Thermography}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Composite Materials}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-9}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we2i4.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Maierhofer, CM and Krankenhagen, RK and R{\"o}llig, MR and Riemer, SR and Gower, MG and Baker, GB and Lodeiro, ML and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Adibekyan, AA and Gutschwager, BG} } @Proceedings { , title = {Design and manufacture of reference and natural defect artefacts for the evaluation of NDE techniques for fibre reinforced plastic (FRP) composites in energy applications}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Composite Materials}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-10}, keywords = {Infrared Testing (IRT), Ultrasonic Testing (UT), Visual and Optical Testing (VT/OT), Other Methods, delamination, validation, carbon fiber reinforced plastic (CFRP), Glass Fiber Reinforced Plastic (GFRP), tensile load, flat bottom hole}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we1e4.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gower, MG and Lodeiro, ML and Aktas, AA and Shaw, RS and Maierhofer, CM and Krankenhagen, RK and Augustin, SA and R{\"o}llig, MR and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Judaschke, RJ and Segur, DS} } @Proceedings { StyblikovaKHPD2016, title = {Use of a nanocrystalline core for a precise non-invasive AC current measurement}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, keywords = {AC current sensor, nanocrystalline material, non-invasive measurement, phase displacement, ratio error.}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Ottawa, ON, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540492}, stag_bib_extends_levelofaccess = {NA}, author = {Styblikova, R. and Knenicky, M and Hlavacek, J. and Prochazka, R. and Draxler, K.} } @Proceedings { OliveiraNKRVNHHT2016, title = {Geometric and Reflectance Signature Characterization of Complex Canopies using Hyperspectral Stereoscopic Images from UAV and Terrestrial Platforms}, journal = {ISPRS - International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences}, year = {2016}, month = {6}, day = {17}, volume = {XLI-B7}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {77-82}, keywords = {Hyperspectral, Radiometry, Photogrammetry, Geometry, Matching, Uncertainty}, web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B7/77/2016/isprs-archives-XLI-B7-77-2016.pdf}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, address = {Gottingen}, event_place = {Prague, Czech Republic}, event_name = {XXIII ISPRS Congress}, event_date = {12-07-2016 to 19-07-2016}, language = {30}, ISSN = {2194-9034}, DOI = {10.5194/isprsarchives-XLI-B7-77-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Oliveira, R. and N{\"a}si, R. and Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Nevalainen, O. and Hakala, T. and Honkavaara, E. and Tommaselli, A.} } @Proceedings { , title = {Development of a novel high precision Large Range Small Angle Generator}, journal = {Proceedings of the 16th International Conference of the European Society for Precision Engineering and Nanotechnology}, year = {2016}, month = {6}, day = {3}, volume = {1}, number = {1}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-2}, keywords = {Angle, angle metrology, small angle generator, SAG, autocollimator, calibration, Robert´s mechanism}, web_url = {http://www.euspen.eu/events/16th-international-conference-exhibition/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {euspen}, address = {Cranfield, Bedfordshire, MK43 0AL, United Kingdom}, event_place = {Nottingham, UK.}, event_name = {Cranfield, Bedfordshire, MK43 0AL, United Kingdom}, event_date = {30 May – 3 June 2016}, language = {30}, ISBN = {9780956679086}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.euspen.eu/events/16th-international-conference-exhibition/}, author = {Olarra, A and Delgado, A and Zubieta, M and Kortaberria, G and Prieto, E and Perez, MM and Morlanes, T} } @Article { SterrAKGHVL2016, title = {A transportable optical lattice clock}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {6}, volume = {723}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {012020}, keywords = {time and frequency metrology, transportable optical lattice clock, chronometric geodesy}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012020/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/723/1/012020}, stag_bib_extends_levelofaccess = {NA}, author = {Sterr, U. and Al-Masoudi, A. and Koller, S. and Grotti, J. and H{\"a}fner, S. and Vogt, S. and Lisdat, C.} } @Proceedings { , title = {Calibration and correction of a 6 degree of freedom piezo driven stage}, journal = {Proceedings of the 16th international conference of the european society for precision engineering and nanotechnology (euspen)}, year = {2016}, month = {5}, day = {30}, volume = {1}, number = {P1.59}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {2}, keywords = {6 degrees of freedom stage, calibration, parallel cinematics, nano-positioning, multi-axis correction model}, web_url = {http://www.euspen.eu/Library/ProceedingsPresentations.aspx}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {euspen}, address = {Bedford}, event_place = {Nottingham, UK}, event_name = {16th international conference of the european society for precision engineering and nanotechnology (euspen)}, event_date = {May 30th – 3rd June 2016}, language = {30}, ISBN = {978-0-9566790-8-6}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"u}ng, A. and Nicolet, A. and Meli, F.} } @Proceedings { , title = {A study of the reference impedance influence on a TRL calibration}, journal = {Proceedings 87th ARFTG Microwave Measurement Conference}, year = {2016}, month = {5}, day = {27}, volume = {n.a.}, number = {n.a.}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Network analysis, calibration, impedance, metrology.}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Danvers,}, event_place = {San Francisco}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {n.a.}, DOI = {10.1109/ARFTG.2016.7501969}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-1-1}, author = {Kuhlmann, K.} } @Article { , title = {Aperture alignment in autocollimator-based deflectometric profilometers}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2016}, month = {5}, day = {24}, volume = {87}, number = {051906 (2016)}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-9}, keywords = {Apertures, Calibration Charge coupled devices, Ray tracing, Optical aberrations}, web_url = {http://aip.scitation.org/doi/10.1063/1.4950734}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Institute of Physics}, address = {Melville, NY 11747-4300 USA}, language = {30}, ISSN = {Print: 0034-6748, Online: 1089-7623}, DOI = {10.1063/1.4950734}, extern = {1}, stag_bib_extends_fe_group = {55,59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Geckeler, R. D. and Artemiev, N. A. and Barber, S. K. and Just, A and Lacey, I. and Kranz, O and Smith, B. V. and Yaschckuk, V. V.} } @Article { , title = {Nonequilibrium thermodynamics of the spin Seebeck and spin Peltier effects}, journal = {Physical Review B}, year = {2016}, month = {5}, day = {18}, volume = {93}, number = {184421}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {184421-1-11}, keywords = {spincaloritronics, Spin-Seebeck, Spin-Peltier}, web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.93.184421}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {2469-9969 (online), 2469-9950 (print)}, DOI = {10.1103/PhysRevB.93.184421}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Basso, V. and Ferraro, E. and Magni, A. and Sola, A. and Kuepferling, M. and Pasquale, M.} } @Article { , title = {State of the Art of Tactile Micro Coordinate Metrology}, journal = {Appied Sciences}, year = {2016}, month = {5}, day = {16}, volume = {6}, number = {150}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, pages = {1-13}, keywords = {micro coordinate metrology, tactile probe, calibration, performance verification}, web_url = {http://www.mdpi.com/2076-3417/6/5/150}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {MDPI AG}, address = {Basel}, language = {30}, ISSN = {ISSN 2076-3417}, DOI = {10.3390/app6050150}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Thalmann, R. and Meli, F. and K{\"u}ng, A.} } @Article { KarkiWW2016, title = {Arts of electrical impedance tomographic sensing}, journal = {Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences}, year = {2016}, month = {5}, day = {16}, volume = {374}, number = {2070}, number2 = {ENG58: MultiFlowMet: Multiphase flow metrology in oil and gas production}, pages = {20150329}, keywords = {electrical impedance tomography, sensitivity, resolution matrix, regional imaging with limited measurements}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2070/20150329}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Royal Society}, address = {London}, language = {30}, ISSN = {1364-503X, 1471-2962}, DOI = {10.1098/rsta.2015.0329}, stag_bib_extends_levelofaccess = {NA}, author = {Karki, B. and Wang, Q. and Wang, M.} } @Thesis { , title = {Development of a Primary Method for the Calibration of Torque Transducers using Dynamic Excitations}, year = {2016}, month = {5}, day = {3}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, keywords = {dynamic torque, model parameter identification, dynamic calibration}, web_url = {https://public.ptb.de/resource/110.20160714}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, school = {Faculty of Mechanical Engineering of Gottfried Wilhelm Leibniz Universit{\"a}t Hannover}, language = {43}, ISBN = {978-3-95606-263-6}, ISSN = {0179-0595}, DOI = {10.7795/110.20160714}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klaus, L.} } @Article { SchraderKSGKS2016, title = {Near and Far Field Characterization of Planar mm-Wave Antenna Arrays with Waveguide-to-Microstrip Transition}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2016}, month = {4}, day = {12}, volume = {37}, number = {9}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {857-873}, keywords = {Phased patch antenna arrays, Radiation pattern measurements, Millimeter wave antenna design and characterization, Spherical far-field and planar near-field scanner, Near to far field transformation,}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Springer Nature}, address = {233 Spring St. Attn: Joerg Schreiber New York NY 10013 United States}, language = {30}, ISSN = {1866-6892, 1866-6906}, DOI = {10.1007/s10762-016-0273-x}, stag_bib_extends_levelofaccess = {NA}, author = {Schrader, T. and Kleine-Ostmann, T. and Spirito, M. and Gentille, G. and Kazemipour, A. and Salhi, M.A.} } @Article { , title = {Diffusion-induced grain boundary migration as mechanism for grain growth and defect annihilation in chalcopyrite thin films}, journal = {Acta Materialia}, year = {2016}, month = {4}, day = {10}, volume = {111}, number = {-}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {377-384}, keywords = {X-ray diffraction, Physical vapor deposition (PVD), Stacking faults, Grain boundary migration, CuInSe2}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier Ltd.}, address = {Amsterdam}, language = {30}, ISSN = {1359-6454}, DOI = {10.1016/j.actamat.2016.03.073}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Stange, H. and Brunken, S. and Greiner, D. and Heinemann, M. D. and Kaufmann, C. A. and Schmidt, S. S. and B{\"a}cker, J.-P. and Klaus, M. and Genzel, C. and Mainz, R.} } @Article { , title = {Investigation of the beam quality of a terahertz emitting vertical-external-cavity surface-emitting laser}, journal = {Journal of Infrared, Millimeter and Terahertz Waves}, year = {2016}, month = {4}, day = {4}, volume = {37}, number = {6}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {536-539}, keywords = {beam quality, Vertical-External-Cavity Surface-Emitting Laser}, web_url = {http://link.springer.com/article/10.1007\%2Fs10762-016-0274-9}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer}, address = {Cham, Switzerland}, language = {30}, ISSN = {1866-6892}, DOI = {10.1007/s10762-016-0274-9}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Zhang, Fan and Wang, Siming and Rehn, Arno and Wichmann, Matthias and Urbasch, Gunter and Rahimi-Iman, Arash and Koch, Stephan W. and Koch, Martin} } @Techreport { , title = {Conformance assessment of electrical energy meters investigated by risk analysis – a case study}, journal = {OIML BULLETIN}, year = {2016}, month = {4}, day = {1}, volume = {LVII}, number = {2}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, keywords = {-}, tags = {MAT}, web_url = {www.oiml.org/en/publications/bulletin/pdf/oiml_bulletin_april_2016.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Organisation Internationale de M{\'e}trologie L{\'e}gale}, address = {Paris}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.oiml.org/en/publications/bulletin/pdf/oiml_bulletin_april_2016.pdf}, author = {Karlsson, H. and Olsen, A.A.F. and Pendrill, L.R.} } @Proceedings { , title = {JRP SIB60 “Metrology for Long Distance Surveying”-a concise survey on major project results}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {March 30-April 1, 2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pollinger, F. and Bauch, A. and Leute, J. and Meiners-Hagen, K. and Mildner, J. and Guillory, J. and Wallerand, J.-P. and Jokela, J. and Kallio, U. and Koivula, H. and Lahtinen, S. and Poutanen, M. and Astrua, M. and Francese, C. and Zucco, M. and Eusebio, L. and Marques, F. and Pires, C. and Saraiva, F. and Pelligrino, O. and Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M. and Kupko, V. and Neyezhmakov, P. and Bergstrand, S. and van den Berg, S.A. and Kersten, T. and Krawinkel, T.} } @Proceedings { , title = {SI-Traceable High-Accuracy EDM based on Multi-Wavelength Interferometry}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {Submission 15}, keywords = {EDM, multi-wavelength interferometry, index of refraction, EMRP JRP SIB60 Surveying}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {30-03-2016 to 01-04-2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf}, author = {Pollinger, F. and Mildner, J. and K{\"o}chert, P. and Yang, R. and Bosnjakovic, A. and Meyer, T. and Wedde, M. and Meiners-Hagen, K.} } @Article { , title = {Potential of GPS Common Clock Single-differences for Deformation Monitoring}, journal = {Journal of Applied Geodesy}, year = {2016}, month = {3}, day = {31}, volume = {10}, number = {1}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {pages 45.52}, keywords = {GPS; Monitoring; Clock Modeling; Common Clock; EMRP JRP SIB60}, web_url = {https://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/reviewed/JISDM_2016_submission_101.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {De Gruyter}, language = {30}, ISSN = {(Online) 1862-9024, (Print) 1862-9016}, DOI = {10.1515/jag-2015-0029}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Sch{\"o}n, S. and Pham, H.K. and Kersten, T. and Leute, J. and Bauch, A.} } @Article { , title = {Investigations on the Influence of Antenna Near-field Effects and Satellite Obstruction on the Uncertainty of GNSS-based Distance Measurements}, journal = {Journal of Applied Geodesy}, year = {2016}, month = {3}, day = {31}, volume = {10}, number = {1}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {53-60}, keywords = {GNSS; Antenna Near-field Effects; Satellite Obstruction; EMRP JRP SIB60}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {De Gruyter}, language = {30}, ISSN = {(Online) 1862-9024, (Print) 1862-9016}, DOI = {10.1515/jag-2015-0026}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zimmermann, F. and Eling, C. and Kuhlmann, H.} } @Article { , title = {Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150044}, keywords = {high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150044}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0044}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wooliams, E.R and Anhalt, K and Ballico, M and Bloembergen, P and Bourson, F and Briaudeau, S and Campos, J and Cox, M.G and del Campo, D and Dong, W and Dury, M.R and Gavrilov, V and Grigoryeva, I and Hernanz, M.L and Jahan, F and Khlevnoy, B and Khromchenko, V and Lowe, D.H and Lu, X and Machin, G and Mantilla, J.M and Martin, M.J and McEvoy, H.C and Rougie, B and Saldi, M and Salim, S.G.R and Sasajima, N and Taubert, D.R and Todd, A.D.W and Van den Bossche, R} } @Article { , title = {A SQUID-based primary noise thermometer for low-temperature metrology}, journal = {Philos Trans A Math Phys Eng Sci}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1-16}, keywords = {PLTS-2000; SQUIDs; noise; primary thermometry; temperature scales}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/26903105}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {National Center for Biotechnology Information}, address = {Bethesda}, language = {30}, ISSN = {NA}, DOI = {10.1098/rsta.2015.0050.}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kirste, A and Engert, J} } @Article { , title = {Accurate Coulomb Blockade Thermometry up to 60 Kelvin}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1-7}, keywords = {primary thermometry, nano-fabrication, low temperature}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150052}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1098/rsta.2015.0052}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Meschke, M and Kemppinen, A and Pekola, J P} } @Article { HainsworthKHJ2016_2, subid = {380}, title = {The existence of a lateral size effect and the relationship between indentation and scratch hardness in copper}, journal = {Philosophical Magazine}, year = {2016}, month = {3}, day = {24}, volume = {96}, number = {32-34}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {3396-3413}, keywords = {Nano-scratch testing, nano-scratch hardness, lateral size effects}, web_url = {https://pure.coventry.ac.uk/ws/portalfiles/portal/10344470/Nigel_Jennett_Manuscript_revised.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1478-6435, 1478-6443}, DOI = {10.1080/14786435.2016.1146828}, stag_bib_extends_levelofaccess = {NA}, author = {Kareer, A. and Hou, X.D. and Jennett, N.M. and Hainsworth, S.V.} } @Article { , title = {What are the correct L-subshell photoionization cross sections for quantitative X-ray spectroscopy?}, journal = {X-ray Spectrometry}, year = {2016}, month = {3}, day = {16}, volume = {45}, number = {4}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {207–211}, keywords = {photoionization cross sections, xrs, fundamental parameters}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/xrs.2691/full}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {John Wiley \& Sons, Ltd}, language = {30}, ISSN = {1097-4539}, DOI = {10.1002/xrs.2691}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}nicke, P and Kolbe, M and Beckhoff, B} } @Article { NadvornikNSNNOJTKWJ2016, title = {Long-range and high-speed electronic spin-transport at a GaAs/AlGaAs semiconductor interface}, journal = {Scientific Reports}, year = {2016}, month = {3}, day = {16}, volume = {6}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {22901}, keywords = {Long-range and high-speed electronic spin-transport at a GaAs/AlGaAs semiconductor interface}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Nature}, address = {233 Spring St., New York NY 10013, USA}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep22901}, stag_bib_extends_levelofaccess = {NA}, author = {N{\'a}dvorn{\'i}k, L. and Němec, P. and Skoromets, V. and Němec, H. and Nov{\'a}k, V. and Olejn{\'i}k, K. and Janda, T. and Troj{\'a}nek, F. and Kužel, P. and Wunderlich, J. and Jungwirth, T.} } @Article { DryakKS2016, title = {Validation of Monte Carlo model of HPGe detector for field-station measurement of airborne radioactivity}, journal = {Journal of Instrumentation}, year = {2016}, month = {3}, day = {15}, volume = {11}, number = {03}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {P03015-P03015}, keywords = {Models and simulations; Dosimetry concepts and apparatus}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/11/03/P03015}, stag_bib_extends_levelofaccess = {NA}, author = {Dry{\'a}k, P. and Kov{\'a}ř, P. and Solc, J.} } @Article { , title = {Preparation and characterisation of an 57Fe enriched haemoglobin spike material for speciesspecific isotope dilution mass spectrometry}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, month = {3}, day = {10}, volume = {31}, number = {9}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1846 - 1857}, keywords = {isotope dilution mass spectrometry (IDMS), MonoQ® ion exchange chromatography, size exclusion column (SEC),high-performance liquid chromatography (HPLC) system}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00028B\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {0267-9477 (print) ; 1364-5544 (online)}, DOI = {10.1039/c6ja00028b}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brauckmann, C. and Frank, C. and Schulze, D. and Kaiser, P. and Stosch, R. and Swart, C.} } @Article { , title = {A virtual lateral standard for AFM calibraion}, journal = {Microelectronic Engineering}, year = {2016}, month = {3}, day = {5}, volume = {153}, number = {5 March 2016}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {pp 29-36}, keywords = {Nanoscale production; Lateral AFM calibration; Virtual standard; Traceability; Measurement uncertainty; Non-linearity}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.mee.2016.01.010}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Koops, R. and van Veghel, M. and van de Nes, A.} } @Article { KovarSLTMSHSS2016, title = {Distribution of radionuclides in an iron calibration standard for a free release measurement facility}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {96-100}, keywords = {246 kg reference standard, free release measurement facility, Distribution of radionuclides, iron calibration}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804315302396}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.11.010}, stag_bib_extends_levelofaccess = {NA}, author = {Kov{\'a}ř, P. and Šur{\'a}ň, J. and Lutter, G. and Tzika, F. and Marissens, G. and Stroh, H. and Hult, M. and Skala, L. and Sud, J.} } @Article { CapogniKDSI2016, title = {A novel method for the activity measurement of large-area beta reference sources}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {358-362}, keywords = {Method of measurement, Large area reference sources, Numerical model}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.12.030}, stag_bib_extends_levelofaccess = {NA}, author = {Capogni, M. and Keightley, J. and De Felice, P. and Stanga, D. and Ioan, M.R.} } @Article { , title = {Evaluation of comparison and proficiency test results of gamma ray spectrometry at Jožef Stefan Institute from 1986 to 2014}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {54-60}, keywords = {comparisons, proficiency tests, \(\zeta\)–score, high resolution gamma-ray spectrometry, environmental samples, radioactivity, natural and artificial radionuclides, Co-60, Cs-137, K-40, Ra-226}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804315303687}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier Ltd.}, language = {30}, DOI = {10.1016/j.apradiso.2015.12.025}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Glavič-Cindro, D. and Korun, M. and Nečemer, M. and Vodenik, B. and Zorko, B.} } @Article { , title = {Investigation of CVD graphene topography and surface electrical properties}, journal = {Surface Topography: Metrology and Properties}, year = {2016}, month = {2}, day = {29}, volume = {4}, number = {2}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {025001}, keywords = {graphene, Raman spectroscopy, Metrology, scanning probe microscopy techniques}, web_url = {http://iopscience.iop.org/article/10.1088/2051-672X/4/2/025001/pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {n/a}, DOI = {10.1088/2051-672X/4/2/025001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wang, R and Pearce, R and Gallop, J and Patel, T and Zhao, F and Pollard, A and Klein, N and Jackman, R and Zurutuza, A and Hao, L} } @Article { , title = {Dissemination of thermodynamic temperature above the freezing point of silver}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {2}, day = {22}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150043}, keywords = {high-temperature fixed points, thermodynamic temperature, filter radiometer, radiation thermometer}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150043}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0043}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sadli, M and Machin, G and Anhalt, K and Bourson, F and Biraudeau, S and del Campo, D and Diril, A and Kozlova, O and Lowe, D.H and Mantilla Amor, J.M and Martin, M.J and McEvoy, H.C and Ojanen-Saloranta, M and Pehlivan, {\"O} and Rougi{\'e}, B and Salim, S.G.R} } @Article { NeumaierDK2016, title = {Development and characterization of scintillation based detectors for the use in radiological early warning networks}, journal = {Journal of Instrumentation}, year = {2016}, month = {2}, day = {18}, volume = {11}, number = {02}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {C02055}, keywords = {Radiation monitoring, dosimetry concepts, dosimetry apparatus}, misc2 = {EMRP A169: Call 2013 Environment II}, language = {30}, DOI = {10.1088/1748-0221/11/02/C02055}, stag_bib_extends_levelofaccess = {NA}, author = {Neumaier, S. and Dombrowski, H. and Kessler, P.} } @Article { ChebenDKVNV2016, subid = {578}, title = {Mid-Infrared Silicon-on-Insulator Fourier-Transform Spectrometer Chip}, journal = {IEEE Photonics Technology Letters}, year = {2016}, month = {2}, day = {15}, volume = {28}, number = {4}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {528-531}, keywords = {mid-IR, spectrometry, silicon photonics}, web_url = {http://hdl.handle.net/10261/167745}, web_url2 = {https://dx.doi.org/10.5258/SOTON/383407}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, language = {30}, ISSN = {1041-1135, 1941-0174}, DOI = {10.1109/LPT.2015.2496729}, stag_bib_extends_levelofaccess = {NA}, author = {Nedeljkovic, Milos and Velasco, Aitor V. and Velasco, Aitor V. and Khokhar, Ali Z. and Delage, Andre and Cheben, Pavel} } @Article { MyersWardCMLGPGK2016, title = {Atmospheric doping effects in epitaxial graphene: correlation of local and global electrical studies}, journal = {2D Materials}, year = {2016}, month = {2}, volume = {3}, number = {1}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {015006}, keywords = {mono-, bi- and tri-layer epitaxial graphene, 6H–SiC(0001), measurements, Kelvin, N2, O2, NO2, doping effects,epitaxial graphene}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Bristol, United Kingdom}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/3/1/015006}, stag_bib_extends_levelofaccess = {NA}, author = {Myers-Ward, Rachael L and Cassidy, Nathan and Martin, Nicholas A and Lartsev, Arseniy and Giusca, Cristina E and Panchal, Vishal and Gaskill, D Kurt and Kazakova, Olga} } @Article { PoletaeffBPOKZA2016, title = {Improvement of LISN Measurement Accuracy Based on Calculable Adapters}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2016}, month = {2}, volume = {65}, number = {2}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {365-377}, keywords = {Improvement of LISN Measurement Accuracy Based on Calculable Adapters}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2479107}, stag_bib_extends_levelofaccess = {NA}, author = {Poletaeff, Andr{\'e} and B{\'e}li{\`e}res, Denis and Pinter, Borut and Ouameur, Mohamed and Kokalj, Miha and Ziade, Francois and Allal, Djamel} } @Article { EomJKKK2016_3, title = {Absolute angle measurement using a phase-encoded binary graduated disk}, journal = {Measurement}, year = {2016}, month = {2}, volume = {80}, number2 = {SIB58: Angles: Angle metrology}, pages = {288-293}, keywords = {Absolute angle measurement, Angle encoder, Graduated disk, Absolute position binary code, Nonlinearity error}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2015.11.037}, stag_bib_extends_levelofaccess = {NA}, author = {Eom, T.B. and Jin, J. and Kang, C.S. and Kim, J.W. and Kim, J.A.} } @Article { , title = {A folded‑sandwich polarization‑entangled two‑color photon pair source with large tuning capability for applications in hybrid quantum systems}, journal = {Applied Physics B}, year = {2016}, month = {1}, day = {30}, volume = {122}, number = {February 2016}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {33}, keywords = {Entangled Photons Source, Quantum Hybrid Systems}, web_url = {https://link.springer.com/article/10.1007/s00340-015-6275-x}, web_url2 = {http://link.springer.com/journal/340}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer-Verlag}, address = {Berlin Heidelberg}, language = {30}, ISSN = {1432-0649}, DOI = {10.1007/s00340-015-6275-x}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dietz, O. and M{\"u}ller, C. and Krei{\ss}l, T. and Herzog, U. and Kroh, T. and Ahlrichs, A. and Benson, O.} } @Proceedings { MonteBKALBGRRKMAG2016, title = {Characterisation of artificial defects in CFRP and GFRP sheets designed for energy applications using active thermography}, journal = {Proceedings of the 2016 International Conference on Quantitative InfraRed Thermography}, year = {2016}, month = {1}, day = {16}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, keywords = {Characterisation artificial defects CFRP and GFRP active thermography}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {QIRT Council}, address = {1065 ave. de la Medecine Quebec City Quebec G1V 0A6 Canada}, event_place = {Gdansk}, event_name = {QIRT 16}, event_date = {04-07-2016 to 08-07-2016}, language = {30}, DOI = {10.21611/qirt.2016.076}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Blahut, A. and Knazovicka, L. and Aktas, A. and Lodeiro, M. and Baker, G. and Gower, M. and Rehmer, B. and R{\"o}llig, M. and Krankenhagen, R. and Maierhofer, C. and Adibekyan, A. and Gutschwager, B.} } @Article { , title = {Markov chain Monte Carlo methods: an introductory example}, journal = {Metrologia}, year = {2016}, month = {1}, day = {13}, volume = {53}, number = {1}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {32-39}, keywords = {MCMC, Metropolis–Hastings, Monte Carlo, Bayesian statistics, high-dimensional integration, proposal distribution, convergence diagnostics}, tags = {MAT}, web_url = {-}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {BIPM}, address = {S{\`e}vres}, language = {30}, ISSN = {-}, DOI = {10.1088/0026-1394/53/1/S32}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klauenberg, K. and Elster, C.} } @Article { , title = {Electron beam controlled covalent attachment of small organic molecules to graphene}, journal = {Nanoscale}, year = {2016}, month = {1}, day = {4}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {2711-2719}, keywords = {graphene, polyaromatic molecules, measurement}, web_url = {http://pubs.rsc.org/en/content/articlehtml/2016/nr/c5nr07539d}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {The Royal Society of Chemistry}, language = {30}, DOI = {10.1039/C5NR07539D}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Markevich, A. and Kurasch, S. and Lehtinen, O. and Reimer, O. and Feng, X. and M{\"u}llen, K. and Turchanin, A. and Khlobystov, A. N. and Kaiser, U. and Besley, E.} } @Techreport { TerauchiKSBWWADGAAHUWSJKKFSBSS2016, subid = {415}, title = {Final report of CCQM-K129 'Measurement of Mole Fractions of Cu, In, Ga and Se in Cu(In,Ga)Se2 Films}, journal = {Metrologia}, year = {2016}, month = {1}, volume = {53}, number = {1A}, number2 = {14SIP05: TF-STANDARD: Developing a Standard for Valid Methodology for the Characterisation of Functional Alloy Thin Films}, pages = {08011-08011}, keywords = {CIGS, Cu(In,Ga)Se2, mole fractions, key comparison CCQM-K129}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1A/08011\&\#10;https://www.bipm.org/utils/common/pdf/final_reports/QM/K129/CCQM-K129.pdf}, misc2 = {EMPIR 2014: Support for Impact}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/1A/08011}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, A.S. and Kim, K.J. and Jang, J.S. and Suh, J.K. and Wirth, T. and Unger, W. and Hodoroaba, V.D. and Araujo, J.R. and Archanjo, B.S. and Galhardo, C.E. and Damasceno, J. and Achete, C.A. and Wang, H. and Wang, M. and Bennett, J. and Simon, D. and Kurokawa, A. and Terauchi, S. and Fujimoto, T. and Streeck, C. and Beckhoff, B. and Spencer, S. and Shard, A.} } @Article { SilvaSSSMK2016, title = {Surface and interface structure of quasi-free standing graphene on SiC}, journal = {2D Materials}, year = {2016}, volume = {3}, number = {2}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {025023}, keywords = {intercalated graphene, Kelvin probe force microscopy, x-ray photoelectron spectroscopy, surface enhanced Raman scattering, Raman spectroscopy}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP science}, address = {Bristol, United Kingdom}, language = {30}, DOI = {10.1088/2053-1583/3/2/025023}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, S R P and Strupinski, W and Shard, A and Spencer, S and Melios, C and Kazakova, O} } @Article { WeichertBFKKWK2016, title = {Implementation of straightness measurements at the Nanometer Comparator}, journal = {CIRP Annals - Manufacturing Technology}, year = {2016}, volume = {65}, number = {1}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {507-510}, keywords = {Measurement, Straightness, Error Separation}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, address = {New York, USA}, language = {30}, ISSN = {0007-8506}, DOI = {10.1016/j.cirp.2016.04.070}, stag_bib_extends_levelofaccess = {NA}, author = {Weichert, Christoph and Bosse, Harald and Fl{\"u}gge, Jens and K{\"o}ning, Rainer and K{\"o}chert, Paul and Wiegmann, Axel and Kunzmann, Horst} } @Article { , title = {The influence of some relevant metallic impurities in the triple point of mercury temperature}, journal = {Metrologia}, year = {2016}, volume = {53}, number = {1}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {51-60}, keywords = {Triple point of mercury, ITS-90, impurities, uncertainty, liquidus slope, phase change, phase diagram}, web_url = {http://iopscience.iop.org/0026-1394/53/1/51}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, Bureau International des Poids et Mesures}, address = {Bristol}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/0026-1394/53/1/51}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tabacaru, C. and del Campo, D. and G{\'o}mez, E. and Garc{\'i}a Izquierdo, C. and Welna, A. and Kalemci, M. and Pehlivan, {\"O}} } @Article { , title = {Experimental assessment of the speed of light perturbation in free-fall absolute gravimeters}, journal = {Metrologia}, year = {2016}, volume = {52}, number = {Oct}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {635–645}, keywords = {speed of light perturbation, absolute gravimeters, gravimetry, watt balance, SI}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/635}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institute of Physics}, address = {Bristol (UK)}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/52/5/635}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Baumann, H and Pythoud, F and Blas, D and Sibiryakov, S and Eichenberger, A and Klingel{\'e}, E E} } @Article { , title = {Infrared mapping of ultrasound fields generated by medical transducers: Feasibility of determining absolute intensity levels.}, journal = {Journal of the Acousticla Society of America}, year = {2016}, volume = {134}, number = {2}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1586–1597}, keywords = {ultrasound, infrared, intensity, thermal imaging, exposimetry}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Acoustical Society of America.}, address = {New York}, language = {30}, ISSN = {0001-4966}, DOI = {10.1121/1.4812878}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-3-1}, author = {Khokhlova, VA and Shmeleva, SM and Gavrilov, LR and Martin, E and Sadhoo, N and Shaw, A} } @Article { , title = {Annihilation of structural defects in chalcogenide absorber films for high-efficiency solar cells}, journal = {Energy \& Environmental Science}, year = {2016}, volume = {9}, number = {5}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1818-1827}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, XRD, XRF, in-situ, planar defects, TEM}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {1754-5692}, DOI = {10.1039/c6ee00402d}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-18}, author = {Mainz, R. and Simsek Sanli, E. and Stange, H. and Azulay, D. and Brunken, S. and Greiner, D. and Hajaj, S. and Heinemann, M. D. and Kaufmann, C. A. and Klaus, M. and Ramasse, Q. M. and Rodriguez-Alvarez, H. and Weber, A. and Balberg, I. and Millo, O. and van Aken, P. A. and Abou-Ras, D.} } @Article { KarhaIVB2016, title = {Temperature invariant energy value in LED spectra}, journal = {Applied Physics Letters}, year = {2016}, volume = {109}, number = {23}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {231103}, keywords = {band gap, III-V optosemiconductors}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Institute of Physics}, language = {30}, DOI = {10.1063/1.4971831}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}rh{\"a}, P. and Ikonen, E. and Vaskuri, A. and Baumgartner, H.} } @Article { , title = {Time-Frequency Diversity for Solving the Deadlock in Defining Interference Levels in Power Lines}, journal = {Proceedings of the 2016 International Symposium on EMC (EMC Europe) Wroclaw, Poland}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-6}, keywords = {electromagnetic interference; power line telecommunication; narrow-band frequency; cyclic short-time}, web_url = {http://www.emceurope.org/2016/program.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Not yet available}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Setiawan, I. and Keyer, C.H. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Drawbacks of a medium sized, grid coupled Photo Voltaic Array}, journal = {Proceedings of the 2016 International Conference on Renewable Energies and Power Quality (ICREPQ), Madrid, Spain, 2016}, year = {2016}, volume = {N.A.}, number = {14}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-4}, keywords = {Photo voltaic array, apparent power, real power, reactive power fine.}, web_url = {http://www.icrepq.com/re\&pqj/RE\&PQJ\%2714-Index.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Renewable Energy \& Power Quality Journal (RE\&PQJ) European Association for the Development of Renewable Energies, Environment and Power Quality, Reg.No. 169208}, address = {Vigo, Spain}, language = {30}, ISSN = {2172-038X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Keyer, C.H. and Setiawan, I. and Leferink, F.B.J. and Buesink, Frits} } @Article { , title = {Mains Power Synchronous Conducted Noise Measurement in the 2 to 150 kHz band}, journal = {Proceedings of the 2016 International Symposium on EMC (EMC Europe) Wroclaw, Poland}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-5}, keywords = {Live measurement, mains, education, common mode, differential mode, wave form}, web_url = {http://www.emceurope.org/2016/program.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Not yet available}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {978-1-5090-1416-3/16/$31.00 ©2016 IEEE}, author = {Keyer, C.H. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Time-domain Measurement Technique to Analyze Cyclic Short-Time Interference in Power Supply Networks}, journal = {Proceedings of the 2016 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Shenzhen, China}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {279-282}, keywords = {electromagnetic compatibility; time-domain measurement; spectrogram; power mains noise and interference}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Unknown}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Setiawan, I. and Keyer, C.H. and Azpurua, M. and Silva, F. and Leferink, F.B.J.} } @Article { , title = {Analysis of a liquid sample residue using in situ alpha spectrometry}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2016}, volume = {307}, number = {1}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {747-750}, keywords = {Liquid sample, sample processing, evaporation residue, in-situ alpha spectrometry, spectrum unfolding}, web_url = {http://link.springer.com/article/10.1007/s10967-015-4103-8}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Springer Netherlands}, address = {Akad{\'e}miai Kiad{\'o} Zrt., Budapest, Hungary}, language = {30}, ISSN = {0236-5731}, DOI = {10.1007/s10967-015-4103-8}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {P{\"o}ll{\"a}nen, R. and Klemola, S.} } @Proceedings { , title = {Series arrays of NbSi barrier Josephson junctions for AC voltage standards}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest}, year = {2016}, volume = {n / a}, number = {n / a}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {7540562 (2 pp.)}, keywords = {AC Josephson voltage standards, binary-divided Josephson series arrays, NbSi barrier Josephson junctions, pulse-driven Josephson series arrays, SNS Josephson junctions}, web_url = {http://ieeexplore.ieee.org/document/7540562/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {Electronic ISSN: 2160-0171}, DOI = {10.1109/CPEM.2016.7540562}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540562/}, author = {Kohlmann, J. and Kieler, O. and Scheller, T. and Egeling, B. and Wendisch, R. and Behr, R.} } @Proceedings { , title = {Numerical method for calculation of transfer matrix for non typical adapters used for calibration of EMC devices}, journal = {ERK 2015}, year = {2016}, volume = {Volume A}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {273-276}, keywords = {EMC, adapter, LISN}, web_url = {http://www.ieee.si/erk/erk15.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {24th International Electrotechnical and Computer Science Conference ERK 2015}, address = {Portorož}, event_place = {Portorož}, event_name = {24th International Electrotechnical and Computer Science Conference ERK 2015}, event_date = {21-9-2015 to 23-9-2015}, language = {110}, ISSN = {1581-4572}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kokalj, M. and Voljč, B. and Pinter, B. and Lindič, M. and Svetik, Z. and Kokalj, Miha} } @Proceedings { , title = {Intercomparison of PTB and ESTI Spectroradiometers Using Simulated and Natural Sunlight}, journal = {Proceedings of the 32nd European PV Solar Energy Conference and Exhibition ( 32nd EU PVSEC)}, year = {2016}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {2230 - 2233}, keywords = {Calibration, Spectroradiometer, Solar Simulator, Characterisation, Characterization, Intercomparison}, web_url = {http://www.eupvsec-proceedings.com/proceedings?paper=36762}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Munich, Germany}, event_name = {32nd European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {20-24 June 2016}, language = {30}, ISBN = {3-936338-41-8}, DOI = {10.4229/EUPVSEC20162016-5BV.4.20}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kroeger, I. and Galleano, R. and Plag, F. and Muellejans, H. and Winter, S.} } @Proceedings { , title = {Investigation of UV-Induced Degradation of Different Types of WPVS Reference Solar Cells}, journal = {Proceedings of the 32nd European PV Solar Energy Conference and Exhibition ( 32nd EU PVSEC)}, year = {2016}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {2277 - 2281}, keywords = {Calibration, Degradation, Encapsulation, Durability, Characterisation, Characterization}, web_url = {https://www.eupvsec-proceedings.com/proceedings?paper=37311}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Munich, Germany}, event_name = {32nd European Photovoltaic Solar Energy Conference and Exhibition (EU PVSEC 2016)}, event_date = {20-24 June 2016}, language = {30}, ISBN = {3-936338-41-8}, DOI = {10.4229/EUPVSEC20162016-5BV.4.34}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kroeger, I. and Hohl-Ebinger, J. and Brachmann, S. and Winter, S.} } @Proceedings { , title = {Investigation of the Influence of Temperature Inhomogeneity on the Measurement Uncertainty of Solar Cell Temperature Coefficients}, journal = {Proceedings of the 32nd European PV Solar Energy Conference and Exhibition ( 32nd EU PVSEC)}, year = {2016}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {2200 - 2203}, keywords = {calibration, characterization, spectral responsivity}, web_url = {http://www.eupvsec-proceedings.com/proceedings?paper=39495}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Munich, Germany}, event_name = {32nd European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {20-24 June 2016}, language = {30}, ISBN = {3-936338-41-8}, DOI = {10.4229/EUPVSEC20162016-5BV.4.10}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Schweitzer, A. and Kroeger, I. and Winter, S.} } @Proceedings { , title = {COMPREHENSIVELY CHARACTERIZED SOLAR CELLS: IMPACT OF ANGULAR, SPECTRAL, AND NON-LINEAR EFFECTS}, journal = {Proceedings of the 32nd European PV Solar Energy Conference and Exhibition ( 32nd EU PVSEC)}, year = {2016}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {1711 - 1715}, keywords = {Characterisation, Energy Rating, Experimental Methods, Performance, Simulation}, web_url = {http://www.eupvsec-proceedings.com/proceedings?paper=38532}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Munich, Germany}, event_name = {32nd European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {20-24 June 2016}, language = {30}, ISBN = {3-936338-41-8}, DOI = {10.4229/EUPVSEC20162016-5DO.11.3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Fey, T. and Kroeger, I. and Witt, F. and Winter, S.} } @Proceedings { , title = {Moisture measurement setup for wood based materials and biomasses}, journal = {International Congress of Metrology 08008 (2015)}, year = {2016}, volume = {International Congress of Metrology 08008 (2015)}, number = {International Congress of Metrology 08008 (2015)}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {4}, keywords = {moisture, biomass, loss-on-drying, SI traceability}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08008.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {17th International Congress of Metrology, 08008 (2015)}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/20150008008}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ojanen-Saloranta, M. and Sairanen, H. and Salminen, J. and Kajastie, H. and Heinonen, M.} } @Proceedings { , title = {First metrological applications of the PTB 1 V Josephson Arbitrary Waveform Synthesizer}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {153}, keywords = {Josephson arbitrary waveform synthesizer comparison thermal converter ac-dc transfer difference}, web_url = {http://ieeexplore.ieee.org/document/7540602/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, DOI = {10.1109/CPEM.2016.7540602}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Palafox, L and Behr, R and Kieler, O and Lee, J and Budovsky, I and Bauer, S and Hagen, T} } @Proceedings { , title = {Tests on waveform synthesis in a new cryocooler setup}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, volume = {10.1109/CPEM.2016.7540563}, number = {10.1109/CPEM.2016.7540563}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {voltage measurement, coaxial cables, cooling, cryogenics, Josephson effect, measurement standards}, web_url = {http://ieeexplore.ieee.org/abstract/document/7540563/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa}, event_name = {CPEM16}, event_date = {10-15 July 2016}, language = {30}, ISBN = {978-1-4673-9134-4, 978-1-4673-9135-1, 978-1-4673-9132-0}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540563}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SOSSO, A and Trinchera, B and Durandetto, P and Monticone, E and Kieler, O and Behr, R and Kohlmann, J} } @Article { , title = {Characterization of a Josephson array for pulse-driven voltage standard in a cryocooler}, journal = {Measurement}, year = {2016}, volume = {95}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {77–81}, keywords = {Josephson effect; Quantum voltage standard; Quantum waveform synthesis; Measurement techniques; Measurement uncertainty; Precision measurements; Uncertainty}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116305425}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {Amsterdam, The Netherlands}, language = {30}, ISSN = {http://dx.doi.org/10.1016/j.measurement.2016.09.039}, DOI = {10.1016/j.measurement.2016.09.039}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SOSSO, A and Durandetto, P and Trinchera, B and Kieler, O and Behr, R and Kohlmann, J} } @Proceedings { , title = {Implementation of an impedance bridge based on pulse-driven Josephson arrays for arbitrary impedance ratios and phase angles}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, keywords = {Bridge circuits, Impedance, Impedance measurement, Frequency measurement, Temperature measurement, Resistors, Standards}, web_url = {http://ieeexplore.ieee.org/document/7540626/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540626}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Bauer, S and Behr, R and Hagen, T and Kieler, O and Palafox, L and Schurr, J} } @Article { , title = {The role of acoustic nonlinearity in tissue heating behind a rib cage using a high-intensity focused ultrasound phased array}, journal = {PHYSICS IN MEDICINE AND BIOLOGY}, year = {2016}, volume = {58}, number = {2013}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {2537–2559}, keywords = {HIFU, ultrasound surgery, ribs, nonlinear propagation, focusing, diffraction, shock heating}, web_url = {http://iopscience.iop.org/article/10.1088/0031-9155/58/8/2537/pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP PUBLISHING}, address = {Bristol, Tokyo, Philadelphia, Beijing}, language = {30}, ISSN = {1088/0031}, DOI = {10.1088/0031-9155/58/8/2537}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yuldashev, P V and Shmeleva, S M and Ilyin, S A and Sapozhnikov, O A and Gavrilov, L R and Khokhlova, V A} } @Article { , title = {In vivo synthesized 34S enriched amino acid standards for species specific isotope dilution of proteins}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, volume = {2016}, number = {31}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1830-1835}, keywords = {characterization of protein standards,protein hydrolysis, amino acid quantification,species specific isotope dilution analysis (IDA),Reverse isotope dilution mass spectrometry (IDMS),plasma mass spectrometry (ICP-MS),cysteic acid,methionine sulfone, lysozyme standards, ceruloplasmin standards}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {The Royal Society of Chemistry}, address = {Cambridge, United Kingdom}, language = {30}, DOI = {10.1039/c6ja00039h}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hermann, Gerrit and Hyrup M{\o}ller, Laura and Gammelgaard, Bente and Hohlweg, Jonas and Mattanovich, Diethard and Hann, Stephan and Koellensperger, Gunda} } @Proceedings { , title = {Comparison of the frequency dependence of capacitance ratios between LNE and PTB}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, keywords = {Impedance bridge, Josephson array, Josephson impedance bridge}, web_url = {http://ieeexplore.ieee.org/document/7540585/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540585}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Hagen, T and Th{\'e}venot, O and S{\'e}ron, O and Khan, S and Palafox, L and Behr, R} } @Article { , title = {Development of a programmable small capacitance standard at LNE}, journal = {Conference on Precision Electromagnetic Measurements Digest 2016}, year = {2016}, volume = {2016}, number = {2016}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {388-389}, keywords = {Capacitance measurements, multiplexer, small capacitance standard, capacitance bridge}, web_url = {https://www.eiseverywhere.com/retrieveupload.php?c3VibWlzc2lvbl8xMjc4NzJfNzkxODg4LnBkZiplc2VsZWN0}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {CPEM}, address = {Ottawa}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540611}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {KHAN, Mohammad Saif khan and Seron, Olivier Seron and Thuillier, Ga{\"e}l Thuillier and Th{\'e}venot, Olivier Th{\'e}venot} } @Article { , title = {Metrological challenges for measurements of key climatological observables: oceanic salinity and pH, and atmospheric humidity. Part 1: overview}, journal = {Metrologia}, year = {2016}, volume = {53}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {R1-R11}, keywords = {seawater salinity, seawater pH, relative humidity, traceability}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1/R1}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Physics}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/1/R1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Feistel, R and Wielgosz, R and Bell, S A and Cam{\~o}es, M F and Cooper, J R and Dexter, P and Dickson, A G and Fisicaro, P and Harvey, A H and Heinonen, M and Hellmuth, O and Kretzschmar, H-J and Lovell-Smith, J W and McDougall, T J and Pawlowicz, R and Ridout, P and Seitz, S and Spitzer, P and Stoica, D and Wolf, H} } @Article { , title = {Reassessing changes in diurnal temperature range: A new data set and characterization of data biases}, journal = {Journal of Geophysical Research: Atmospheres}, year = {2016}, volume = {121}, number = {10}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {5115–5137}, keywords = {diurnal temperature range, data set, reassessment}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/2015JD024583/abstract}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley}, address = {Hoboken}, language = {30}, ISSN = {2169-897X}, DOI = {10.1002/2015JD024583}, extern = {1}, stag_bib_extends_fe_group = {79,59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Thorne, P W and Menne, M J and Williams, C N and Rennie, J J and Lawrimore, J H and Vose, R S and Petersono, T C and Durre, I and Davy, R and Esau, I and Klein-Tank, A M G and Merlone, A} } @Techreport { IlanderCBKP2016, subid = {106}, title = {Acceptance of the proposal for a new international standard for list-mode data used in nuclear instrumentation}, journal = {JRC Technical reports}, year = {2016}, volume = {JRC100968}, number = {JRC100968}, number2 = {14SIP07: Digital Standard: Standard for Digital Data Format for Nuclear Instrumentation}, pages = {14}, keywords = {Nuclear metrology, International standard, Nuclear safety and security}, misc2 = {EMPIR 2014: Support for Impact}, publisher = {Publications Office of the European Union}, address = {Brussels}, language = {30}, ISBN = {978-92-79-57550-1}, ISSN = {1831-9424}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://publications.jrc.ec.europa.eu/repository/handle/JRC100968}, author = {Ilander, Tarja and Capogni, Marco and Bobin, Christophe and Keightley, John and Paepen, Jan} } @Article { , title = {Traceable methods for vertical scale characterization of dynamic stroboscopic scanning white-light interferometer measurements}, journal = {Applied Optics}, year = {2015}, month = {12}, day = {9}, volume = {54}, number = {35}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {10397-10403}, keywords = {Stroboscopic scanning white-light interferometry (SSWLI),3D imaging of oscillating samples,Traceability of the vertical displacement measurement, metrology, uncertainties}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-54-35-10397}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {OSA Publishing}, address = {Washington, D.C.}, language = {30}, ISSN = {n/a}, DOI = {10.1364/AO.54.010397}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-9}, author = {Heikkinen, V and Kassmakov, I and Sepp{\"a}, J and Paulin, T and Nolvi, A and Lassila, A and H{\ae}ggstr{\"o}m, E} } @Article { , title = {Technology for the next gravitational wave detectors}, journal = {SCIENCE CHINA Physics, Mechanics \& Astronomy}, year = {2015}, month = {12}, day = {4}, volume = {58}, number = {12}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {120404}, keywords = {gravitational waves, advanced techniques, thermal noise, coating, laser}, web_url = {http://link.springer.com/article/10.1007\%2Fs11433-015-5738-8}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Science China Press and Springer-Verlag}, address = {Berlin Heidelberg}, language = {30}, ISSN = {1674-7348}, DOI = {10.1007/s11433-015-5738-8}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {MITROFANOV, V and CHAO, S and PAN, H-W and KUO, L-C and COLE, G and DEGALLAIX, J and WILLKE, B} } @Article { , title = {Self-supporting graphene films and their applications}, journal = {IET Circuits, Devices \& Systems}, year = {2015}, month = {12}, day = {3}, volume = {9}, number = {6}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {420 - 427}, keywords = {thermal properties, atomic force microscopy, chemical vapour deposition, copper, foils, graphene, mechanical properties, micromechanical resonators, monolayers, scanning electron microscopy}, web_url = {http://ieeexplore.ieee.org/document/7339736/}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York CIty}, language = {30}, ISSN = {1751-858X}, DOI = {10.1049/iet-cds.2015.0149}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-3}, author = {Goniszewski, S and Gallop, J and Adabi, M and Gajewski, K and Shaforost, E and Klein, N and Sierakowski, A and Chen, J and Gotszalk, T and Chen, Y and Hao, L} } @Article { KralikBAVSS2015, title = {Measurement of secondary neutrons generated during proton therapy}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {12}, volume = {172}, number = {4}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {341-345}, keywords = {Secondary neutrons, proton therapy, Bonner Sphere Spectrometer}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv504}, stag_bib_extends_levelofaccess = {NA}, author = {Kr{\'a}l{\'i}k, M. and B{\'a}rtov{\'a}, H. and Andrl{\'i}k, M. and Vykydal, Z. and Solc, J. and Solc, J.} } @Article { , title = {Ion beam analysis of Cu(In,Ga)Se2 thin film solar cells}, journal = {Applied Surface Science}, year = {2015}, month = {11}, day = {30}, volume = {356}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {631–638}, keywords = {Thin solar Cu(In,Ga)Se2 cells, Ion beam analysis, RBS/PIXE techniques, Synchrotron GIXRF analysis, Depth profiling}, web_url = {http://ac.els-cdn.com/S0169433215019467/1-s2.0-S0169433215019467-main.pdf?_tid=cba9d288-1c21-11e6-9bf0-00000aab0f26\&acdnat=1463484395_b9279df87868924a41b103cfe0aeacf7}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, ISSN = {0169-4332}, DOI = {10.1016/j.apsusc.2015.08.133}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Karydas, AGK and Streeck, CS and Bogdanovic Radovic, IBR and Kaufmann, CK and Rissom, TR and Beckhoff, BB and Jakšic, MJ and Barradas, NPB} } @Article { SmerziSHAEPLKLPK2015, title = {Satisfying the Einstein–Podolsky–Rosen criterion with massive particles}, journal = {Nature Communications}, year = {2015}, month = {11}, day = {27}, volume = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {8984}, keywords = {quantum mechanics, entanglement, heisenberg limit}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms9984}, stag_bib_extends_levelofaccess = {NA}, author = {Smerzi, A. and Santos, L. and Hammerer, K. and Arlt, J. and Ertmer, W. and Pezz{\`e}, L. and L{\"u}cke, B. and Kruse, I. and Lange, K. and Peise, J. and Klempt, C.} } @Article { , title = {A clock network for geodesy and fundamental science}, journal = {Nature Communication}, year = {2015}, month = {11}, day = {24}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, web_url = {arxiv.org/abs/1511.07735}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and D{\"o}rscher, S. and H{\"a}fner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G.} } @Article { SzmyrkaGrzebykKG2015, title = {The basics of calibration procedure and estimation of uncertainty budget for meteorological temperature sensors}, journal = {Meteorological Applications}, year = {2015}, month = {11}, day = {24}, volume = {22}, number = {S1}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {867-872}, keywords = {calibration; uncertainty budget; temperature sensor}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Wiley}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1527}, stag_bib_extends_levelofaccess = {NA}, author = {Szmyrka-Grzebyk, A. and Kowal, A. and Grykałowska, A.} } @Article { , title = {Thermoelectric properties of currently available Au/Pt thermocouples related to the valid reference function}, journal = {Int. J. Metrol. Qual. Eng.}, year = {2015}, month = {11}, day = {23}, volume = {6}, number = {3}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {303}, keywords = {Au/Pt thermocouple, reference function, temperature scale}, web_url = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Dr. A. CHARKI}, address = {EDP Sciences - France 17, Avenue du Hoggar Parc d'Activit{\'e} de Courtabœuf BP 112 91944 Les Ulis Cedex A France}, language = {30}, DOI = {10.1051/ijmqe/2015016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, author = {Edler, F. and Arifovic, N. and Atance, G. and Dinu, C. and Elliott, C. J. and Izquierdo, C. G. and Hodzic, N. and Kalisz, S. and Pearce, J.V. and Simic, S. and Strnad, R. and Taubert, D.} } @Article { , title = {ELSTAB - fiber optic time and frequency distribution technology - a general characterization and fundamental limits}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2015}, month = {11}, day = {20}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, keywords = {fiber optics; time transfer; frequency transfer; delay stabilization}, misc2 = {EMRP A169: Call 2009 Energy}, language = {30}, DOI = {10.1109/TUFFC.2015.2502547}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Krehlik, P. and Śliwczyński, L. and Buczek, L. and Kolodziej, J. and Lipiński, M.} } @Article { , title = {A tutorial on Bayesian Normal linear regression}, journal = {Metrologia}, year = {2015}, month = {11}, day = {18}, volume = {52}, number = {6}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {878 - 892}, keywords = {Bayesian inference, prior knowledge, conjugate prior distribution, linear regression, Normal inverse Gamma distribution, Gaussian measurement error, sonic nozzle calibration}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/6/878/meta}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {BIPM}, address = {S{\`e}vres}, language = {30}, ISSN = {-}, DOI = {10.1088/0026-1394/52/6/878}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klauenberg, K. and Wuebbeler, G. and Mickan, B. and Harris, P. and Elster, C.} } @Article { , title = {Analysis of thermal radiation in ion traps for optical frequency standards}, journal = {Metrologia}, year = {2015}, month = {11}, day = {12}, volume = {52}, number = {6}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {842-856}, keywords = {blackbody radiation shift, ion traps, optical atomic clocks, ion clocks, thermal and high frequency finite element method modelling}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/6/842}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, BIPM}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/52/6/842}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Doležal, M and Balling, P and Nisbet-Jones, P B R and King, S A and Jones, J M and Klein, H A and Gill, P and Lindvall, T and Wallin, A E and Merimaa, M and Tamm, C and Sanner, C and Huntemann, N and Scharnhorst, N and Leroux, I D and Schmidt, P O and Burgermeister, T and Mehlst{\"a}ubler, T E and Peik, E} } @Proceedings { , title = {EUROPEAN RESEARCH PROJECT ON MICROFLOW MEASUREMENTS – MEDD}, year = {2015}, month = {11}, day = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {MEDD, microflow, measurements}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Washington/USA}, event_name = {ISSFM}, event_date = {April 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Batista, Elsa and Lucas, Peter and Bissing, Hugo and Petter, Harm Tido and Ogheard, Florestan and Koustrup Niemann, Anders} } @Article { , title = {Inter-comparison of halocarbons in an atmospheric dry whole air sample}, journal = {Elementa}, year = {2015}, month = {11}, day = {3}, volume = {3}, number = {N/A}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {N/A}, keywords = {None supplied}, web_url = {https://www.elementascience.org/articles/75}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {BioOne}, address = {Washington DC}, language = {30}, ISSN = {2325-1026}, DOI = {10.12952/journal.elementa.000075}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rhoderick, G C and Hall, B D and Harth, C M and Kim, J S and Lee, J and Montzka, S A and Muhle, J and Reimann, S and Vollmer, M K and Weiss, R F} } @Article { , title = {Self-Compensating Networks for Four-Terminal-Pair Impedance Definition in Current Comparator Bridges}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {11}, day = {2}, volume = {65}, number = {5}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {1149 - 1155}, keywords = {Bridge circuits, Impedance, Windings, Standards, Current measurement, Frequency measurement, Uncertainty}, web_url = {http://ieeexplore.ieee.org/document/7314919/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {---}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2490898}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7314919/}, author = {Callegaro and D'Elia and Kucera and Ortolano and Pourdanesh and Trinchera} } @Article { , title = {European research project for the Dynamic Measurement of Mechanical Quantities}, journal = {PTB-Mitteilungen}, year = {2015}, month = {11}, volume = {125}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {4-11}, keywords = {dynamic measurement, mechanical quantities, EMRP, dynamic calibration, primary calibration, force ; torque, pressure, conditioning amplifier, modeling, parameter identification}, web_url = {https://public.ptb.de/resource/310.20150202}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, language = {30}, ISSN = {ISSN 0030-834X}, DOI = {10.7795/310.20150202}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kobusch, M. and Bruns, T.} } @Article { , title = {Characterization of force transducers for dynamic measurements}, journal = {PTB-Mitteilungen}, year = {2015}, month = {11}, volume = {125}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {43-51}, keywords = {Dynamic measurement, dynamic force calibration, sinusoidal force, shock force, primary calibration, force transducer, modeling, model parameter identification}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, language = {30}, ISSN = {0030-834X}, DOI = {10.7795/310.20150207}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kobusch, M.} } @Article { EbertPK2015, title = {Measurement of water vapor line strengths in the 1.4–2.7µm range by tunable diode laser absorption spectroscopy}, journal = {Journal of Quantitative Spectroscopy and Radiative Transfer}, year = {2015}, month = {11}, volume = {165}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {108-122}, keywords = {Line strength, Water vapor, Tunable diode laser absorption spectroscopy, Uncertainty, Metrology}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, address = {New York, USA}, language = {30}, ISSN = {0022-4073}, DOI = {10.1016/j.jqsrt.2015.06.023}, stag_bib_extends_levelofaccess = {NA}, author = {Ebert, Volker and Pog{\'a}ny, Andrea and Klein, Alexander} } @Article { , title = {Towards a shock tube method for the dynamic calibration of pressure sensors}, journal = {PTB-Mitteilungen}, year = {2015}, month = {11}, volume = {125}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {24-37}, keywords = {dynamic measurement, pressure sensor calibration, primary calibration, GUM, shock tube, step response}, web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4115465/}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, language = {30}, ISSN = {ISSN 0030-834X}, DOI = {10.7795/310.20150205}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Downes, S. and Knott, A. and Robinson, I.} } @Article { , title = {Alignment position method for SPAD detector calibration and homogeneity}, journal = {International Journal of Scientific Reports}, year = {2015}, month = {11}, volume = {1}, number = {7}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {271-274}, keywords = {SPAD detector, Detection efficiency, Alignment position, Homogeneity}, web_url = {http://www.sci-rep.com/index.php/scirep}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Medip Academy}, address = {Ahmedabad}, language = {30}, ISSN = {2454-2156}, DOI = {10.18203/issn.2454-2156.IntJSciRep20151253}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dhoska, K. and Hofer, H. and Lopez, M. and K{\"u}barsepp, T. and K{\"u}ck, S.} } @Article { , title = {One-step large-scale deposition of salt-free DNA origami nanostructures}, journal = {Scientific Reports}, year = {2015}, month = {10}, day = {23}, volume = {5}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {15634}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Nature Publishing Group}, language = {30}, DOI = {10.1038/srep15634}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Linko, V. and Shen, B. and Tapio, K. and Toppari, J. and Kostianen, M and Tuukkanen, S.} } @Article { , title = {Stability limitations from optical detection in Ramsey-type vapour-cell atomic clocks}, journal = {Electronics Letters}, year = {2015}, month = {10}, day = {22}, volume = {51}, number = {22}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {1767 - 1769}, keywords = {atomic clocks, Ramsey scheme, pulsed interrogation, optical detection}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7308180\&filter\%3DAND\%28p_IS_Number\%3A7308095\%29\%26rowsPerPage\%3D75}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Institution of Engineering and Technology (IET)}, address = {Stevenage \& London, UK}, language = {30}, ISSN = {0013-5194}, DOI = {10.1049/el.2015.1902}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ietdl.org/t/Uofr0b}, author = {Kang, S. and Gharavipour, M. and Affolderbach, C. and Mileti, G.} } @Article { , title = {Effect of Na presence during CuInSe2 growth on stacking fault annihilation and electronic properties}, journal = {Applied Physics Letters}, year = {2015}, month = {10}, day = {14}, volume = {107}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {152103}, keywords = {Stacking faults, Cu(In,Ga)Se2, thin films, solar cells, XRD, GIXRD, GDOES, grain growth, optical pump terahertz probe spectroscopy}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {AIP Publishing LLC}, address = {College Park}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4933305}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Stange, H. and Brunken, S. and Hempel, H. and Rodriguez-Alvarez, H. and Sch{\"a}fer, N. and Greiner, D. and Scheu, A. and Lauche, J. and Kaufmann, C. A. and Unold, T. and Abou-Ras, D. and Mainz, R.} } @Article { , title = {Sudden stress relaxation in compound semiconductor thin films triggered by secondary phase segregation}, journal = {Physical Review B}, year = {2015}, month = {10}, day = {12}, volume = {92}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {155310}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, stress relaxation, recrystallization, grain growth, in-situ, XRD, XRF}, web_url2 = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.155310}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Physical Society}, address = {College Park}, language = {30}, ISSN = {2469-9969}, DOI = {10.1103/PhysRevB.92.155310}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mainz, R. and Rodriguez-Alvarez, H. and Klaus, M. and Thomas, D. and Lauche, J. and Weber, A. and Heinemann, M. D. and Brunken, S. and Greiner, D. and Kaufmann, C. A. and Unold, T. and Schock, H.-W. and Genzel, C.} } @Article { , title = {The European project on high temperature measurement solutions in industry (HiTeMS) – A summary of achievements}, journal = {Measurement}, year = {2015}, month = {10}, day = {9}, volume = {78}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {168-179}, keywords = {High temperature measurement High temperature fixed points (HTFPs) Industrial process control Radiation thermometry Thermocouples Reference functions}, web_url = {http://www.sciencedirect.com/science/article/pii/S026322411500500X}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2015.09.033}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Machiin, G and Anhalt, K and Battuello, M and Bourson, F and Dekker, P and Diril, A and Edler, F and Elliott, C.J. and Girard, F and Greenen, A and Knazovick{\'a}, L and Lowe, D and Pavlasek, P and Pearce, J.V. and Sadli, M and Strnad, R and Seifert, M and Vuelban, E.M.} } @Article { , title = {Domain wall magneto-Seebeck effect}, journal = {Physical Review B}, year = {2015}, month = {10}, day = {6}, volume = {92}, number = {14}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {140405}, keywords = {Spincaloritronics, magnetic domain wall, spin-Seebeck}, web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.140405}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {New York}, language = {30}, ISSN = {1098-0121}, DOI = {10.1103/PhysRevB.92.140405}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Krzysteczko, P. and Hu, X. and Liebing, N. and Sievers, S. and Schumacher, H. W.} } @Article { , title = {Shell Model force field for Lead Zirconate Titanate Pb(Zr1−xTix)O3}, journal = {The Journal of Physical Chemistry C}, year = {2015}, month = {10}, volume = {J. Phys. Chem. C 2015, 119, 17784−17789}, number = {J. Phys. Chem. C 2015, 119, 17784−17789}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {J. Phys. Chem. C 2015, 119, 17784−17789}, keywords = {Shell Model Lead Zirconate Titanate Pb(Zr1−xTix)O3}, web_url = {http://pubs.acs.org/doi/pdf/10.1021/acs.jpcc.5b03207}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {ACS Publications}, language = {30}, DOI = {10.1021/acs.jpcc.5b03207}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gindele,, O and Kimmel,, A and Cain,, M and Duffy, D} } @Proceedings { , title = {Metrology to underpin future regulation of industrial emissions}, journal = {International Congress of Metrology (CIM) 2015, Proceedings}, year = {2015}, month = {9}, day = {23}, volume = {2015}, number = {n.a.}, number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions}, pages = {07008}, keywords = {EMRP, industrial emissions}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07008/metrology_metr2015_07008.html}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {EDP Sciences - Web of Conferences}, address = {Les Ulis Cedex}, event_place = {Paris}, event_name = {17th International Comgress of Metrology 2015}, event_date = {2015-09-21 to 2015-09-24}, language = {30}, ISBN = {n.a.}, ISSN = {n.a.}, DOI = {10.1051/metrology/20150007008}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rausch, Anne and Werhahn, Olav and Witzel, Oliver and Ebert, Volker and Vuelban, Edgar Moreno and Gersl, Jan and Kvernmo, Gjermund and Korsman, John and Coleman, Marc and Gardiner, Tom and Robinson, Rod} } @Proceedings { , title = {Measurements of traceable amount of substance fractions through infrared spectroscopy at PTB}, journal = {International Congress of Metrology (CIM) 2015, Proceedings}, year = {2015}, month = {9}, day = {23}, volume = {2015}, number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments}, pages = {07005}, keywords = {infrared laser spectroscopy, TILSAM, tunable diode laser absorption, cavity ring-down spectroscopy, photoacoustic spectroscopy, gas analysis}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07005/metrology_metr2015_07005.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {EDP Sciences - Web of Conferences}, address = {Les Ulis Cedex}, event_place = {Paris}, event_name = {17th International Congress of Metrology 2015}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/20150007005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\"u}ttschwager, Nils and Pog{\'a}ny, Andrea and Nwaboh, Javis and Klein, Alexander and Buchholz, Bernhard and Werhahn, Olav and Ebert, Volker} } @Article { , title = {METefnet: developments in metrology for moisture in materials}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15003}, keywords = {Development - Moisture in materials}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bell, S and Aro, A and Arpino, F and Aytekin, S and Cortellessa, G and Dell’Isola, M and Ferenč{\'i}kov{\'a}, Z and Fernicola, V and Gavioso, R and Georgin, E and Heinonen, M and Hudoklin, D and Jalukse, L and Karab{\"o}ce, N and Leito, I and M{\"a}kynen, A and Miao, P and Nielsen, J and Nicolescu, I and Rudolfov{\'a}, M and Ojanen-Saloranta, M and {\"O}sterberg, P and {\O}stergaard, P and Rujan, M and Sega, M and Strnad, R and Vachova, T} } @Proceedings { BettsBHCWKG2015, title = {Fast Current Mapping of Photovoltaic Devices Using Compressive Sampling}, journal = {Proceedings of the 31st European Photovoltaic Solar Energy Conference and Exhibition}, year = {2015}, month = {9}, day = {18}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {29-34}, keywords = {Simulation, Characterisation, Characterization, Compressed Sensing}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {WIP}, address = {Munich}, event_place = {Hamburg, Germany}, event_name = {31st European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {14-09-2015 to 18-09-2015}, language = {30}, ISBN = {3-936338-39-6}, ISSN = {2196-0992}, DOI = {10.4229/EUPVSEC20152015-1AO.2.3}, stag_bib_extends_levelofaccess = {NA}, author = {Betts, TR and Bliss, M and Hall, S and Cashmore, M and Wu, X and Koutsourakis, G and Gottschalg, G} } @Article { , title = {Characterization of surface topography of a newly developed metrological gloss scale}, journal = {Surface Topography: Metrology and Properties}, year = {2015}, month = {9}, day = {15}, volume = {3}, number = {4}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {045001}, keywords = {Gloss, roughness, PSD}, web_url = {http://iopscience.iop.org/article/10.1088/2051-672X/3/4/045001}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {2051-672X}, DOI = {10.1088/2051-672X/3/4/045001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-15}, author = {Flys, O and K{\"a}llberg, S and Ged, G and Silvestri, Z and Ros{\'e}n, B-G} } @Proceedings { , title = {DESIGN OF A MEASUREMENT STANDARD FOR MONITORING METROLOGICAL PERFORMANCE OF MACHINE TOOLS}, journal = {Proceedings of International Conference on Innovative Technologies IN-TECH2015}, year = {2015}, month = {9}, day = {12}, volume = {1}, number = {1}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {104-107}, keywords = {Design, traceability, measurement standard, machine tool}, web_url = {http://www.in-tech.info}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Faculty of Engineering, University of Rijeka}, address = {Rijeka, Croatia}, event_place = {Dubrovnik, Croatia}, event_name = {International Conference on Innovative Technologies IN-TECH2015}, event_date = {08-09-2015 to 12-09-2015}, language = {30}, ISBN = {977-000-001-849-7}, ISSN = {1849-0662}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.in-tech.info}, author = {Acko, M. and Klobucar, R. and Milfelner, M.} } @Article { , title = {Advantages of white LED lamps and new detector technology in photometry}, journal = {Light: Science \& Applications}, year = {2015}, month = {9}, day = {11}, volume = {4}, number = {September 2015}, number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry}, pages = {105}, keywords = {LED; optical metrology; photometry; standard lamp}, web_url = {http://www.nature.com/lsa/index.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Light: Science \& Applications}, address = {Changchun}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/lsa.2015.105}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pulli, T.omi P and D{\"o}nsberg, T. and Poikonen, T. and Manoocheri, F. and K{\"a}rh{\"a}, P. and Ikonen, E.} } @Article { , title = {Optical injection locking based amplification in phase coherent transfer of optical frequencies}, journal = {Optics Letters}, year = {2015}, month = {9}, day = {3}, volume = {40}, number = {18}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {4198-4201}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/OL.40.004198}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kim, J. and Schnatz, H. and Wu, D. S. and Marra, G. and Richardson, D.J. and Slav{\'i}k, R.} } @Article { , title = {Tunnel-Junction Thermometry Down to Millikelvin Temperatures}, journal = {APS Physics}, year = {2015}, month = {9}, day = {3}, volume = {4}, number = {034001}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1-9}, keywords = {Tunnel-Junction Thermometry Down to Millikelvin Temperatures}, web_url = {http://journals.aps.org/prapplied/abstract/10.1103/PhysRevApplied.4.034001}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {APS Physics}, address = {New York}, language = {30}, ISSN = {NA}, DOI = {10.1103/PhysRevApplied.4.034001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Feshchenko, A V and Casparis, L and Khaymovich, I M and Marandan, D and Saira, O-P and Palma, M and Meschke, M and Pekola, J P and Zumbuhl, D M} } @Article { QuetelKHFEBB2015, title = {Who should take responsibility for decisions on internationally recommended datasets? The case of the mass concentration of mercury in air at saturation}, journal = {Metrologia}, year = {2015}, month = {8}, day = {27}, volume = {52}, number = {5}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {L25-L30}, keywords = {Who should take responsibility for decisions on internationally recommended datasets? The case of the mass concentration of mercury in air at saturation}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/52/5/L25}, stag_bib_extends_levelofaccess = {NA}, author = {Qu{\'e}tel, C.R. and Kim, K.H. and Horvat, M. and Fisicaro, P. and Ent, H. and Brewer, P.J. and Brown, R.J.C.} } @Proceedings { , title = {Emission Measurement of a Full Body mm Wave Scanner}, year = {2015}, month = {8}, day = {26}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, keywords = {THz, mm-wave, Full Body Scanner, Emission Measurements}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Hong Kong}, event_name = {40th International Conference on Infrared, Millimeter and Terahertz Waves (IRMMW-THz 2015)}, event_date = {2015-08-23 until 2015-08-28}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kleine-Ostmann, T. and Schrader, T.} } @Article { KimNHLAHLHMLHJBCPYKSPPHK2015, title = {A Facile Route for Patterned Growth of Metal–Insulator Carbon Lateral Junction through One-Pot Synthesis}, journal = {ACS Nano}, year = {2015}, month = {8}, day = {25}, volume = {9}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {8352-8360}, keywords = {amorphous carbon, bottom-up growth, graphene, graphene growth from polymer, graphene-based heterostructure}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Chemical Society (ACS)}, address = {Washington, USA}, language = {30}, ISSN = {1936-0851, 1936-086X}, DOI = {10.1021/acsnano.5b03037}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, Kwang S. and Novoselov, Konstantin S. and Hwang, Chanyong and Lee, Zonghoon and Ahn, Jong-Hyun and Han, Sang Woo and Lee, Tae Geol and Hyun, Seung and Mishchenko, Artem and Lee, Seoung-Ki and Huh, Sung and Jeon, Gumhye and Byun, Jinseok and Chae, Dong-Hun and Park, Hyo Ju and Yu, Seong Uk and Kim, Yong-Jin and Son, Jin Gyeong and Park, Jaesung and Park, Beomjin and Hong, Byung Hee and Kim, Jin Kon} } @Proceedings { , title = {Measurement and Simulation of Heat Transfer into a Human Skin Phantom}, year = {2015}, month = {8}, day = {24}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, keywords = {THz, mm-wave, Skin Phantom, Thermal Imaging}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Hong Kong}, event_name = {40th International Conference on Infrared, Millimeter and Terahertz Waves (IRMMW-THz 2015)}, event_date = {2015-08-23 until 2015-08-28}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kazemipour, A. and Charles, M. and Allal, D. and Borsero, M. and Zilberti, L. and Bottauscio, O. and Chiampi, M.} } @Proceedings { , title = {Adapter and method for improving the LISN input impedance measurement accuracy}, journal = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, year = {2015}, month = {8}, day = {22}, volume = {2015}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1254-1259}, keywords = {3D electromagnetic simulations, LISN calibration, input impedance, conductive immunity}, web_url = {http://ieeexplore.ieee.org/document/7256350/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Dresden}, event_name = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, event_date = {16-08-2015 to 22-08-2015}, language = {30}, ISBN = {978-1-4799-6616-5}, ISSN = {2158-1118}, DOI = {10.1109/ISEMC.2015.7256350}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ziade, Francois and Ouameur, Mohamed and B{\'e}li{\`e}res, Denis and Poletaeff, Andr{\'e} and Allal, Djamel and Kokalj, Miha and Pinter, Borut} } @Article { , title = {Assessment of a dual-channel array spectrometer for ground-based ozone retrievals}, journal = {Journal of Atmospheric and Oceanic Technology}, year = {2015}, month = {8}, day = {20}, volume = {32}, number = {August 2015}, number2 = {ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation}, pages = {1464-1477}, keywords = {Ozone, UV, array spectrometer}, web_url = {http://journals.ametsoc.org/doi/pdf/10.1175/JTECH-D-14-00200.1}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {American Meteorological Society}, address = {Boston}, language = {30}, ISSN = {0739-0572}, DOI = {10.1175/JTECH-D-14-00200.1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Smedley, Andrew R.D. and Kift, Richard C. and Webb, Ann R.} } @Article { , title = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system}, journal = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system}, year = {2015}, month = {8}, day = {19}, volume = {2}, number = {3}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {035015}, keywords = {graphene, Quantum Hall, cryogen-free, measurement}, web_url = {http://iopscience.iop.org/2053-1583/2/3/035015/video/abstract}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/2/3/035015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Rozhko, S. and Antonov, I. and Tzalenchuk, A. and Williams, J. M. and Melhem, Z. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R.} } @Article { , title = {Improving acoustic determinations of the Boltzmann constant with mass spectrometer measurements of the molar mass of argon}, journal = {Metrologia}, year = {2015}, month = {8}, day = {19}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S394–S409}, keywords = {Boltzmann constant, molar mass of argon, mass spectrometer, argon isotope, acoustic gas thermometer}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S394/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/0026-1394/52/5/S394}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yang, I and Pitre, L and Moldover, M R and Zhang, J and Feng, X and Kim, J S} } @Article { , title = {Preparation and characterization of primary magnesium mixtures for the ab initio calibration of absolute magnesium isotope ratio measurements}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2015}, month = {8}, day = {17}, volume = {31}, number = {1}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {179–196}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, DOI = {10.1039/C5JA00284B}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brandt, Bj¨orn and Vogl, Jochen and Noordmann, Janine and Kaltenbach, Angela and Rienitz, Olaf} } @Article { , title = {Investigation of Verification Artifacts in WR-03 Waveguides}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2015}, month = {8}, day = {15}, volume = {36}, number = {11}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1089-1100}, keywords = {Scattering parameters, Waveguide standards, Measurement uncertainty, Verification artifacts, Microwave measurements}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer}, address = {New York}, language = {30}, ISSN = {1866-6906}, DOI = {10.1007/s10762-015-0193-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shoaib, N. and Kuhlmann, K. and Judaschke, R. and Sellone, M. and Brunetti, L.} } @Article { , title = {Detecting metrologically useful entanglement in the vicinity of Dicke states}, journal = {New Journal of Physics}, year = {2015}, month = {8}, day = {13}, volume = {17}, number = {1}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {083027}, keywords = {quantum Fisher information, quantum metrology, quantum entanglement, Dicke states}, web_url = {http://arxiv.org/abs/1412.3426}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol BS1 6HG UK}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/17/8/083027}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://iopscience.iop.org/1367-2630/17/8/083027}, author = {Apellaniz, I and L{\"u}cke, B and Peise, J and Klempt, C and T{\'o}th, G} } @Proceedings { , title = {Investigations for determining the sound power level by applying different measurement setups according to ISO 3744}, journal = {InterNoise 2015}, year = {2015}, month = {8}, day = {9}, volume = {44}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, pages = {11}, keywords = {sound power level determination, measurement errors,tracebility}, web_url = {http://ince.publisher.ingentaconnect.com/content/ince/incecp/2015/00000250/00000004}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {INTERNOISE}, address = {Washington, D.C.}, event_place = {San Francisco}, event_name = {InterNoise 2015}, event_date = {09.08.2015-12.08.2015}, language = {30}, ISSN = {0736-2935}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arendt, I. and Kurtz, P.} } @Proceedings { , title = {Airborne sound power level measurements revisited}, journal = {InterNoise 2015}, year = {2015}, month = {8}, day = {9}, volume = {44.}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, pages = {4684-4692}, keywords = {sound power level determination, systematic differences, tracebility}, web_url = {http://ince.publisher.ingentaconnect.com/content/ince/incecp/2015/00000250/00000002}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {INTERNOISE}, address = {Washington, D.C.}, event_place = {San Francisco}, event_name = {InterNoise 2015}, event_date = {9.-12. August 2015}, language = {30}, ISSN = {0736-2935}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arendt, I. and Kurtz, P.} } @Article { , title = {Brief bursts of infrasound may improve cognitive function - An fMRI study}, journal = {Hearing Research}, year = {2015}, month = {8}, day = {7}, volume = {328 (2015)}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {87-93}, keywords = {Auditory system; Cognitive processing; Infrasound; N-back; Working memory; fMRI}, web_url = {http://www.sciencedirect.com/science/article/pii/S0378595515001628}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, address = {Philadelphia}, language = {30}, DOI = {10.1016/j.heares.2015.08.001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-5-31}, author = {Weichenberger, Markus and Bauer, Martin and K{\"u}hler, Robert and Hensel, Johannes and Br{\"u}hl, R{\"u}diger and Ihlenfeld, Albrecht and Ittermann, Bernd and Gallinat, J{\"u}rgen and Koch, Christian and Sander, Tilmann and K{\"u}hn, Simone} } @Proceedings { , subid = {135}, title = {Metrology for long distance surveying - a joint attempt to improve traceability of long distance measurements}, journal = {IAG 150 Years - Proceedings of the 2013 IAG Scientific Assembly}, year = {2015}, month = {8}, day = {1}, volume = {143}, number = {2015}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {calibration · EDM · GNSS · local ties · reference baseline · long distance}, web_url = {http://link.springer.com/chapter/10.1007\%2F1345_2015_154}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer International Publishing}, address = {Berlin Heidelberg}, event_place = {Potsdam, Germany}, event_name = {International Association of Geodesy (IAG) Scientific Assembly 2013}, event_date = {September 1-6, 2013}, language = {30}, ISSN = {0939-9585}, DOI = {10.1007/1345_2015_154}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Pollinger, F. and Astru, M. and Bauch, A. and Bergstrand, S. and G{\"o}rres, B. and Jokela, J. and Kallio, U. and Koivula, H. and Kuhlmann, H. and Kupko, V. and Meiners-Hagen, K. and Merimaa, M. and Niemeier, W. and Neyezhmakov, P. and Poutanen, M. and Saraiva, F. and Sch{\"o}n, S. and van den Berg, S.A. and Wallerand, J.-P. and Zucco, M.} } @Techreport { , title = {A Guide to Bayesian Inference for Regression Problems}, journal = {-}, year = {2015}, month = {7}, day = {30}, volume = {-}, number = {-}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {-}, tags = {MAT}, web_url = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {PTB}, address = {Brunswick \& Berlin}, institution = {-}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, author = {Elster, C. and Klauenberg, K. and Walzel, M. and Wuebbeler, G. and Harris, P. and Cox, M. and Matthews, C. and Smith, I. and Wright, L. and Allard, A. and Fischer, N. and Cowen, S. and Ellison, S. and Wilson, P. and Pennecchi, F. and Kok, G. and Van der Veen, A. and Pendrill, L.R.} } @Article { KapschK2015, title = {Measurement of spatial response functions of dosimetric detectors}, journal = {Physics in Medicine and Biology}, year = {2015}, month = {7}, day = {30}, volume = {60}, number = {16}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {6177-6194}, keywords = {detector response function, ionization chamber, photon field dosimetry, electron field dosimetry, detector size effect}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/60/16/6177}, stag_bib_extends_levelofaccess = {NA}, author = {Kapsch, R.P. and Ketelhut, S.} } @Article { BergerudOMMPK2015, title = {Effect of changes in temperature scales on historical temperature data}, journal = {International Journal of Climatology}, year = {2015}, month = {7}, day = {19}, volume = {36}, number = {2}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {1005-1010}, keywords = {historical; temperature; data; climate change}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0899-8418}, DOI = {10.1002/joc.4404}, stag_bib_extends_levelofaccess = {NA}, author = {Bergerud, R. A. and Olsen, {\AA}. A. F. and Musacchio, C. and Merlone, A. and Pavlasek, P. and Knazovicka, L.} } @Proceedings { , title = {Investigation of perception at infrasound frequencies by functional magnetic resonance imaging (fMRI) and magnetoencephalography (MEG)}, journal = {Proceedings of International Conference on Sound and Vibration (ICSV22)}, year = {2015}, month = {7}, day = {16}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, keywords = {non-audible noise, functional magnetic resonance imaging, magnetoencephalography, infrasound}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Florence (Italy)}, event_name = {The 22nd International Congress on Sound and Vibration}, event_date = {12-16 July 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bauer, M and Sander-Th{\"o}mmes, T and Ihlenfeld, A and K{\"u}hn, S and K{\"u}hler, R and Koch, C} } @Article { , title = {Flow variability and its physical causes in infusion technology: a systematic review of in vitro measurement and modeling studies}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {7}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {277-300}, keywords = {compliance; drug delivery; in vitro; infusion; metrology; pumps; review}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0148}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Snijder, R.A. and Koning, M.K. and Lucas, P. and Egberts, T.C. and Timmerman, A.M.D.E.} } @Article { , title = {Tip-enhanced Raman spectroscopy: principles and applications}, journal = {EPJ Techniques and Instrumentation}, year = {2015}, month = {7}, day = {1}, volume = {2:9}, number = {2015}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {2:9}, keywords = {Tip-enhanced Raman spectroscopy; Nanotechnology; Nanophotonics}, web_url = {http://epjtechniquesandinstrumentation.springeropen.com/articles/10.1140/epjti/s40485-015-0019-5}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer Open}, address = {Heidelberg}, language = {30}, ISSN = {N/A}, DOI = {10.1140/epjti/s40485-015-0019-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-7-1}, author = {Kumar, N. and Mignuzzi, S. and Su, W. and Roy, D.} } @Article { , title = {Study of wear of diamond-coated probe tips when scanning on different materials}, journal = {Meas. Sci. Technol. 26 (2015) 084005 (7pp).}, year = {2015}, month = {7}, volume = {26}, number = {084005}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, keywords = {coordinate measuring machine (CMM), scanning, probe tip wear, diamond coated sphere}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {30}, DOI = {10.1088/0957-0233/26/8/084005}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"u}ng, A and Nicolet, A and Meli, F} } @Article { , title = {Air index compensated interferometer as aprospective novel primary standard for baselinecalibrations}, journal = {Meas. Sci. Technol.}, year = {2015}, month = {7}, volume = {26 (8)}, number = {084002}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {absolute distance measurement, refractive index compensation, interferometry, geodesy}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1088/0957-0233/26/8/084002}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Meiners–Hagen, Karl and Bosnjakovic, Alen and K{\"o}chert, Paul and Pollinger, Florian} } @Article { , title = {A prototype of RK=200 quantum Hall array resistance standard on epitaxial graphene}, journal = {A prototype of RK=200 quantum Hall array resistance standard on epitaxial graphene}, year = {2015}, month = {7}, volume = {118}, number = {4}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {044506}, keywords = {Epitaxial graphene, silicon carbide, Hall, graphene, measurement,}, web_url = {http://scitation.aip.org/content/aip/journal/jap/118/4/10.1063/1.4927618}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979}, DOI = {10.1063/1.4927618}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lartsev, A. and Lara-Avila, S. and Danilov, A. and Tzalenchuk, A. and Yakimova, R. and Kubatkin, S.} } @Article { , title = {Influence of impurity spin dynamics on quantum transport in epitaxial graphene}, year = {2015}, month = {7}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {epitaxial graphene, measurements, graphene, magnetotransport, magnetic field B∥,}, web_url = {http://arxiv.org/abs/1507.03841v1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1103/PhysRevLett.115.106602}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lara-Avila, S. and Kubatkin, S. and Kashuba, O. and Folk, J. A. and L{\"u}scher, S. and Yakimova, R. and Janssen, T.J.B.M. and Tzalenchuk, A. and Fal'ko, V.} } @Article { , title = {MEASUREMENT AND ASSESSMENT OF AIRBORNE ULTRASOUND NOISE}, journal = {Proceedings of the 22nd International Congress on Sound and Vibration, Florence, Italy, from 12 to 16 July 2015}, year = {2015}, month = {7}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {7}, keywords = {Airborne Ultrasound, High Frequency, Noise, Assessment, Hearing Threshold}, web_url = {http://iiav.org/archives_icsv_last/2015_icsv22/content/papers/papers/full_paper_414_20150501172215252.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {International Institute of Acoustics and Vibration (IIAV)}, address = {Italy}, language = {30}, ISSN = {2329-3675}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://iiav.org/archives_icsv_last/2015_icsv22/content/papers/papers/full_paper_414_20150501172215252.pdf}, author = {Kling, Christoph and Koch, Christian and K{\"u}hler, Robert} } @Article { , title = {Online validation of comparison algorithms using the TraCIM system}, journal = {Journal of mechanical Engineering and Automation}, year = {2015}, month = {7}, volume = {2}, number = {7}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {312-327}, keywords = {Comparison, TraCIM, weighted mean, expanded measurement uncertainty, En value, largest consistent subset, En criterion, Grubbs’ test.}, tags = {MAT}, web_url = {http://www.ethanpublishing.com/uploadfile/2015/0806/20150806111104726.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Scientific \& Academic Publishing (SAP)}, address = {Rosemead}, language = {30}, ISSN = {2163-2413}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"a}rtig, FH and Tang, JT and Hutzschenreuter, DH and Wendt, KW and Kniel, KK and Shi, ZS} } @Proceedings { BlattnerKJSHB2015, title = {Measurement uncertainty of photometric measurements considering the requirements of the new international standard CIE S 025 / E:2015 ''Test Method for LED Lamps, LED Luminaires and LED Modules}, journal = {Proceedings of the 28th Session of the CIE Manchester, United Kingdom, 28 June – 4 July 2015}, year = {2015}, month = {7}, volume = {1}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {797-811}, keywords = {measurement uncertainty, LED, CIE S 025, Test Method for LED lamps, international standard}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Commission Internationale de L'Eclairage}, address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A, 1010 Vienna, Austria}, event_place = {Manchester, UK}, event_name = {28th Session of the CIE}, event_date = {28-06-2015 to 04-07-2015}, language = {30}, ISBN = {978-3-902842-55-8}, stag_bib_extends_levelofaccess = {NA}, author = {Blattner, P. and Kr{\"u}ger, U. and Jordan, W. and Steudtner, W. and Hornischer, R. and Bechter, W.} } @Article { , title = {High-bandwidth transfer of phase stability through a fiber frequency comb}, journal = {Optics Express}, year = {2015}, month = {6}, day = {30}, volume = {23}, number = {15}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {19771-19776}, web_url = {http://arxiv.org/abs/1505.02084}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Scharnhorst, N. and W{\"u}bbena, J. B. and Hannig, S. and Jakobsen, K. and Kramer, J. and Leroux, I. D. and Schmidt, P. O.} } @Article { , title = {Direct Comparison of a 1 V Josephson Arbitrary Waveform Synthesizer and an AC Quantum Voltmeter}, journal = {Metrologia}, year = {2015}, month = {6}, day = {16}, volume = {52}, number = {4}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {528-537}, keywords = {ac Josephson voltage Standard, Josephson arbitrary waveform Synthesizer, ac quantum Voltmeter, direct comparison}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/4/528}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {BIPM \& IOP Publishing Ltd}, address = {Bristol}, language = {30}, ISSN = {ISSN 0026-1394 (print) ; ISSN 1681-7575 (online)}, DOI = {10.1088/0026-1394/52/4/528}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Behr, Ralf and Kieler, Oliver and Lee, Jinni and Bauer, Stephan and Palafox, Luis and Kohlmann, Johannes} } @Article { , title = {An experimental setup for traceable measurement and calibration of liquid flow rates down to 5 nl/min}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {6}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {337-345}, keywords = {calibration; metrology; microflow; nanoflow; traceability; uncertainty.}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0153}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ahrens, M. and Nestler, B. and Klein, S. and Lucas, P. and Petter, H.T. and Damiani, C.} } @Article { , title = {How physical infusion system parameters cause clinically relevant dose deviations after setpoint changes}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {6}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {365-376}, keywords = {drug delivery; metrology; multi-infusion; standards; syringe compliance}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0139}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Timmerman, A.M.D.E. and Snijder, R.A. and Lucas, P. and Lagerwij, M.C. and Radermacher, J.H. and Konings, M.K.} } @Proceedings { , title = {Sensitivity of VOC Sensors for Air Quality Monitoring within the EURAMET Key-VOC project}, journal = {AMA Science}, year = {2015}, month = {6}, day = {5}, volume = {Fourth Scientific Meeting EuNetAir}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {6 - 9}, keywords = {benzene, photo ionisation detectors, metal oxide sensors, electrochemical cells, micro GCs, electronic noses}, web_url = {http://www.ama-science.org/proceedings/details/2117}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {AMA Science (http://www.ama-science.org/ama-conferences)}, address = {Wunstorf}, event_place = {Linkoping University, Linkoping, Sweden}, event_name = {Fourth Scientific Meeting EuNetAir}, event_date = {03-06-2015 to 05-06-2015}, language = {30}, DOI = {10.5162/4EuNetAir2015/02}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Spinelle, L. and Gerboles, M. and Kok, G. and Sauerwald, T.} } @Article { NieminenKHBE2015, title = {Traceability and Characterization of a 1000 kV HVDC Reference Divider}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {1709-1715}, keywords = {Resistors, Resistance, Calibration, Uncertainty, Voltage measurement, Measurement uncertainty, HVDC transmission}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2410373}, stag_bib_extends_levelofaccess = {NA}, author = {Nieminen, T. and Kharezy, M. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Elg, A.P.} } @Article { , title = {Design and Calibration of a Compact Quasi-Optical System for Material Characterization in Millimeter/Sub-millimeter Wave Domain}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {1438-1445}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2014.2376115}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kazemipour, A. and Hudlicka, M. and Yee, S.-K. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Article { , title = {Dynamic torque calibration by means of model parameter identification}, journal = {Acta Imeko}, year = {2015}, month = {6}, volume = {4}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {39-44}, keywords = {model parameter identification; dynamic torque calibration; dynamic measurement; mechanical model}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-04\%20\%282015\%29-02-07}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Imeko}, address = {Budapest}, language = {30}, ISSN = {ISSN 2221-870X}, DOI = {10.21014/acta_imeko.v4i2.211}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klaus, L. and Arendack{\'a}, B. and Kobusch, M. and Bruns, T.} } @Article { , title = {Investigations for the model‐based dynamic calibration of force transducers by using shock excitation}, journal = {Acta Imeko}, year = {2015}, month = {6}, volume = {4}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {45-51}, keywords = {Dynamic calibration, shock force, dynamic modelling, parameter identification}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-04\%20(2015)-02-08/384}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Imeko}, address = {Budapest}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v4i2.214}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kobusch, M. and Eichst{\"a}dt, S. and Klaus, L. and Bruns, T.} } @Article { , title = {Verification of statistical calculations in interlaboratory comparisons by simulating input datasets}, journal = {International Journal of Simulation Modelling}, year = {2015}, month = {6}, volume = {14}, number = {2}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {227-237}, keywords = {Interlaboratory Comparison, Validation Software, Performance Metrics, Verification, Simulation}, tags = {MAT}, web_url = {http://www.ijsimm.com/Full_Papers/Fulltext2015/text14-2_227-237.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {DAAAM International Vienna }, address = {Vienna}, language = {30}, ISSN = {1726-4529}, DOI = {10.2507/IJSIMM14(2)4.288}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Acko, BA and Brezovnik, SB and Crepinsek-Lipus, LCL and Klobucar, RK} } @Article { , title = {Carrier type inversion in quasi-free standing graphene: studies of local electronic and structural properties}, journal = {Nature: Scientific reports}, year = {2015}, month = {6}, number = {5}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {10505}, keywords = {metrology, Kelvin, graphene, measurements,}, web_url = {http://www.nature.com/articles/srep10505}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Scientific reports}, language = {30}, DOI = {10.1038/srep10505}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Melios, C. and Panchal, V. and Giusca, C. E. and Strupinski, W. and Silva, S. Ravi P. and Kazakova, O.} } @Article { SuomalainenSNMMLLKHEDBHW2015, title = {Performance of a Modular Wideband HVDC Reference Divider for Voltages up to 1000 kV}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {1390-1397}, keywords = {Voltage measurement, Calibration, Resistors, HVDC transmission, Uncertainty, Voltage control, Resistance}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2408795}, stag_bib_extends_levelofaccess = {NA}, author = {Suomalainen, E.P. and Schmidt, M. and Nieminen, T. and Merev, A. and Meisner, J. and Lucas, W. and Lehtonen, T. and Kl{\"u}ss, J. and Houtzager, E. and Elg, A.P. and Dedeoğlu, S. and Bergman, A. and H{\"a}llstr{\"o}m, J. and Weber, C.} } @Proceedings { , title = {Auditory cortex activation by infrasonic and low-frequency sound of equalized individual loudness}, journal = {Euronoise 2015}, year = {2015}, month = {5}, day = {31}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {2577-2582}, keywords = {Infrasound, loudness, MEG}, web_url = {http://www.conforg.fr/euronoise2015/output_directory/data/articles/000402.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Maastricht (Nederlands)}, event_name = {Euronoise 2015, Maastricht}, event_date = {3rd June 2015}, language = {30}, ISSN = {2226-5147}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"u}hler, Robert and Bauer, Martin and Hensel, Johannes and Koch, Christian and Sander-Th{\"o}mmes, Tillmann} } @Proceedings { , title = {MEG and fMRI localization of infrasonic and low-frequency sound}, journal = {Proccedings of the ISMRM 2015 - International Society for Magnetic Resonance in Medicine}, year = {2015}, month = {5}, day = {30}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, web_url = {http://www.ismrm.org/15/}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Toronto, Ontario, Canada}, event_name = {ISMRM 23rd Annual Meeting \& Exhibition}, event_date = {30 May-05 June 2015}, language = {30}, ISSN = {1545-4428}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Weichenberger, M. and Br{\"u}hl, R. and Bauer, M. and K{\"u}hler, R. and Ihlenfeld, A. and Hensel, J. and Koch, C. and Ittermann, B. and K{\"u}hn, S. and Sander-Th{\"o}mmes, T.} } @Article { , title = {Precise determination of micromotion for trapped-ion optical clocks}, journal = {Atomic Physics (physics.atom-ph); Quantum Physics (quant-ph)}, year = {2015}, month = {5}, day = {21}, number = {2015}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {https://arxiv.org/abs/1505.05907}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Keller, J. and Partner, H. L. and Burgermeister, T. and Mehlstaeubler, T. E.} } @Article { , title = {Edge-Mode Resonance-Assisted Switching of Nanomagnet Logic Elements}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {5}, day = {21}, volume = {51}, number = {11}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {4/3401004}, keywords = {Ferromagnetic resonance (FMR) mode, microwave-assisted magnetization switching (MAS), nanomagnet logic (NML), simulation}, web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=20}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2015.2435901}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hu, X.K. and Dey, H. and Liebing, N. and Csaba, G. and Orlov, A. and Bernstein, G.H. and Porod, W. and Krzysteczko, P. and Sievers, S. and Schumacher, H.W.} } @Article { , title = {Single shot lateral shear interferometer with variable shear}, journal = {Optical Engineering}, year = {2015}, month = {5}, day = {20}, volume = {54}, number = {5}, number2 = {SIB08: subnano: Traceability of sub-nm length measurements}, pages = {054105}, keywords = {Wave front sensing, Shear interferometry, Spatial carrier}, web_url = {http://opticalengineering.spiedigitallibrary.org/article.aspx?articleid=2297869}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {SPIE}, address = {Bellingham}, language = {30}, ISSN = {1.OE.54.5.054105}, DOI = {10.1117/1.OE.54.5.054105}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Falldorf, C. and Klattenhoff, R. and Bergmann, R. B.} } @Article { , title = {Design and application of a versatile gas calibration for non-metal determination by carrier gas hot extraction}, journal = {Analytical Methods}, year = {2015}, month = {5}, day = {19}, volume = {7}, number = {13}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {5468-5475}, web_url = {http://pubs.rsc.org/En/content/articlelanding/2015/ay/c5ay00845j\#!divAbstract}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, DOI = {10.1039/c5ay00845j}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kramer, Claus and Ried, Peter and Mahn, Stefan and Richter, Silke and Langhammer, Nicole and Kipphardt, Heinrich} } @Proceedings { , title = {Investigation of verification artefacts in rectangular waveguides up to 325 GHz}, journal = {Proceedings Radio Science Conference (URSI AT-RASC), 2015 1st URSI Atlantic}, year = {2015}, month = {5}, day = {16}, volume = {n.a.}, number = {n.a.}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1}, keywords = {verification, waveguide}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Danvers}, event_place = {Gran Canaria}, event_name = {Radio Science Conference (URSI AT-RASC), 2015 1st URSI Atlantic}, event_date = {16-05-2015 to 24-05-2015}, language = {30}, ISBN = {n.a.}, ISSN = {n.a.}, DOI = {10.1109/URSI-AT-RASC.2015.7302818}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Shoaib, N. and Kuhlmann, K. and Judaschke, R.} } @Article { , title = {New frontiers in angle metrology at the PTB}, journal = {Measurement}, year = {2015}, month = {5}, day = {14}, number2 = {SIB58: Angles: Angle metrology}, keywords = {Angle measurement; Angle standard; Angle encoder; Autocollimator; Traceability; Key comparison}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Geckeler, R D and Krause, M and Just, A and Kranz, O and Bosse, H} } @Article { SuranKBAMSHTLT2015, title = {A new large-volume metal reference standard for radioactive waste management}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {13}, volume = {168}, number = {3}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {293-299}, keywords = {reference materials, calibration, ionizing radiation, free release measurement}, web_url = {http://rpd.oxfordjournals.org}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv309}, stag_bib_extends_levelofaccess = {NA}, author = {Šur{\'a}ň, J. and Kov{\'a}ř, P. and Burda, O. and Arnold, D. and Marissens, G. and Stroh, H. and Hult, M. and Tzika, F. and Listkowska, A. and Tyminski, Z.} } @Article { , title = {Frequency and time transfer for metrology and beyond using telecommunication network fibres}, journal = {Comptes Rendus Physique}, year = {2015}, month = {5}, day = {8}, volume = {16}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {531–539}, keywords = {Time and frequency metrology Optical links Frequency stabilized lasers Fibre optics}, web_url = {www.sciencedirect.com}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1016/j.crhy.2015.04.005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopez, O. and K{\'e}f{\'e}lian, F. and Jiang, H. and Haboucha, A. and Bercy, A. and Stefani, F. and Chanteau, B. and Kanj, A. and Rovera, D. and Achkar, J. and Chardonnet, C and Pottie, P.-O. and Amy-Klein, A. and Santarelli, G.} } @Article { , title = {Characterization of a large-area pyroelectric detector from 300 GHz to 30 THz}, journal = {Journal of Infrarred, Millimeter, and Terahertz Waves}, year = {2015}, month = {5}, day = {5}, volume = {36}, number = {7}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {654-661}, keywords = {Far infrared detectors, Terahertz detectors, Radiometry, Metrological instrumentation, Infrared and far infrared lasers, Optics}, web_url = {http://link.springer.com/article/10.1007\%2Fs10762-015-0163-7}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer US}, address = {New York}, language = {30}, ISSN = {1866-6892}, DOI = {10.1007/s10762-015-0163-7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {M{\"u}ller, Ralf and Gutschwager, Berndt and Hollandt, J{\"o}rg and Kehrt, Mathias and Monte, Christian and M{\"u}ller, Ralph and Steiger, Andreas} } @Techreport { , title = {Guideline for the detection efficiency calibration of Si-SPAD}, journal = {project SIQUTE website www.ptb.de/empr/siqute-home.html}, year = {2015}, month = {5}, day = {2}, volume = {xxxx}, number = {xxx}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {13}, keywords = {Calibration, single-photon avalanche diode,}, web_url = {www.ptb.de/empr/siqute-home.html}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {The Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, institution = {The Physikalisch-Technische Bundesanstalt}, language = {30}, ISBN = {none}, ISSN = {none}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\'o}pez, Marco and Helmuth Hofer, Helmuth and K{\"u}ck, Stefan} } @Article { , title = {From plane to spatial angles: PTB’s spatial angle autocollimator calibrator}, journal = {Advanced Optical Technologies}, year = {2015}, month = {5}, number2 = {SIB58: Angles: Angle metrology}, keywords = {angle metrology; autocollimator calibration; deflectometry; spatial angles; synchrotron metrology}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1515/aot-2015-0017}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kranz, O and Geckeler, R D and Just, A and Krause, M and Osten, W} } @Article { , title = {Automatic minimisation of micromotion in a 88Sr+ optical clock}, journal = {Measurement Science \& Technology}, year = {2015}, month = {5}, volume = {26}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0957-0233/26/7/075203}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barwood, GP and Huang, G and Klein, HA and Gill, P} } @Article { , title = {Heavy ion Beams for Radiobiology: Dosimetry and Nanodosimetry at HIL}, journal = {Acta Physica Polonica A}, year = {2015}, month = {5}, volume = {127}, number = {5}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {1516-1519}, keywords = {PACS numbers: 87.53.Bn, 87.53.-j}, web_url = {http://przyrbwn.icm.edu.pl/APP/ABSTR/127/a127-5-18.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.12693/APhysPolA.127.1516}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kamierczak, U. and Bantsar, A. and Banas, D. and Braziewicz, J. and Czub, J. and Jask{\'o}la, M. and Korman, A. and Kruszewski, M. and Lankoff, A. and Lisowska, H. and Pietrzak, M. and Pszona, S. and Stepkowski, T. and Szeflinski, Z. and Wojew{\'o}dzka, M.} } @Article { , title = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, journal = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, year = {2015}, month = {5}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Dirac-point physics, epitaxial graphene, magneto-transport, measurement, graphene, hall effect, electron-hole puddles,}, web_url = {http://arxiv.org/abs/1505.03747}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1103/PhysRevB.92.075407}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, J. and Alexander-Webber, J.A. and Baker, A.M.R. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.} } @Proceedings { , title = {Approaches for assigning numerical uncertainty to reference data pairs for software validation}, journal = {Advanced Mathematical and Computational Tools in Metrology and Testing X}, year = {2015}, month = {5}, volume = {86}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {195-202}, keywords = {Numerical uncertainty, numerical accuracy, condition number, numerical sensitivity, performance metric, software validation}, tags = {MAT}, web_url = {http://www.worldscientific.com/doi/abs/10.1142/9789814678629_0023}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {World Scientific Publishing}, address = {Singapore}, event_place = {St Petersburg, Russia}, event_name = {Advanced Mathematical and Computational Tools in Metrology and Testing 2014 - Traceability for computationally-intensive metrology}, event_date = {09-09-2014 to 12-09-2014}, language = {30}, ISBN = {978-981-4678-63-6}, DOI = {10.1142/9789814678629_0023}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kok, GJPK and Smith, IMS} } @Article { , title = {Phase Locking a Clock Oscillator to a Coherent Atomic Ensemble}, journal = {Phys. Rev. X}, year = {2015}, month = {4}, day = {27}, volume = {5}, number = {2}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {021011}, keywords = {Atomic and Molecular Physics, Quantum Physics}, web_url = {http://arxiv.org/abs/1501.03709}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {2160-3308}, DOI = {10.1103/PhysRevX.5.021011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kohlhaas, R and Bertoldi, A and Cantin, E and Aspect, A and Landragin, A and Bouyer, P} } @Article { , title = {Visibility of sparkle in metallic paints}, journal = {Journal of the Optical Society of America A, Optics, Image Science and Vision.}, year = {2015}, month = {4}, day = {27}, volume = {32}, number = {5}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {921-927}, keywords = {sparkle, Color, measurement, Vision - acuity, Color visi{\'o}n, Vision - contrast sensitivity, Spectral discrimination, Astronomical optics}, web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-5-921}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society (OSA)}, address = {Washington, DC}, language = {30}, ISSN = {1084-7529}, DOI = {10.1364/JOSAA.32.000921}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kirchner, E and van der Lans, I and Perales, E and Mart{\'i}nez-Verd{\'u}, FM and Campos, J and Ferrero, A} } @Article { , title = {Multiphoton luminescence imaging of chemically functionalized multi-walled carbon nanotubes in cells and solid tumors†}, journal = {ChemComm}, year = {2015}, month = {4}, day = {24}, volume = {51}, number = {45}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {9366-9369}, keywords = {N/A}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/CC/c5cc02675j\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Royal Society of Chemistry}, address = {Picadilly UK}, language = {30}, ISSN = {N/A}, DOI = {10.1039/c5cc02675j}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Rubio, N. and Hirvonen, L.M. and Chong, E.Z. and Wang, J.T.W. and Bourgognon, M. and Kafa, H. and Hassan, H.A.F.M. and Al-Jamal, W.T. and McCarthy, D. and Hogstrand, C. and Festy, F. and Al-Jamal, K.T.} } @Article { , title = {A novel type N coaxial air-line verification standard}, journal = {Metrologia}, year = {2015}, month = {4}, day = {24}, volume = {52}, number = {4}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {469–477}, keywords = {VNA verification standard, coaxial air-line, type N coaxial connector}, web_url = {http://stacks.iop.org/0026-1394/52/i=4/a=469}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing on behalf of BIPM}, address = {Bristol}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/0026-1394/52/4/469}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shoaib, N. and Kuhlmann, K. and Judaschke, R.} } @Article { , title = {Epitaxial graphene on SiC: Modification of structural and electron transport properties by substrate pretreatment}, journal = {Epitaxial graphene on SiC: modification of structural and electron transport properties by substrate pretreatment}, year = {2015}, month = {4}, day = {20}, volume = {27}, number = {18}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {185303}, keywords = {Epitaxial graphene, step bunching, graphene buffer layer, graphene bilayer, resistance anisotropy, quantum Hall resistance, hydrogen, argon, pretreatment, transport properties, SiC substrate, annealing, shallowly stepped}, web_url = {http://iopscience.iop.org/article/10.1088/0953-8984/27/18/185303/meta}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {0953-8984}, DOI = {10.1088/0953-8984/27/18/185303}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kruskopf, M. and Pierz, K. and Wundrack, S. and Stosch, R. and Dziomba, T. and Kalmbach, C.C. and M{\"u}ller, A. and Ahlers, F.J. and Schumacher, H.W. and Baringhaus, J. and Tegenkamp, C.} } @Article { , title = {Quantum Hall resistance standard in graphene devices under relaxed experimental conditions}, journal = {Nature Nanotechnology}, year = {2015}, month = {4}, day = {20}, volume = {10}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {965-971}, keywords = {graphene, QHR, measurement}, web_url = {https://www.ptb.de/emrp/resources/documents/graphohm/Sonstige_Fotos/NatureComms7806-2015-Lafont.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Macmillan Publishers}, language = {30}, DOI = {10.1038/ncomms7806}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lafont, F. and Ribeiro-Palau, R. and Kazazis, D. and Michon, A. and Couturaud, O. and Consejo, C. and Chassagne, T. and Zielinski, M. and Portrail, M. and Jouault, B. and Schopfer, F. and Poirier, W.} } @Article { KleineOstmannSS2015, title = {Antenna Characterization and Channel Measurements in the mmWave and Sub-mmWave Region}, journal = {Microwave Journal}, year = {2015}, month = {4}, day = {15}, volume = {58}, number = {4}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {124-134}, keywords = {SCANNING systemsm WAVEGUIDE antennas, TELECOMMUNICATION systems, MICROSTRIP antennas, BROADBAND antennas}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Horizon House Publications Inc.}, language = {30}, ISSN = {0192-6225}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {0192-6225}, author = {Kleine-Ostmann, T. and Schrader, T. and Salhi, M.} } @Article { , title = {Interaction-free measurements by quantum Zeno stabilization of ultracold atoms}, journal = {Nature Communications}, year = {2015}, month = {4}, day = {14}, volume = {6}, number = {1}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {6811}, keywords = {Physical sciences Atomic and molecular physics}, web_url = {http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html\#affil-auth}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Macmillan Publishers Limited}, address = {Basingstoke, Hampshire RG21 6XS, United Kingdom}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms7811}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html\#affil-auth}, author = {Peise, J and L{\"u}cke, B and Pezze, L and Deuretzbacher, F and Ertmer, W and Arlt, J and Smerzi, A and Santos, L and Klempt, C} } @Article { , title = {Infrasonic and low-frequency insert earphone hearing threshold}, journal = {JASA}, year = {2015}, month = {4}, day = {10}, volume = {137 (2015-April)}, number = {4}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {EL347-EL353}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1121/1.4916795}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"u}hler, R and Fedtke, T and Hensel, J} } @Article { , title = {Evaluation and Selection of High-Temperature Fixed-Point Cells for Thermodynamic Temperature Assignment}, journal = {Int J Thermophys}, year = {2015}, month = {4}, day = {5}, volume = {36}, number = {8}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1834-1847}, keywords = {High-temperature fixed points · Metal-carbon eutectics · Radiation thermometry · Temperature standards · Thermodynamic temperature}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1860-0}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Link}, address = {Europe/Asia/Africa}, language = {30}, ISSN = {NA}, DOI = {10.1007/s10765-015-1860-0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yamada, Y and Anhalt, K and Battuello, M and Bloembergen, P and Khlevnoy, B and Machin, G and Matveyev, M and Sadli, M and Todd, A and Wang, T} } @Article { , title = {Positive operator-valued measure reconstruction of a beam-splitter tree-based photon-number-resolving detector}, journal = {OPTICS LETTERS}, year = {2015}, month = {4}, day = {1}, volume = {40}, number = {7}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {1548-1551}, keywords = {Quantum optics, Quantum detectors, Quantum information and processing.}, web_url = {https://www.osapublishing.org/ol/home.cfm}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington}, language = {30}, ISSN = {0146-9592}, DOI = {10.1364/OL.40.001548}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-4-1}, author = {Piacentini, F. and Levi, M. P. and Avella, A. and L{\'o}pez, M. and K{\"u}ck, S. and Polyakov, S. V. and Degiovanni, I. P. and Brida, G. and Genovese, M.} } @Article { , title = {Bayesian analysis of a flow meter calibration problem}, journal = {Metrologia}, year = {2015}, month = {4}, day = {1}, volume = {52}, number = {2}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {392-399}, keywords = {Bayesian analysis, prior knowledge, posterior distribution, calibration, flow meter, least squares, regression}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/2/392/meta}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {BIPM}, address = {S{\`e}vres}, language = {30}, ISSN = {-}, DOI = {10.1088/0026-1394/52/2/392}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kok, G. J. P. and Van der Veen, A. M. H. and Harris, P. M. and Smith, I. M. and Elster, C.} } @Article { , title = {Flow Cytometry - Reference Procedure for the Measurement of Stem Cell Concentrations in Apheresis Products}, journal = {PTB mitteilungen - Traceable Dynamic Measurement of Mechanical Quantities}, year = {2015}, month = {4}, volume = {2}, number = {02 2015}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {70-73}, keywords = {quantitative measurement, stem cells, reference procedure, flow cytometry}, web_url = {www.ptb.de/cms/resources/internet/publikationen/ptb_mitteilungen/mitt2015/Heft2/PTB-Mitteilungen_2015_Heft_2.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Physikalisch-Technische Bundesanstalt (ed.)}, address = {Brunswick \& Berlin}, language = {30}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.ptb.de/cms/resources/internet/publikationen/ptb_mitteilungen/mitt2015/Heft2/PTB-Mitteilungen_2015_Heft_2.pdf}, author = {Neukammer, J. and Kammel, M. and H{\"o}ckner, J. and Kummrow, A. and Ruf, A.} } @Article { , title = {Detection efficiency calibration of single-photon silicon avalanche photodiodes traceable using double attenuator technique}, journal = {Journal of Modern Optics}, year = {2015}, month = {3}, day = {27}, volume = {62}, number = {S2}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {S21-S27}, keywords = {detection efficiency, Si-SPAD, photon statistics}, web_url = {http://www.tandfonline.com/loi/tmop20}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Taylor \& Francis.}, address = {London}, language = {30}, ISSN = {0950-0340}, DOI = {10.1080/09500340.2015.1021724}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\'o}pez, M. and Hofer, H. and K{\"u}ck, S.} } @Article { AzumaBBBBBCDFFHKKKMMMMNNPRRSSVWWZ, title = {Improved measurement results for the Avogadro constant using a 28Si-enriched crystal}, journal = {Metrologia}, year = {2015}, month = {3}, day = {25}, volume = {52}, number = {2}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, keywords = {fundamental constants, Avogadro constant, kilogram}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0026-1394/52/2/360}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Azuma, Y and Barat, P and Bartl, G and Bettin, H and Borys, M and Busch, I and Cibik, L and D’Agostino, G and Fujii, K and Fujimoto, H and Hioki, A and Krumrey, M and Kuetgens, U and Kuramoto, N and Mana, G and Massa, E and Mee{\ss}, R and Mizushima, S and Narukawa, T and Nicolaus, A and Pramann, A and Rabb, S A and Rienitz, O and Sasso, C and Stock, M and Vocke Jr, R D and Waseda, A and Wundrack, S and Zakel, S} } @Article { , title = {Status and Strategy for Moisture Metrology in European Metrology Institutes}, journal = {Int. J. Thermophysics}, year = {2015}, month = {3}, day = {22}, volume = {36}, number = {8}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {2185-2198}, keywords = {Certified reference materials · Measurement traceability · Moisture content · Strategy · Water content}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1859-6}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer International Publishing AG}, address = {Teddington}, language = {30}, ISSN = {NA}, DOI = {10.1007/s10765-015-1859-6}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bell, S and Bose, N and Bosma, R and Buzoianu, M and Carroll, P and Frenicola, V and Georgin, E and Heinonen, M and Kentved, A and Melvad, C and Nielsen, J} } @Article { , title = {Improvements to the volume measurement of 28Si spheres to determine the Avogadro constant}, journal = {IEEE Transaction on Instrumentation and Measurement}, year = {2015}, month = {3}, day = {19}, volume = {64}, number = {6}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {1650-1656}, keywords = {Avogadro constant, diameter measurement, optical interferometer, silicon crystal, spectroscopic ellipsometer, volume measurement.}, web_url = {http://ieeexplore.ieee.org/xpl/abstractCitations.jsp?arnumber=7063918\&refinements\%3D4294557292\%26filter\%3DAND\%28p_IS_Number\%3A7104190\%29}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institution of Electrical and Electrical Engineering (IEEE)}, address = {Piscataway}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2401212}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {INSPEC 15111473}, author = {Kuramoto, N.K. and Azuma, Y. A and Inaba, H. I. and Hong, F-L. H. and Fujii, K. F} } @Article { , title = {Angle Resolved Scattering as a tribological investigation tool for surface characterization}, journal = {Wear}, year = {2015}, month = {3}, day = {15}, volume = {326-327}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {58-67}, keywords = {Surface roughness, Angle-resolved scattering, Wear, Isotropy}, web_url = {https://www.researchgate.net/publication/270344579_Angle_resolved_scattering_as_a_tribological_investigation_tool_for_surface_characterization}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, ISSN = {0043-1648}, DOI = {10.1016/j.wear.2014.12.040}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Azouigui, SA and Silvestri, ZS and Zerrouki, CZ and Plimmer, MP and Spaltmann, DS and Kovalev, AK and Woydt, MW and Pinot, PP} } @Article { KangGAGM2015, title = {Demonstration of a high-performance pulsed optically pumped Rb clock based on a compact magnetron-type microwave cavity}, journal = {Journal of Applied Physics}, year = {2015}, month = {3}, day = {12}, volume = {117}, number = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, keywords = {atomic clock, microwave cavity, optical pumping, POP}, web_url = {http://scitation.aip.org/content/aip/journal/jap/117/10/10.1063/1.4914493}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, ISSN = {0021-8979}, DOI = {10.1063/1.4914493}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kang, S. and Gharavipour, M. and Affolderbach, C. and Gruet, F. and Mileti, G.} } @Article { , title = {Metrology for drug delivery}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {3}, day = {9}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {271-275}, keywords = {drug delivery; infusion technology; low infusion rates; metrology; multi-pump infusion; underestimated risks.}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0155}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lucas, P. and Klein, S.} } @Article { KrehlikS2015, title = {Multipoint joint time and frequency dissemination in delay-stabilized fiber optic links}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2015}, month = {3}, volume = {62}, number = {3}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {412-420}, keywords = {Optical fibers, Uncertainty, Delays, Calibration, Propagation delay, Optical receivers}, web_url = {https://ieeexplore.ieee.org/iel7/58/7055429/07055436.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2014.006773}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L.} } @Article { , title = {Variable aperture extraction lens for ion beam investigation in inductively coupled plasma-mass spectrometry}, journal = {JOURNAL OF ANALYTICAL ATOMIC SPECTROMETRY}, year = {2015}, month = {2}, day = {25}, volume = {30}, number = {6}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {1329 - 1335}, keywords = {ICP-MS, HALF-LIFE, 2ND VACUUM STAGE, TIME-RESOLVED MEASUREMENTS, SKIMMER, DENSITY, INTERFACE, FRACTIONATION}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {0267-9477}, DOI = {10.1039/c4ja00150h}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kivel, Niko and Potthast, Heiko-Dirk and Guenther-Leopold, Ines and Vanhaecke, Frank and Guenther, Detlef} } @Article { , title = {Traceability of In-Process Measurement of Workpiece Geometry}, journal = {Procedia Engineering}, year = {2015}, month = {2}, day = {24}, volume = {100}, number = {-}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {376-383}, keywords = {Traceability; production process; calibration; measurement standard; machine-tool capability}, web_url = {http://www.sciencedirect.com/science/article/pii/S1877705815004087}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {1877-7058}, DOI = {10.1016/j.proeng.2015.01.381}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Acko, Bojan and Klobucar, Rok and Acko, Matic} } @Article { , title = {Wafer-scale homogeneity of transport properties in epitaxial graphene on SiC}, journal = {Carbon}, year = {2015}, month = {2}, day = {23}, volume = {87}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {409-414}, keywords = {wafer-scale, graphene, SiC}, web_url = {http://liu.diva-portal.org/smash/record.jsf?pid=diva2\%3A811295\&dswid=-258}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, language = {30}, ISSN = {0008-6223}, DOI = {10.1016/j.carbon.2015.02.058}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yager, T. and Lartsev, A. and Yakimova, R. and Lara-Avila, S. and Kubatkin, S.} } @Article { KhamlichiG2015_2, subid = {1097}, title = {Calibration Setup For Traceable Measurements Of Very Fast Transients}, journal = {Springer}, year = {2015}, month = {2}, day = {19}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {Calibration, setup, transients}, misc2 = {EMPIR 2015: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3238169}, stag_bib_extends_levelofaccess = {NA}, author = {Khamlichi, A. and Garnacho, F.} } @Article { , title = {HfTi-nanoSQUID gradiometers with high linearity}, journal = {Applied Physics Letters}, year = {2015}, month = {2}, day = {17}, volume = {106}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {072601}, keywords = {nanoSQUID gradiometers, metrology}, web_url = {http://scitation.aip.org/content/aip/journal/apl/106/7/10.1063/1.4909523}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, address = {Melville, New York}, language = {30}, ISSN = {n/a}, DOI = {10.1063/1.4909523}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-8-17}, author = {Bechstein, S and Ruede, F and Drung, D and Storm, J. -H. and Kieler, O. F. and Kohlmann, J. and Weimann, T. and Schurig, T.} } @Article { KuepferlingZSVDPRRB2015, title = {Vortex dynamics in Co-Fe-B magnetic tunnel junctions in presence of defects}, journal = {Journal of Applied Physics}, year = {2015}, month = {2}, day = {13}, volume = {117}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, web_url = {http://scitation.aip.org/content/aip/journal/jap/117/17/10.1063/1.4908142}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {0021-8979}, DOI = {10.1063/1.4908142}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kuepferling, M. and Zullino, S. and Sola, A. and Van de Wiele, B. and Durin, G. and Pasquale, M. and Rott, K. and Reiss, G. and Bertotti, G.} } @Article { , title = {Two-photon interference from a quantum dot microcavity: Persistent pure dephasing and suppression of time jitter}, journal = {Physical Review B}, year = {2015}, month = {2}, day = {12}, volume = {91}, number = {7}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {075413}, keywords = {Two-photon interference , indistinguishability, Hong-Ou-Mandel interference,Purcell enhancements}, web_url = {http://journals.aps.org/prb/}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {Washington}, language = {30}, ISSN = {1098-0121}, DOI = {10.1103/PhysRevB.91.075413}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Unsleber, Sebastian and McCutcheon, Dara P. S. and Dambach, Michael and Lermer, Matthias and Gregersen, Niels and H{\"o}fling, Sven and M{\o}rk, Jesper and Schneider, Christian and Kamp, Martin} } @Article { , title = {Scattering of two photons on a quantum emitter in a one-dimensional waveguide: exact dynamics and induced correlations}, journal = {New Journal of Physics}, year = {2015}, month = {2}, day = {10}, volume = {17}, number = {2}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {023030}, keywords = {two photons scattering, quantum emitter, quantum correlations}, web_url = {http://iopscience.iop.org/1367-2630}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOPScience}, address = {Bristol (UK)}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/17/2/023030}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Nysteen, Anders and Kristensen, Philip Tr{\o}st and McCutcheon, Dara P S and Kaer, Per and M{\o}rk, Jesper} } @Article { , title = {Precision measurement of a potential-profile tunable single-electron pump}, journal = {Metrologia}, year = {2015}, month = {2}, day = {5}, volume = {52}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {195-200}, keywords = {single electron pump, quantum current standard, QD electron pump}, web_url = {http://m.iopscience.iop.org/0026-1394/52/2/195}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1088/0026-1394/52/2/195}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bae, M.-H. and Ahn, Y.-H. and Seo, M. and Chung, Y. and Fletcher, J. D. and Giblin, S. P. and Kataoka, M. and Kim, N.} } @Article { ZikmundRKHA, title = {Precise scalar calibration of a tri-axial Braunbek coil system}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {2}, day = {2}, volume = {51}, number = {1}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2357783}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zikmund, A. and Ripka, P. and Ketzler, R. and Harcken, H. and Albrecht, M.} } @Article { , title = {Surface Layer Analysis of Si Sphere by XRF and XPS}, journal = {IEEE Transaction on Instrumentation and Measurement}, year = {2015}, month = {2}, day = {2}, volume = {64}, number = {6}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {1509-1513}, keywords = {Chemical analysis, silicon, surface contamination, thickness measurement, X-ray spectroscopy}, web_url = {http://ieeexplore.ieee.org/xpl/abstractAuthors.jsp?arnumber=7029043\&refinements\%3D4294557292\%26filter\%3DAND\%28p_IS_Number\%3A7104190\%29}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institution of Electrical and Electrical Engineering (IEEE)}, address = {Piscataway}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2389352}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {INSPEC Accession Number: 15111454}, author = {Zhang, L. Z. and Azuma, Y. A. and Kurokawa, A. K. and Kuramoto, N. K. and Fujii, K. F.} } @Article { KubatkinLYLY2015, title = {The effect of bilayer domains on electronic transport properties of epitaxial graphene on SiC}, journal = {arXiv.org}, year = {2015}, month = {2}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {bilayer domains, epitaxial graphene, SiC, Magnetotransport, epitaxial graphene, Silicon Carbide (SiC/G), bilayer graphene,}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Mesoscale and Nanoscale Physics (cond-mat.mes-hall)}, address = {Ithaca, NY 14850, USA}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1502.02013}, author = {Kubatkin, Sergey and Lara-Avila, Samuel and Yakimova, Rosita and Lartsev, Arseniy and Yager, Tom} } @Article { , title = {High mobility epitaxial graphene devices via aqueous-ozone processing}, journal = {High mobility epitaxial graphene devices via aqueous-ozone processing}, year = {2015}, month = {2}, volume = {106}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {063503}, keywords = {graphene, aqueous-ozone, monolayer,}, web_url = {http://scitation.aip.org/content/aip/journal/apl/106/6/10.1063/1.4907947}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4907947}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yager, T. and Webb, M.J. and Grennberg, H. and Yakimova, R. and Lara-Avila, S. and Kubatkin, S.} } @Article { , title = {Structural, optical and electrostatic properties of single and fewlayers MoS2: effect of substrate}, journal = {Structural, optical and electrostatic properties of single and fewlayers MoS2: effect of substrate}, year = {2015}, month = {2}, volume = {2}, number = {1}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {015005}, keywords = {two dimensional materials, MoS2, nanomechanics, substrate interaction, Kelvin probe, ultrasonic force microscopy, Raman}, web_url = {http://iopscience.iop.org/article/10.1088/2053-1583/2/1/015005}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/2/1/015005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Robinson, B. J. and Giusca, C. E. and Gonzalez, Y. T. and Kay, N. D. and Kazakova, O. and Kolosov, O. V.} } @Proceedings { , title = {A model-based approach for the dynamic calibration of torque transducers}, year = {2015}, month = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {61-71}, keywords = {dynamic calibration, mechanical modelling, model parameter identification, dynamic measurement, dynamic torque calibration}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Orlando USA}, event_name = {International Modal Analysis Conference IMAC XXXIII}, event_date = {02-02-2015 to 05-02-2015}, language = {30}, ISBN = {978-3-319-15211-0}, DOI = {10.7795/820.20150414K}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klaus, L. and Kobusch, M. and Bruns, T.} } @Article { ElgHK2015, title = {Optimization of field grading for a 1000 KV wide-band voltage divider}, journal = {Journal of Electrostatics}, year = {2015}, month = {2}, volume = {73}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {140-150}, keywords = {HVDC transmission; Electromagnetic fields; Finite element methods; Voltage dividers; Voltage measurement}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3886}, DOI = {10.1016/j.elstat.2014.11.005}, stag_bib_extends_levelofaccess = {NA}, author = {Elg, A.P. and H{\"a}llstr{\"o}m, J. and Kl{\"u}ss, J.} } @Article { , title = {Mass Measurement of 1-kg Silicon Spheres for Determination of the Avogadro and Planck Constants}, journal = {IEEE Transaction on Instrumentation and Measurement}, year = {2015}, month = {1}, day = {27}, volume = {64}, number = {6}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {1527-1532}, keywords = {Avogadro’s constant, mass measurement, Planck’s constant, silicon sphere}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7024156\&refinements\%3D4294557292\%26filter\%3DAND\%28p_IS_Number\%3A7104190\%29}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institution of Electrical and Electrical Engineering (IEEE)}, address = {Piscataway}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2389351}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {INSPEC Accession Number: 15111471}, author = {Mizushima, S. M. and Kuramoto, N. K. and Ueda, K. U. and Fujii, K. F.} } @Article { , title = {Homogeneity Characterization of Lattice Spacing of Silicon Single Crystals}, journal = {IEEE Transaction on Instrumentation and Measurement}, year = {2015}, month = {1}, day = {17}, volume = {64}, number = {6}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {1692-1695}, keywords = {Avogadro constant, impurity, lattice comparator, lattice spacing, silicon single crystal}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7004030\&refinements\%3D4294557292\%26filter\%3DAND\%28p_IS_Number\%3A7104190\%29}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institution of Electrical and Electrical Engineering (IEEE)}, address = {Piscataway}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2014.2383091}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {INSPEC Accession Number: 15111465}, author = {Waseda, A. W. and Fujimoto, H. F. and Zhang, X. Z. and Kuramoto, N. K. and Fujii, K. F.} } @Article { , title = {Precise method of estimation of semiconductor laser phase-noise-to-intensity-noise conversion in dispersive fiber}, journal = {Measurement}, year = {2015}, month = {1}, day = {16}, volume = {65}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {54 - 60}, keywords = {Laser phase noise Noise conversion Fiber optic systems Time transfer Frequency transfer}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1016/j.measurement.2014.12.054}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Krehlik, P. and Śliwczyński, L.} } @Article { , title = {Informative prior distributions for ELISA analyses}, journal = {Biostatistics}, year = {2015}, month = {1}, day = {9}, volume = {16}, number = {3}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {454-464}, keywords = {4-parametric logistic function; Bayesian inference; CCQM-P58.1; ELISA; Heteroscedastic variance; Immunoassay; Informative prior; Metrology; Non-linear modeling; Prior knowledge.}, tags = {MAT}, web_url = {http://biostatistics.oxfordjournals.org/content/16/3/454}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Oxford University Press}, address = {Oxford}, language = {30}, ISSN = {-}, DOI = {10.1093/biostatistics/kxu057}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klauenberg, K. and Walzel, M. and Ebert, B. and Elster, C.} } @Article { , title = {Contact-free sheet resistance determination of large area graphene layers by an open}, journal = {Journal of Applied Physics}, year = {2015}, month = {1}, day = {9}, volume = {117}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {024501}, keywords = {graphene, dielectic thin films, quartz, electrical resistivity, microwaves}, web_url = {http://scitation.aip.org/content/aip/journal/jap/117/2/10.1063/1.4903820}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {n/a}, DOI = {10.1063/1.4903820}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaforost, O and Wang, K and Goniszewski, S and Adabi, M and Guo, Z and Hanham, S and Gallop, J and Hao, L and Klein, N} } @Article { , title = {Ultrastable long-distance fiber-optic time transfer: Active compensation over a wide range of delays}, journal = {Metrologia}, year = {2015}, month = {1}, day = {7}, volume = {52}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {82 - 88}, keywords = {time transfer, frequency transfer, fibre optics}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1088/0026-1394/52/1/82}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Krehlik, P. and Śliwczyński, L. and Buczek, L. and Kołodziej, J. and Lipiński, M.} } @Article { , title = {Alternative Methods of Blackbody Thermodynamic Temperature Measurement Above Silver Point}, journal = {International Journal of Thermophysics}, year = {2015}, month = {1}, day = {7}, volume = {36}, number = {2}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {252-266}, keywords = {Blackbody, Double wavelength technique, High-temperature fixed points, Method of ratios, Synchrotron radiation, Thermodynamic temperature}, web_url = {http://link.springer.com/article/10.1007/s10765-014-1826-7}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Link}, address = {Europe/Asia/Africa}, language = {30}, DOI = {10.1007/s10765-014-1826-7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Prokhorov, A and Sapritsky, V and Khlevnoy, B and Gavrllov, V} } @Article { , title = {Determining the viscoelastic properties obtained by depth sensing microindentation of epoxy and polyester thermosets using a new phenomenological method}, journal = {Materials Research Express}, year = {2015}, month = {1}, day = {2}, volume = {2}, number = {1}, number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials}, pages = {015301}, web_url = {http://iopscience.iop.org/article/10.1088/2053-1591/2/1/015301/pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, address = {London}, language = {30}, ISSN = {2053-1591}, DOI = {10.1088/2053-1591/2/1/015301}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kohl, JGK and Schwarzer, NS and Ngo, TTN and Favaro, GF and Rengnet, ER and Bierwisch, NB} } @Article { , title = {Frequency Noise Processes in a Strontium Ion Optical Clock}, journal = {J. Phys. B: At. Mol. Opt. Phys}, year = {2015}, month = {1}, volume = {48}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {http://iopscience.iop.org/0953-4075/48/3/035401/}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0022-3700}, DOI = {10.1088/0953-4075/48/3/035401}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barwood, GP and Huang, G and King, SA and Klein, HA and Gill, P} } @Article { , title = {Calibration of bridge-, charge- and voltage amplifiers for dynamic measurement applications}, journal = {Metrologia}, year = {2015}, month = {1}, volume = {52}, number = {1}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {72-81}, keywords = {dynamic calibration bridge amplifier charge amplifier voltage amplifier}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing on behalf of Bureau International des Poids et Mesures}, address = {Bristol}, language = {30}, ISSN = {ISSN 0026-1394 (print) ; ISSN 1681-7575 (online)}, DOI = {10.1088/0026-1394/52/1/72}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Klaus, L. and Bruns, Th. and Volkers, H.} } @Article { , title = {Absolute distance measurementby dual-comb interferometry with multi-channel digital lock-in phase detection}, journal = {Meas. Sci. Technol.}, year = {2015}, volume = {26 (8)}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1088/0957-0233/26/8/084001}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yang, R. and Pollinger, F. and Meiners-Hagen, K. and Krystek, M. and Tan, J. and Bosse, H.} } @Proceedings { , title = {Self-compensating networks for four terminal-pair impedance definition in current comparator bridges}, journal = {Proceedings of the 2015 IEEE International Instrumentation and Measurement Technology Conference}, year = {2015}, volume = {-}, number = {-}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {1658-1661}, keywords = {Impedance measurement, bridge circuits, digital-analog conversion, electromagnetic devices, precision measurements.}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Luca Callegaro}, address = {INRIM, Torino, Italy}, event_place = {Pisa, Italy}, event_name = {2015 IEEE International Instrumentation and Measurement Technology Conference}, event_date = {2015-05- 11-14}, language = {30}, ISBN = {-}, ISSN = {978-1-4799-6113-9}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Callegaro, Luca and D'Elia, V. and Pourdanesh, Faranak and Trinchera, Bruno and Kucera, J. and Ortolano, Massimo} } @Article { KlapetekVPPMYM2015, title = {Large area high-speed metrology SPM system}, journal = {Nanotechnology}, year = {2015}, volume = {26}, number = {065501}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, keywords = {scanning probe microscopy, high-speed SPM, metrology}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, DOI = {10.1088/0957-4484/26/6/065501}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P and Valtr, M and Picco, L and Payton, O D and Martinek, J and Yacoot, A and Miles, M} } @Proceedings { BosseBDFFHKKW2015, title = {Challenges in nanometrology: high precision measurement of position and size}, year = {2015}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, keywords = {traceability, measurement uncertainty, New SI, interferometry, line scale length encoder, straightness, photomask, CD metrology, signal modeling, reference}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Ilmenau, Germany}, event_name = {58th IWK Ilmenau Scientific Colloquium}, event_date = {12 September 2014}, DOI = {10.1515/teme-2015-0002}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bosse, Harald and Bodermann, Bernd and Dai, Gaoliang and Fl{\"u}gge, Jens and Frase, Carl Georg and H{\"a}{\ss}ler-Grohn, Wolfgang and K{\"o}chert, Paul and K{\"o}ning, Rainer and Weichert, Christoph} } @Proceedings { , title = {Compact and high-performance Rb clock based on pulsed optical pumping for industrial application}, year = {2015}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {800-803}, keywords = {Rb clock; POP; frequency stability; magnetron-type cavity.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Denver CO, USA}, event_name = {2015 JOINT CONFERENCE OF THE IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM \& European Frequency and Time Forum}, event_date = {13-17 April 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kang, S. and Gharavipour, M. and Gruet, F. and Affolderbach, C. and Mileti, G.} } @Article { , title = {Ultrastable low-noise current amplifier: a novel device for measuring small electric currents with high accuracy}, journal = {Rev. Sci. Instrum.}, year = {2015}, volume = {86}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1063/1.4907358}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Drung, D. and Krause, C. and Becker, U. and Scherer, H. and Ahlers, F. J.} } @Article { , title = {Energy dependence of Fricke-xylenol orange gel and gel based on Turnbull blue for low-energy photons}, journal = {Journal of Physics: Conference Series}, year = {2015}, volume = {573}, number = {1}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {1-4}, keywords = {gel dosimeters, photon radiation, Fricke gel}, web_url = {http://iopscience.iop.org/1742-6596/573/1/012069}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {1742-6596}, DOI = {10.1088/1742-6596/573/1/012069}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Solc, J. and Sochor, V. and Kozub{\'i}kov{\'a}, P.} } @Proceedings { , title = {Focused ultrasound temperature effect in tissue-mimicking material and sheep liver}, journal = {IEEE Xplore Conference Publications}, year = {2015}, volume = {-}, number = {-}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {131-134}, keywords = {IFU; temperature measurements; TMM; tissue phantom; metrolog}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7145186}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IEEE}, address = {-}, event_place = {Lisbon}, event_name = {Medical Measurements and Applications}, event_date = {11.06.2014}, language = {30}, ISBN = {-}, ISSN = {78-1-4799-6477-2/15/$31.00 ©2015 IEEE}, DOI = {10.1109/MeMeA.2015.7145186}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Karab{\"o}ce, Baki} } @Proceedings { , title = {Characterization of pressure fields of focused transducers at TUBITAK UME}, journal = {Physics Procedia}, year = {2015}, volume = {70C}, number = {-}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1241-1245}, keywords = {HIFU-High Intensity Focused Ultrasound; Pressure field; Hydrophone; KZK model; Metrology}, web_url = {-}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier}, address = {-}, event_place = {Metz-France}, event_name = {International Congress of Ultrasonics}, event_date = {10.05.2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1016/j.phpro.2015.08.276}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Karab{\"o}ce, Baki and Şahin, Ali and İnce, Ahmet T. and Skarlatos, Yani} } @Proceedings { , title = {Visual investigation of heating effect in liver and lung induced by a HIFU transducer}, journal = {Physics Procedia}, year = {2015}, volume = {70C}, number = {-}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1225-1228}, keywords = {High Intensity Focused Ultrasound; Tissue Mimicking Material; Visual investigation; Liver; Lung; Heating}, web_url = {-}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier}, address = {-}, event_place = {Metz-France}, event_name = {International Congress of Ultrasonics}, event_date = {10.05.2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1016/j.phpro.2015.08.264}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Karab{\"o}ce, Baki and Durmuş, H{\"u}seyin Okan} } @Article { , title = {Experiences with a two terminal-pair digital impedance bridge}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, volume = {64}, number = {6}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {1460 - 1465}, keywords = {Impedance measurement, bridge circuits, digital-analog conversion, electromagnetic devices, precision measurements.}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Luca Callegaro}, address = {INRIM, Torino, Italy}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2401192}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Callegaro, Luca and D'Elia, V. and Kampik, Marian and Kim, Dan Bee and Ortolano, Massimo and Pourdanesh, Faranak} } @Article { , title = {Results of the EURAMET.RI(II)-S6.I-129 Supplementary Comparison}, journal = {Metrologia Tech. Suppl.}, year = {2015}, volume = {52}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {06017}, keywords = {Activity measurements; I-129; International comparisons}, web_url = {http://iopscience.iop.org/0026-1394}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Institute of Physcis Science}, address = {Bristol, UK}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/0026-1394/52/1A/06017}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-1}, author = {Garcia-Tora{\~n}o, E. and Altzitzoglou, T. and Pavel Auerbach, P. and B{\'e}, M.M. and Lourenco, V. and Bobin, C. and Cassette, P. and Dersch, R. and Kossert, K. and N{\"a}hle, O. and Peyr{\'e}s, V. and Pomm{\'e}, S. and Rozkov, A. and Sanchez-Cabezudo, A. and Sochorov{\'a}, J.} } @Proceedings { , title = {Provisional Assessment of Candidate High-Temperature Thermal Conductivity Reference Materials in the EMRP “Thermo” Project}, journal = {32nd International Thermal Conductivity Conference and 20th International Thermal Expansion Symposium}, year = {2015}, volume = {N/A}, number = {N/A}, number2 = {SIB52: Thermo: Metrology for thermal protection materials}, pages = {142-153}, keywords = {thermal conductivity, reference material, provisional assessment, high temperature, dimensional stability, mechanical stability, chemical stability, uniformity}, web_url = {http://docs.lib.purdue.edu/thermal/2014/steady/5/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Purdue University Press}, address = {West Lafayette, IN, USA}, event_place = {Purdue University, West Lafayette, Indiana, USA}, event_name = {32nd International Thermal Conductivity Conference}, event_date = {Apr. 27 - May 1, 2014}, language = {30}, ISBN = {Print ISBN: 978-1-62671-050-4; ePUB ISBN: 978-1-62671-051-1; ePDF ISBN: 978-1-62671-052-8}, ISSN = {N/A}, DOI = {10.5703/1288284315555}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wu, J. and Morrell, R. and Fry, T. and Gnaniah, S. and Dohil, D. and Dawson, A. and Hameury, J. and Koenen, A. and Hammerschmidt, U. and Turz{\'o}-Andr{\'a}s, E. and Strnad, R. and Blahut, A.} } @Thesis { , title = {Untersuchungen der Abnutzung von AFM-Spitzen}, year = {2015}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, keywords = {atomic force microscope, tip geometry}, web_url = {http://www.tu-ilmenau.de/pms/publikationen/nur-studienabschlussarbeiten/litseite/3/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, school = {Technical University Ilmenau}, language = {43}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Koppe, A.} } @Article { , title = {A dedicated calibration standard for nanoscale areal surface texturemeasurements}, journal = {Microelectronic Engineering}, year = {2015}, volume = {141}, number = {2015}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {250-255}, keywords = {Traceability Calibration standard Areal surface texture Sq Measurement uncertainty}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.mee.2015.04.021}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Koops, R and van Veghel, M and van de Nes, A} } @Proceedings { , title = {Towards traceability in scatterometric-optical dimensional metrology for optical lithography}, journal = {DGaO-Proceedings}, year = {2015}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, web_url = {http://www.dgao-proceedings.de}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Eindhoven, The Netherlands}, event_name = {113th annual meeting of the DGaO}, event_date = {29 May - 1 June 2012}, language = {30}, ISSN = {1614-8436}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bodermann, Bernd and Endres, Johannes and Gro{\ss}, Hermann and Henn, Mark-Alexander and Kato, Akiko and Scholze, Frank and Wurm, Matthias} } @Article { , title = {Fourier ellipsometry – an ellipsometric approach to Fourier scatterometry}, journal = {JEOS}, year = {2015}, volume = {10}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Optical metrology, ellipsometry, scatterometry, RCWA, Fourier scatterometry, sensitivity}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {1990-2573}, DOI = {10.2971/jeos.2015.15002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Petrik, P. and Kumar, N. and Fried, M. and Fodor, B. and Juhasz, G. and Pereira, S.E. and Burger, S. and Urbach, H. P.} } @Proceedings { , title = {Optical characterization of laterally and vertically structured oxides and semiconductors}, journal = {Proc. of SPIE}, year = {2015}, volume = {Vol. 8987}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {ZnO, Ellipsometry, Scatterometry, Material Structure}, web_url = {http://spiedigitallibrary.org/}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1117/12.2042181}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Petrik, P. and Kumar, N. and Agocs, E. and Fodor, B. and Pereira, S. F. and Lohner, T. and Fried, M. and Urbach, H. P.} } @Proceedings { , title = {Investigation of transfer standards in the highest range up to 50 MN within EMRP project SIB 63}, journal = {Proceedings of the 21st IMEKO World Congress}, year = {2015}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {7}, keywords = {transfer standard, meganewton, build-up system}, web_url = {http://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC3-083.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Prague, Czech Republic}, event_name = {XXI IMEKO World Congress}, event_date = {August 30 - September 4}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Tegtmeier, F and Wagner, M and Kumme, R} } @Article { , title = {Brillouin amplification supports 1x 10-20 uncertainty in optical frequency transfer over 1400 km of underground fiber}, journal = {PHYSICAL REVIEW A}, year = {2015}, volume = {92}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1103/PhysRevA.92.021801}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Raupach, S. and Koczwara, A. and Grosche, G.} } @Article { , title = {White Rabbit Precision Time Protocol on Long Distance Fiber Links}, journal = {IEEE Transactions on UFFC}, year = {2015}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, keywords = {Clocks, Timing, Time dissemination, Optical fiber networks, White Rabbit, Precision Time Protocol}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Dierikx, E. F. and Wallin, A. E. and Fordell, T. and Myyry, J. and Koponen, P. and Merimaa, M. and Pinkert, T. J. and Koelemeij, J.C.J. and Peek, H. and Smets, R.} } @Proceedings { , title = {Two-Way Coherent Frequency Transfer in a Commercial DWDM Communication Network in Sweden}, journal = {Frequency Control Symposium \& the European Frequency and Time Forum (FCS), 2015 Joint Conference of the IEEE International}, year = {2015}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {276-279}, keywords = {Frequency transfer, Optical fiber network, Optical fiber, DWDM.}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?reload=true\&arnumber=7138840}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IEEE}, event_place = {Denver, CO}, event_date = {12-16 April 2015}, language = {30}, ISBN = {978-1-4799-8865-5}, DOI = {10.1109/FCS.2015.7138840}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ebenhag, S.-C. and Zelan, M. and Hedekvist, P. O. and Karlsson, M. and Josefsson, B.} } @Proceedings { , title = {An upgraded data acquisition and drive system at the Nanometer}, journal = {ASPE Proceedings}, year = {2015}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {61-66}, keywords = {interferometer}, web_url = {http://aspe.net/technical-meetings/past-aspe-meetings/aspe-summer-2015/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {American Society for Precision Engineering}, address = {Raleigh}, event_place = {Colorado, USA}, event_name = {ASPE Summer Topical Meeting, Precision Interferometric Metrolofy}, event_date = {July 8-10, 2015}, language = {30}, ISBN = {978-1-887706-68-1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"o}chert, P. and K{\"o}ning, R. and Weichert, C. and Fl{\"u}gge, J. and Manske, E.} } @Article { , title = {Custom-shaped metal nanostructures based on DNA origami silhouettes}, journal = {Nanoscale}, year = {2015}, volume = {7}, number = {2015}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {11267–11272}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {The Royal Society of Chemistry}, language = {30}, DOI = {10.1039/c5nr02300a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Shen, B. and Linko, V. and Tapio, K. and Kostianen, M. and Toppair, J.} } @Proceedings { , title = {Nanometrology on Gratings with GISAXS: FEM Reconstruction and Fourier Analysis}, journal = {Proc SPIE}, year = {2015}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {optical metrology, computational lithography, nite element method, grazing incidence scatterometry, electron beam lithography, Fourier transformation}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Jose, California, United States}, event_name = {SPIE Metrology, Inspection, and Process Control for Microlithography XXVII}, event_date = {February 23, 2014}, language = {30}, DOI = {10.1117/12.2046212}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Soltwisch, V. and Wernecke, J. and Haase, A. and Probst, J. and Schoengen, M. and Krumrey, M. and Scholze, F.} } @Proceedings { , title = {Development of a scatterometry reference standard}, journal = {Proc SPIE}, year = {2015}, volume = {9132}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, CD metrology, traceability, reference standard, tool matching, AFM, SEM, rigorous modelling}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brussels, Belgium}, event_name = {SPIE Optical Micro- and Nanometrology V}, event_date = {April 14, 2014}, language = {30}, DOI = {10.1117/12.2052278}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bodermann, B. and Loechel, B. and Scholze, F. and Dai, G. and Wernecke, J. and Endres, J. and Probst, J. and Schoengen, M. and Krumrey, M. and Hansen, P.-E. and Soltwisch, V.} } @Proceedings { , title = {Determination of line profiles on photomasks using DUV, EUV and X-ray scattering}, journal = {Proc SPIE}, year = {2015}, volume = {9231}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {scatterometry, GISAXS, EUV-scatterometry, line structure}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Dresden, Germany}, event_name = {30th European Mask and Lithography Conference}, event_date = {June 24, 2014}, language = {30}, DOI = {10.1117/12.2065941}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Scholze, F. and Bodermann, B. and Burger, S. and Endres, J. and Haase, A. and Krumrey, M. and Laubis, C. and Soltwisch, V. and Ullrich, A. and Wernecke, J.} } @Proceedings { , title = {Measurement comparison of goniometric scatterometry and coherent Fourier scatterometry}, journal = {Proc SPIE}, year = {2015}, volume = {9132}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, CD, pitch, inverse diffraction problem}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brussels, Belgium}, event_name = {SPIE Optical Micro- and Nanometrology V}, event_date = {April 14, 2014}, language = {30}, DOI = {10.1117/12.2052819}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Endres, J. and Kumar, N. and Petrik, P. and Henn, M.-A. and Heidenreich, S. and Pereira, S. F. and Urbach, H. P. and Bodermann, B.} } @Article { , title = {Degeneracy in cryptophane-xenon complex formation in aqueous solution}, journal = {Chemical Communications}, year = {2015}, volume = {51}, number = {9}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {1721 - 1724}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/CC/C4CC08601E\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {PSC Publishing}, address = {Cambridge}, language = {30}, ISSN = {0009-241X (print) ; 1364-548X (online)}, DOI = {10.1039/c4cc08601e}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Korchak, S. and Kilian, W. and Mitschang, L.} } @Article { , title = {Modelling the transmission of beta rays through thin foils in planar geometry}, journal = {Applied Radiation and Isotopes}, year = {2015}, volume = {107}, number = {2016}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {206–213.}, keywords = {Modeling Beta-rays Transmission Planar geometry}, web_url = {http://www.journals.elsevier.com/applied-radiation-and-isotopes/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {ELSEVIER}, address = {Amsterdam, The Netherlands}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.10.024}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stanga, D. and De Felice, P. and Keightley, J. and Capogni, M. and Ionescu, E.} } @Article { , title = {Low contact resistance in epitaxial graphene devices for quantum metrology}, journal = {Low contact resistance in epitaxial graphene devices}, year = {2015}, volume = {5}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {087134}, keywords = {epitaxial graphene, monolayer, measurement, Quantum Hall, bilayer, graphene, chemical sciences, Kemi}, web_url = {http://urn.kb.se/resolve?urn=urn:nbn:se:liu:diva-122071}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AMER INST PHYSICS}, language = {30}, DOI = {10.1063/1.4928653}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yager, T. and Lartsev, A. and Cedergren, K. and Yakimova, R. and Panchal, V. and Kazakova, O. and Tzalenchuk, A. and Ho Kim, K. and Woo Park, Y. and Lara-Avila, S. and Kubatkin, S.} } @Article { , title = {Accurate experimental determination of the isotope effects on the triple point temperature of water. II. Combined dependence on the 18O and 17O abundances}, journal = {Metrologia}, year = {2015}, volume = {52}, number = {6}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {827-834}, keywords = {water triple point, thermometry, oxygen isotopes, isotope correction.}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/6/827/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, Bureau International des Poids et Mesures}, address = {Berlin}, language = {30}, ISSN = {ISSN 0026-1394}, DOI = {10.1088/0026-1394/52/6/827}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Faghihi, V. and Kozick, M. and Aerts-Bijma, A.T and Jansen, H. G. and Spriensma, J.J. and Peruzzi, A. and Meijer, H.A.J.} } @Article { , title = {Methoden der Zellz{\"a}hlung - Referenzverfahren zur Messung von Stammzellkonzentrationen}, journal = {BIOspektrum Wissenschaft Special Durchflusszytometrie}, year = {2015}, volume = {21. Jahrgang}, number = {03.15}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {294-297}, keywords = {quantitative measurement, cell counting, stem cells, reference procedure}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Science+Business Media (ed.)}, address = {Berlin, Heidelberg, Luxembourg}, language = {43}, ISSN = {-}, DOI = {10.1007/s12268-015-0577-8}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Neukammer, J. and Kammel, M. and H{\"o}ckner, J. and Kummrow, A. and Ruf, A.} } @Proceedings { , title = {Flow cytometer for reference measurements of blood cell concentrations with low uncertainty}, journal = {Proceedings 2015 IEEE International Symposium on Medical Measurements and Applications}, year = {2015}, volume = {-}, number = {-}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {517-520}, keywords = {erythrocytes, leukocytes, cell concentration, reference measurement procedure, dead time correction, external quality assurance}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE (ed.)}, address = {New York}, event_place = {Torino, Italy}, event_name = {2015 IEEE International Symposium on Medical Measurements and Applications}, event_date = {07-05-2015 to 09-05-2015}, language = {30}, ISBN = {978-1-4799-6476-5}, ISSN = {978-1-4799-6477-2/15}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP15MEA-USB}, author = {Kammel, M. and Kummrow, A. and John, M. and Witt, K. and Neukammer, J.} } @Article { , title = {NOVEL EQUIPMENT FOR IN-SITU ALPHA SPECTROMETRY WITH GOOD ENERGY RESOLUTION}, journal = {Health Physics}, year = {2015}, volume = {109}, number = {6}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {601-605}, keywords = {in-situ measurements; radionuclide contamination; alpha spectrometry; spectrum unfolding}, web_url = {http://journals.lww.com/health-physics/Abstract/2015/12000/Novel_Equipment_for_In_Situ_Alpha_Spectrometry.22.aspx}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wolters, Kluwer, Lippincott Williams \& Wilkins}, address = {Philadelphia}, language = {30}, ISSN = {-}, DOI = {10.1097/HP.0000000000000360}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {P{\"o}ll{\"a}nen, R. and Turunen, J. and Karhunen, T. and Per{\"a}j{\"a}rvi, K. and Siiskonen, T. and Wirta, M. and Turunen, A.} } @Article { , title = {Activity measurements of barrels filled with radioactive waste}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2015}, volume = {304}, number = {1}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {145–150}, keywords = {Technologically enhanced naturally occurring radioactive materials, Radioactive waste, Activity, Attenuation of gamma-rays, 226Ra, 228Ra}, web_url = {http://link.springer.com/article/10.1007\%2Fs10967-014-3666-0}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Springer}, address = {New York City}, language = {30}, DOI = {10.1007/s10967-014-3666-0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Glavič-Cindro, D. and Korun, M. and Vodenik, B. and Zorko, B.} } @Article { , title = {Accurate measurement of enhancement factor in tip-enhanced Raman spectroscopy through elimination of far-field artefacts}, journal = {Applied Physics Letters}, year = {2014}, month = {12}, day = {28}, volume = {104}, number = {12}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {123106}, web_url = {http://scitation.aip.org/content/aip/journal/apl/104/12/10.1063/1.4869184}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Scitation}, address = {American Institute of Physics}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4869184}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Kumar, N. and Rae, A. and Roy, D.} } @Article { PolyakovGMKPBDRG2014_2, title = {Reconstruction of mode structure of faint light sources and its applications}, journal = {Physica Scripta}, year = {2014}, month = {12}, day = {19}, volume = {2014}, number = {T163}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, keywords = {photon-number statistics, photon-number resolving detection, hight-order correlation function, mode reconstruction}, web_url = {http://iopscience.iop.org/1402-4896/}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, ISSN = {0031-8949}, DOI = {10.1088/0031-8949/2014/T163/014024}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Polyakov, S. V. and Goldschmidt, E. A. and Migdall, A. and K{\"u}ck, S. and Piacentini, F. and Brida, G. and Degiovanni, I. P. and Ruo Berchera, I. and Genovese, M.} } @Article { , title = {A calculable and correlation-based magnetic field fluctuation thermometer}, journal = {Journal of Physics}, year = {2014}, month = {12}, day = {4}, volume = {568}, number = {3}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {032012}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/568/3/032012/pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/1742-6596/568/3/032012}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kirste, A and Regin, M and Engert, J and Drung, D and Schurig, T} } @Article { , title = {Global color estimation of special-effect coatings from measurements by commercially available portable multiangle spectrophotometers}, journal = {Journal of the Optical Society of America A}, year = {2014}, month = {12}, day = {3}, volume = {32}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1-11}, keywords = {OCIS codes: (330.1710) Color, measurement; (330.1720) Color vision; (290.1483) BSDF, BRDF, and BTDF.}, web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-1-1}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {OSA}, address = {Washington, DC, USA}, language = {30}, ISSN = {1084-7529 (print), 1520-8532 (online)}, DOI = {10.1364/JOSAA.32.000001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ferrero, A and Campos, J and Perales, E and Mart{\'i}nez-Verd{\'u}, F. M. and van der Lans, I and Kirchner, E} } @Article { , title = {Partitioning of on-demand electron pairs}, journal = {Nature Nanotechnology}, year = {2014}, month = {12}, day = {1}, volume = {10}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {46-49}, web_url = {http://www.nature.com/nnano/journal/v10/n1/full/nnano.2014.275.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1038/nnano.2014.275}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ubbelohde, N. and Hohls, F. and Kashcheyevs, V. and Wagner, T. and Fricke, L. and K{\"a}stner, B. and Pierz, K. and Schumacher, H. W. and Haug, R. J.} } @Article { , title = {Moisture measurement setup for wood based materials}, journal = {NCSLI Measure J. Meas. Sci.}, year = {2014}, month = {12}, volume = {9}, number = {4}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {56-60}, web_url = {http://www.ncsli.org/I/mj/dfiles/NCSLI_Measure_2014_December.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ojanen, M. and Sairanen, H. and Riski, K. and Kajastie, H. and Heinonen, M.} } @Article { ReischlKN2014, title = {Nanoindentation of gold nanorods with an atomic force microscope}, journal = {Materials Research Express}, year = {2014}, month = {11}, day = {28}, volume = {1}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, keywords = {AFM, nanoindentation, molecular dynamics}, web_url = {http://iopscience.iop.org/2053-1591/1/4/045042/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {English}, DOI = {10.1088/2053-1591/1/4/045042}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Reischl, B and Kuronen, A and Nordlund, K} } @Article { RastelloDSKCPSMIKSHKTBMPTACMKV2014, title = {Metrology for industrial quantum communications: the MIQC project}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {10}, keywords = {Metrology, quantum cryptography, quantum communication}, web_url = {http://iopscience.iop.org/0026-1394/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S267}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rastello, M L and Degiovanni, I P and Sinclair, A G and K{\"u}ck, S and Chunnilall, C J and Porrovecchio, G and Smid, M and Manoocheri, F and Ikonen, E and Kubarsepp, T and Stucki, D and Hong, K S and Kim, S K and Tosi, A and Brida, G and Meda, A and Piacentini, F and Traina, P and Al Natsheh, A and Cheung, J Y and M{\"u}ller, I and Klein, R and Vaigu, A} } @Article { MullerKW2014, title = {Traceable calibration of a fibre-coupled superconducting nano-wire single photon detector using characterized synchrotron radiation.}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {8}, keywords = {Metrology, quantum communication, synchrotron radiation, single photon detector, radiometry}, web_url = {http://iopscience.iop.org/0026-1394/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S329}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, Ingmar and Klein, Roman M and Werner, Lutz} } @Article { , title = {Design and Fabrication of Coupled NanoSQUIDs and NEMS}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2014}, month = {11}, day = {20}, volume = {25}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1602604}, keywords = {SQUIDs, nanoscale Dayem bridges, nanoSUQID, metrology}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6960081\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fxpls\%2Fabs_all.jsp\%3Farnumber\%3D6960081}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2371696}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bechstein, S and Ruede, F and Drung, D and Storm, J.-H. and K{\"o}hn, C and Kieler, O. F. and Kohlmann, J. and Weimann, T. and Patel, T and Li, B and Cox, D and Gallop, J. C. and Hao, L. and Schurig, T} } @Article { , title = {Towards a 1 V Josephson Arbitrary Waveform Synthesizer}, journal = {IEEE TRANSACTIONS ON APPLIED SUPERCONDUCTIVITY}, year = {2014}, month = {11}, day = {3}, volume = {25}, number = {3}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {5}, keywords = {AC Josephson voltage standard, Josephson arbitrary waveform synthesizer, SNS junction, sigma-delta modulation}, web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6945363\&tag=1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2366916}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {14818378}, author = {Kieler, O.F. and Behr, R. and Wendisch, R. and Palafox, L. and Kohlmann, J.} } @Article { CorteLeonKSMAK2014, title = {Tailoring of domain wall devices for sensing applications}, journal = {IEEE}, year = {2014}, month = {11}, volume = {50}, number = {11}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, keywords = {Magnetic domain walls (DWs), magnetic sensors, micromagnetics, nanostructures, numerical simulations}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6971343}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2327803}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Krzysteczko, P. and Schumacher, H. W. and Manzin, A. and Antonov, V. and Kazakova, O.} } @Article { MaringerSKCPGCDVHRMSJDTAHM2014, title = {Radioactive waste management: Review on clearance levelsand acceptance criteria legislation, requirements and standards}, journal = {Applied Radiation and Isotopes}, year = {2014}, month = {11}, volume = {81}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, keywords = {Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal}, web_url = {http://www.sciencedirect.com/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2013.03.046}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Maringer, F.J. and Šur{\'a}ň, J. and Kov{\'a}ř, P. and Chauvenet, B. and Peyres, V. and Garc{\'i}a-Tora{\~n}o, E. and Cozzella, M.L. and De Felice, P. and Vodenik, B. and Hult, M. and Roseng{\aa}rd, U. and Merimaa, M. and Sz{\"u}cs, L. and Jeffery, C. and Dean, J.C.J. and Tymińsk, Z. and Arnold, D. and Hincam, R. and Mirescu, G.} } @Article { , title = {Frequency ratio of two optical clock transitions in 171Yb+ and constraints on the time-variation of fundamental constants}, journal = {Physical Review Letters}, year = {2014}, month = {11}, volume = {113}, number = {21}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, keywords = {Optical frequency metrology, fundamental constants}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.113.210801}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Godun, R. M. and Nisbet-Jones, P. B. R. and Jones, J. M. and King, S. A. and Johnson, L. A. M. and Margolis, H. S. and Szymaniec, K. and Lea, S. N. and Bong, K. and Gill, P.} } @Article { , title = {Investigating the Intrinsic Noise Limit of Dayem Bridge NanoSQUIDs}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2014}, month = {10}, day = {24}, volume = {25}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1602105}, keywords = {SQUIDs, Noise, Junctions, Critical current density (superconductivity), Nanoscale devices, Preamplifiers, Niobium}, web_url = {http://ieeexplore.ieee.org/document/6936295/?reload=true\&arnumber=6936295}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {Melville}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2364920}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Patel, T and Li, B and Gallop, J and Cox, D and Kirby, K and Romans, E and Chen, J and Nisbet, A and Hao, L} } @Article { , title = {Novel and improved techniques for traceable temperature dissemination}, journal = {High Temperatures-High Pressures,}, year = {2014}, month = {10}, day = {13}, volume = {43}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {1-11}, keywords = {Temperature, thermometer, ITS-90, traceability, fixed points, standard platinum resistance thermometer, radiation thermometer, thermocouple}, web_url = {http://www.oldcitypublishing.com/HTHP/HTHPcontents/HTHP43.1contents.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0018-1544}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {del Campo, Dolores and Bojkovski, Jovan and Dobre, Miruna and Filipe, Eduarda and Kalemci, Murat and Merlone, Andrea and Pearce, Jonathan and Peruzzi, Andrea and Sparasci, Fernando and Strnad, Radek and Taubert, Dietert and Turz{\'o}-Andr{\'a}s, Emese} } @Article { KramerMMKHB2014, title = {Experimental Verification of the Individual Energy Dependencies of the PartialL-Shell Photoionization Cross Sections of Pd and Mo}, journal = {Physical Review Letters}, year = {2014}, month = {10}, day = {13}, volume = {113}, number = {16}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, keywords = {Individual Energy Dependencies of the PartialL-Shell Photoionization Cross Sections Pd Mo}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.113.163001}, stag_bib_extends_levelofaccess = {NA}, author = {Kr{\"a}mer, M. and Mantler, M. and Muller, M. and Kolbe, M. and Honicke, P. and Beckhoff, B.} } @Article { , title = {Trends in single-cell analysis by use of ICP-MS}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, month = {10}, day = {1}, volume = {406 / 2014}, number = {27}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {6963–6977}, keywords = {Bioanalytical methodsCell systems/single cell analysisMass spectrometry/ICP-MS}, web_url = {http://link.springer.com/article/10.1007/s00216-014-8143-7}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer Berlin}, address = {Heidelberg}, language = {30}, ISSN = {1618-2642 (print); 1618-2650 (online)}, DOI = {10.1007/s00216-014-8143-7}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mueller, Larissa and Traub, Heike and Jakubowski, Norbert and Drescher, Daniela and Baranov, Vladimir I. and Kneipp, Janina} } @Proceedings { , title = {Free-space Quasi-optical Spectrometer for Material Characterization in the 50-500 GHz Frequency Range}, year = {2014}, month = {10}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {636-639}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Rome, Italy}, event_name = {41st European Microwave Conference}, event_date = {06-09 October, 2014}, language = {30}, DOI = {10.1109/EuMC.2014.6986514}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kazemipour, A. and Hudlicka, M. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Article { CoenePRERPKU2014, title = {Reconstruction of sub-wavelength features and nano-positioning of gratings using coherent Fourier scatterometry}, journal = {Optics Express}, year = {2014}, month = {10}, volume = {22}, number = {20}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {24678}, keywords = {sub-wavelength nano-positioning gratings coherent Fourier scatterometry}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.22.024678}, stag_bib_extends_levelofaccess = {NA}, author = {Coene, W.M.J. and Pereira, S.F. and Roy, S. and El Gawhary, O. and Ramanandan, G.K.P. and Petrik, P. and Kumar, N. and Urbach, H.P.} } @Proceedings { KangAGGCM2014, title = {Pulsed Optical Pumping in a Rb Vapour Cell Using a Compact Magnetron-Type Microwave cavity}, year = {2014}, month = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {545-547}, keywords = {atomic clock, microwave cavity, optical pumping, POP}, web_url = {http://www.eftf.org/previousmeetings.php}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Neuchatel, Switzerland}, event_name = {28th European Frequency and Time Forum (EFTF)}, event_date = {22-26 June 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kang, S. and Affolderbach, C. and Gruet, F. and Gharavipour, M. and Calosso, C. E. and Mileti, G.} } @Article { GattoMonticoneKTMFRODBG2014, title = {Beating the diffraction Abbe limit in confocal microscopy via nonclassical photon statistics}, journal = {Physical Review Letters}, year = {2014}, month = {9}, day = {30}, volume = {113}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {143602 [1 to 5]}, web_url = {http://journals.aps.org/prl/}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.113.143602}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gatto Monticone, D and Katamadze, K and Traina, P and Moreva, E and Forneris, J and Ruo-Berchera, I and Olivero, P and Degiovanni, I. P and Brida, G and Genovese, M} } @Article { KuehneGWSIML2014, title = {Power Balance and Loss Mechanism Analysis in RF Transmit Coil Arrays}, journal = {Magnetic Resonance in Medicine}, year = {2014}, month = {9}, day = {22}, volume = {early view}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {Parallel transmission; coil array; power balance; Poynting theorem; electromagnetic simulation; loss analysis}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {english}, ISSN = {1522-2594}, DOI = {10.1002/mrm.25493}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kuehne, Andre and Goluch, Sigrun and Waxmann, Patrick and Seifert, Frank and Ittermann, Bernd and Moser, Ewald and Laistler, Elmar} } @Article { ChoiRDYKSPLRNGECLSELS2014, title = {Field trial of a quantum secured 10 Gb/s DWDM transmission system over a single installed fiber}, journal = {Optics Express}, year = {2014}, month = {9}, day = {15}, volume = {22}, number = {19}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {23121-23128}, web_url = {http://www.opticsinfobase.org/oe/home.cfm}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {1094-4087}, DOI = {10.1364/OE.22.023121}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Choi, Iris and Rong Zhou, Yu and Dynes, James F. and Yuan, Zhiliang and Klar, Andreas and Sharpe, Andrew and Plews, Alan and Lucamarini, Marco and Radig, Christian and Neubert, J{\"o}rg and Griesser, Helmut and Eiselt, Michael and Chunnilall, Christopher and Lepert, Guillaume and Sinclair, Alastair and Elbers, J{\"o}rg-Peter and Lord, Andrew and Shields, Andrew} } @Proceedings { KazemipourHYSKS2014, title = {Wideband Frequency-Domain Material Characterization Up To 500 GHz}, year = {2014}, month = {9}, day = {14}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, web_url = {http://www.irmmw-thz2014.org/sites/default/files/M5-P7.12_Kazemipour.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {The University of Arizona, Tucson, AZ, USA}, event_name = {39th International Conference on Infrared, Millimeter, and THz Waves}, event_date = {September 14, 2014}, language = {English}, DOI = {10.1109/IRMMW-THz.2014.6956130}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hudlicka, M. and Yee, S.-K. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Proceedings { KazemipourSHKS2014, title = {Probe Correction For Near-Field Scanning With A Dielectric Fiber}, year = {2014}, month = {9}, day = {14}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, web_url = {http://www.irmmw-thz2014.org/sites/default/files/T2_B-17.5_Kazemipour.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {The University of Arizona, Tucson, AZ, USA}, event_name = {39th International Conference on Infrared, Millimeter, and THz Waves}, event_date = {September 14, 2014}, language = {English}, DOI = {10.1109/IRMMW-THz.2014.6956288}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Salhi, M. and Hudlicka, M. and Kleine-Ostmann, T. and Schraderr, T.} } @Article { , title = {A Simple New Method to Calibrate Millimeter-Wave Mixers}, journal = {IEEE Design \& Test}, year = {2014}, month = {9}, day = {12}, volume = {31}, number = {6}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {46-51}, keywords = {mm-wave mixer, conversion-losses, powermeasurement, mixer calibration, vector network analyzer.}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, ISSN = {2168-2356}, DOI = {10.1109/MDAT.2014.2355419}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kazemipour, A. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Article { , title = {D{\'e}termination de l'acc{\'e}l{\'e}ration de la pesanteur pour la balance du watt du LNE}, journal = {Revue Fran\c{c}aise de M{\'e}trologie}, year = {2014}, month = {9}, day = {1}, volume = {36}, number = {2014-04}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {11}, keywords = {GRAVIM{\'E}TRIE, CARTOGRAPHIE GRAVIM{\'E}TRIQUE, MOD{\'E}LISATION GRAVIM{\'E}TRIQUE, INTERF{\'E}ROM{\'E}TRIE ATOMIQUE, BALANCE DU WATT}, web_url = {http://www.metrologie-francaise.fr/fr/publications/RFM/2014/rfm1413.asp}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {LNE}, address = {Paris}, language = {37}, ISSN = {1772-1792}, DOI = {10.1051/rfm/2014013}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Merlet, S{\'e}bastien and Gillot, Pierre and Farah, Tristan and Bodart, Quentin and Le Gouet, Julien and Cheinet, Patrick and Guerlin, Christine and Louchet-Chauvet, Anne and Malossi, Nicola and Kopaev, Alexander and Francis, Olivier and d'Agostino, Giancarlo and Diament, Michel and Genev{\`e}s, G{\'e}rard and Clairon, Andr{\'e} and Landragin, Arnaud and Pereira dos Santos, Franck} } @Article { KazemipourHDSKS2014_2, title = {The Horn Antenna as Gaussian-Source in the mm-Wave Domain}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2014}, month = {9}, volume = {35}, number = {9}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {720-731}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {English}, ISSN = {1866-6892}, DOI = {10.1007/s10762-014-0077-9}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hudlicka, M. and Dickhoff, R. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Proceedings { SchallesFK2014, title = {Reduction of thermal effects on precise dimensional measurements}, year = {2014}, month = {9}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, keywords = {Thermal optimisation, Thermally induced errors, Phase change material, PCM}, web_url = {http://nbn-resolving.org/urn:nbn:de:gbv:ilm1-2014iwk:3}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Ilmenau, Germany}, event_name = {58th ILMENAU SCIENTIFIC COLLOQUIUM}, event_date = {8-10 September 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Schalles, M. and Fl{\"u}gge, J. and K{\"o}ning, R.} } @Article { SairanenHHLK, title = {A Calibration System for Reference Radiosondes that Meets GRUAN Uncertainty Requirements}, journal = {NCSL Measure J. Meas. Sci.}, year = {2014}, month = {9}, volume = {9}, number = {3}, number2 = {ENV07: MeteoMet: Metrology for pressure,temperature,humidity and airspeed in the atmosphere}, web_url = {http://www.ncsli.org/I/mj/dfiles/NCSLI_Measure_2014_Sept.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {30}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Sairanen, Hannu and Heinonen, Martti and H{\"o}gstr{\"o}m, Richard and Lakka, Antti and Kajastie, Heikki} } @Article { , title = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene}, journal = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene}, year = {2014}, month = {9}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {hot carriers, bilayer graphene, energy loss rate, magnetotransport}, web_url = {http://arxiv.org/abs/1409.6267v1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1088/0953-8984/27/16/164202}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, J. and Alexander-Webber, J.A. and Janssen, T.J.B.M. and Tzalenchuk, A. and Yager, T. and Lara Avila, S. and Kubatkin, S. and Myers-Ward, R. L. and Gaskill, D. K. and Nicholas, R.J.} } @Proceedings { , title = {Estimation of test uncertainty for TraCIM reference pairs}, journal = {Advanced Mathematical and Computational Tools in Metrology and Testing X}, year = {2014}, month = {9}, volume = {2014}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {1-8}, tags = {MAT}, web_url = {https://www.researchgate.net/publication/277715555_Estimation_of_Test_Uncertainty_for_TraCIM_Reference_Pairs}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {World Scientific Publishing}, address = {Singapore}, event_place = {St Petersburg, Russia}, event_name = {AMCTM 2014 Advanced Mathematical and Computational Tools in Metrology and Testing}, event_date = {10-09-2014 to 12-09-2014}, language = {30}, ISBN = {978-981-4678-63-6}, DOI = {10.1142/9789814678629_0022}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Keller, FK and Wendt, KW and H{\"a}rtig, FH} } @Article { WeiHLPSKHMN2014, title = {Temperature-Dependent Mollow Triplet Spectra from Single Quantum Dot: Rabi Frequency Renormalization and Sideband Linewidth Insensitivity}, journal = {Physical Review Letters}, year = {2014}, month = {8}, day = {28}, volume = {113}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {097401 [1-5]}, web_url = {http://journals.aps.org/prl/}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.113.097401}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Wei, Y-J and He, Y and Lu, C-Y and Pan, J-W and Schneider, C and Kamp, M and H{\"o}fling, S and McCutcheon, D P S and Nazir, A} } @Article { CaprilePKCLL2014, title = {Microwave properties and damping in [Pt/Co] multilayers with perpendicular anisotropy}, journal = {IEEE MAGNETICS LETTERS}, year = {2014}, month = {8}, day = {27}, volume = {5}, number = {3000304}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, keywords = {Pt-Co multilayers, Spin electronics, information storage, magnetic damping, perpendicular magnetic anisotropy}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6884791}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {1949-307X}, DOI = {10.1109/LMAG.2014.2352596}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Caprile, A. and Pasquale, M. and Kuepferling, M. and Co{\"i}sson, M. and Lee, T. Y. and Lim, S.H} } @Proceedings { , title = {Reduction Technique for Measurement Comparisons with Complex-Valued Measurands}, journal = {Proceedings on 29th Conference on Precision Eletromagnetic Measurements}, year = {2014}, month = {8}, day = {25}, volume = {n.a.}, number = {n.a.}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {20-21}, keywords = {Comparison, complex, complex quantity, equivalence, measurements comparison, measurement uncertainty, uncertainty}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Danvers}, event_place = {Rio de Janeiro}, event_name = {29th Conference on Precision Eletromagnetic Measurements}, event_date = {25-08-2014 to 29-08-2014}, language = {30}, ISBN = {978-1-4799-5205-2}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898238}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-1-1}, author = {Kuhlmann, K. and Judaschke, R.} } @Article { KalmbachSAMNLS2014, title = {Towards a graphene-based quantum impedance standard}, journal = {Applied Physics Letters}, year = {2014}, month = {8}, day = {21}, volume = {105}, number = {073511 (2014)}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1063/1.4893940}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kalmbach, C.-C. and Schurr, J. and Ahlers, F. J. and M{\"u}ller, A. and Novikov, S. and Lebedeva, N. and Satrapinski, A.} } @Article { CorteLeonNMFKSK2014, title = {Anisotropic Magnetoresistance State Space of Permalloy Nanowires with Domain Wall Pinning Geometry}, journal = {Scientific reports}, year = {2014}, month = {8}, day = {13}, volume = {4}, number = {6045}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, keywords = {Magnetic domain walls (DWs), magnetic sensors, micromagnetics, nanostructures, numerical simulations}, web_url = {http://www.nature.com/srep/2014/140813/srep06045/full/srep06045.html}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {2045-2322}, DOI = {10.1038/srep06045}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Leon, Hector and Nabaei, Vahid and Manzin, Alessandra and Fletcher, Jonathan and Krzysteczko, Patryk and Schumacher, Hans W and Kazakova, Olga} } @Article { KungMNT2014, title = {Application of a virtual coordinate measuring machine for measurement uncertainty estimation of aspherical lens parameters}, journal = {Measurement Science and Technology}, year = {2014}, month = {8}, day = {12}, volume = {25}, number = {9}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {microcoordinate metrology, asphere, measurement uncertainty, Monte Carlo simulation, virtual CMM}, web_url = {http://iopscience.iop.org/0957-0233/25/9/094011}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1088/0957-0233/25/9/094011}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ng, A. and Meli, F. and Nicolet, A. and Thalmann, R.} } @Article { , title = {Tuning carrier density across Dirac point in epitaxial graphene on SiC by corona discharge.}, journal = {Applied Physics Letters}, year = {2014}, month = {8}, day = {12}, volume = {105}, number = {6}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {063106}, keywords = {dirac point, graphene, SiC}, web_url = {http://scitation.aip.org/content/aip/journal/apl/105/6/10.1063/1.4892922}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.4892922}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lartsev, A. and Yager, T. and Bergsten, T. and Tzalenchuk, A. and Janssen, T.J.B.M. and Yakimova, R. and Lara-Avila, S. and Kubatkin, S.} } @Proceedings { MeesonPPGLMKLZLKEKMA2014, title = {Measurement and control of single-photon microwave radiation on chip}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {324-325}, keywords = {Cryoelectronics, electromagnetic shielding, microwave photons, microwave sensors, microwave sources, nanoelectronics, single-electron devices, superconducting microwave devices, superconducting qubits}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IEEE}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, event_date = {24-08-2014 to 29-08-2014}, language = {30}, DOI = {10.1109/CPEM.2014.6898390}, stag_bib_extends_levelofaccess = {NA}, author = {Manninen, A.J. and Kemppinen, A. and Enrico, E. and Kataoka, M. and Lindstrom, T. and Zorin, A.B. and Lotkhov, S.V. and Khabipov, M. and M{\"o}tt{\"o}nen, M. and Lake, R.E. and Govenius, J. and Pekola, J.P. and Pashkin, Yu.A. and Meeson, P.J. and Astafiev, O.V.} } @Proceedings { BergmanNKHE2014, title = {Traceability and characterization of a 1000 kV HVDC reference divider}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {Resistors, HVDC transmission, Calibration, Voltage measurement, Measurement uncertainty, Uncertainty, Resistance}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {IEEE}, event_place = {Rio de Janeiro, Brazil}, event_name = {9th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, event_date = {24-08-2014 to 29-08-2014}, language = {30}, DOI = {10.1109/CPEM.2014.6898618}, stag_bib_extends_levelofaccess = {NA}, author = {Bergman, A. and Nieminen, T. and Kharezy, M. and H{\"a}llstr{\"o}m, J. and Elg, A.P.} } @Proceedings { KazemipourHKS2014, title = {A Reliable Simple Method to Extract the Intrinsic Material Properties in Millimeter/Sub-millimeter Wave Domain}, year = {2014}, month = {8}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Rio de Janeiro, Brazil}, event_name = {Conference on Precision Electromagnetic Measurements 2014}, event_date = {24-29 August 2014}, language = {English}, DOI = {10.1109/CPEM.2014.6898516}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hudlicka, M. and Kleine-Ostmann, T. and Schrader, T.} } @Proceedings { RodriguezPLKKKHGCBABSUWW2014, title = {The EMRP project Metrology for III–V materials based high efficiency multi-junction solar cells}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, keywords = {Nanoscale electrical measurement Multijunction solar cells standards high conversion efficiency III-V materials characterization}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {25-08-2014 to 29-08-2014}, language = {30}, ISBN = {978-1-4799-2478-3}, ISSN = {no ISSN}, DOI = {10.1109/CPEM.2014.6898387}, stag_bib_extends_levelofaccess = {NA}, author = {Rodriguez, T. G. and Pollakowski, B. and Lackner, D. and Krupka, J. and Kienberger, F. and Kern, R. and Hoffmann, J. and Gambacorti, N. and Cuenat, A. and Baumgartner, H. and Almuneau, G. and Bounouh, A. and Sametoglu, F. and Usydus, L. and Winter, S. and Witt, F.} } @Proceedings { , title = {Graphene metrology}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {662-663}, keywords = {C,Conductivity,Graphene,Metrology,Microwave measurement,Resistance,Silicon carbide,Substrates,electrical conductivity measurement,functional property,graphene,graphene metrology,graphene morphology,graphene topography,industrial production,joining processes,linking morphology,measurement standards,microwave materials,microwave measurement,noncontact microwave conductivity measurement,quality control,quantum Hall effect,rapid noninvasive quality control}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898559}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898559}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Giusca, C. and Gallop, J. and Hao, L. and Kazakova, O. and Panchal, V. and Pierce, R. and Tzalenchuk, A.} } @Article { KaiserRDYWGFCOSDSWBLLTMWY2014, title = {Interlaboratory assessment of nitrous oxide isotopomer analysis by isotope ratio mass spectrometry and laser spectroscopy: current status and perspectives}, journal = {Rapid Communications in Mass Spectrometry}, year = {2014}, month = {8}, volume = {28}, number = {18}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {1995-2007}, keywords = {mass spectroscopy, laser spectroscopy}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0951-4198}, DOI = {10.1002/rcm.6982}, stag_bib_extends_levelofaccess = {NA}, author = {Kaiser, J. and Ridley, A.R. and Doucett, R.R. and Yarnes, C.T. and Well, R. and Giesemann, A. and Forbes, M. and Casciotti, K.L. and Ostrom, N.E. and Szwec, L. and Dyckmans, J. and Steiker, A.E. and Wissel, H. and Br{\"u}ggemann, N. and Liang, M.C. and Lin, C.T. and Toyoda, S. and Mohn, J. and Wolf, B. and Yoshida, N.} } @Proceedings { SuomalainenMHBDEHLKLMNSW2014, title = {Performance of a modular wideband 1000 kV HVDC reference divider}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {HVDC transmission, Voltage measurement, Calibration, Uncertainty, Capacitance, Resistors, Accuracy}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {IEEE}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, event_date = {24-08-2014 to 29-08-2014}, language = {30}, DOI = {10.1109/CPEM.2014.6898619}, stag_bib_extends_levelofaccess = {NA}, author = {Suomalainen, E.P. and Meisner, J. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Dedeoğlu, S. and Elg, A.P. and Houtzager, E. and Lehtonen, T. and Kl{\"u}ss, J. and Lucas, W. and Merev, A. and Nieminen, T. and Schmidt, M. and Weber, C.} } @Article { PanchalLMYTK2014, title = {Visualisation of edge effects in side-gated graphene nanodevices}, journal = {SCIENTIFIC REPORTS}, year = {2014}, month = {7}, day = {30}, volume = {4 : 5881}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1038/srep05881}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, Vishal and Lartsev, Arseniy and Manzin, Alessandra and Yakimova, Rositza and Tzalenchu, Alexander and Kazakova, Olga} } @Article { KondoB2014, title = {High-lateral-resolution scanning deflectometric profiler using a commercially available autocollimator}, journal = {Measurement Science and Technology}, year = {2014}, month = {7}, day = {24}, volume = {25}, number = {9}, number2 = {SIB58: Angles: Angle metrology}, pages = {095202}, keywords = {flatness, metrological instrumentation, surface form measurement, deflectometry, autocollimator}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/25/9/095202}, stag_bib_extends_levelofaccess = {NA}, author = {Kondo, Y. and Bitou, Y.} } @Article { CalamantePhDFIKKORSSv2014, title = {MR System Operator: Recommended Minimum Requirements for Performing MRI in Human Subjects in a Research Setting}, journal = {JOURNAL OF MAGNETIC RESONANCE IMAGING}, year = {2014}, month = {7}, day = {23}, volume = {early view}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {MR safety; research; human; education; training; guidelines}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {english}, ISSN = {1522-2586}, DOI = {10.1002/jmri.24717}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Calamante, PhD, Fernando and Faulkner Jr., BS, RT, William H. and Ittermann, PhD, Bernd and Kanal, MD, Emanuel and Kimbrell, BSRT, Vera and Owman, RT, Titti and Reeder, MD, PhD, Scott B. and Sawyer, BS, RT, Anne M. and Shellock, PhD, Frank G. and van den Brink, PhD on behalf of the ISMRM Safety Committee, Johan S.} } @Article { LafontRKMCCCZPJSP2014, title = {Quantum Hall resistance standard based on graphene grown by chemical vapor deposition on silicon carbide}, journal = {Cornell University Library}, year = {2014}, month = {7}, day = {14}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, web_url = {http://arxiv.org/abs/1407.3615v1}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lafont, F. and Ribeiro-Palau, R. and Kazazis, D. and Michon, A. and Couturaud, O. and Consejo, C. and Chassagne, T. and Zielinski, M. and Portail, M. and Jouault, B. and Schopfer, F. and Poirier, W.} } @Article { , title = {State of the Art Raman Techniques for Biological Applications}, journal = {Methods}, year = {2014}, month = {7}, day = {1}, volume = {68}, number = {2}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {338-347}, note = {Level of access: Yes It was confirmed by a later email (12/09/2016)}, keywords = {Raman spectroscopy, quantification, nonlinear optics, biomedical}, web_url = {http://www.sciencedirect.com/science/article/pii/S1046202314000905}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {1046-2023}, DOI = {10.1016/j.ymeth.2014.02.035}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Rae, A and Stosch, R and Klapetek, P and Hight Walker, A.R and Roy, D} } @Article { NevasBEPKEG2014, title = {Characterisation of nonlinearities of array spectroradiometers in use for measurements of the terrestrial solar UV irradiance}, journal = {UV News: Newsletter of the Thematic Network for Ultraviolet Measurements}, year = {2014}, month = {7}, volume = {10}, number2 = {ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation}, pages = {9-11}, keywords = {Solar measurements, array spectroradiometer, linearity, characterisation}, web_url = {http://metrology.tkk.fi/uvnet/reports.htm}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {1456-2537}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nevas, Saulius and Blattner, Peter and El Gawhary, Omar and Pulli, Tomi and K{\"a}rh{\"a}, Petri and Egli, Luca and Gr{\"o}bner, Julian} } @Article { GraesslRHDWORKSLFPN2014, title = {Modular 32-Channel Transceiver Coil Array for Cardiac MRI at 7.0T}, journal = {Magnetic Resonance in Medicine}, year = {2014}, month = {7}, volume = {72}, number = {1}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {276 to 290}, keywords = {ultrahigh-field MRI; cardiovascular MRI; transceiver array; parallel imaging}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, ISSN = {1522-2594}, DOI = {10.1002/mrm.24903}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Graessl, Andreas and Renz, Wolfgang and Hezel, Fabian and Dieringer, Matthias A and Winter, Lukas and Oezerdem, Celal and Rieger, Jan and Kellman, Peter and Santoro, Davide and Lindel, Tomasz D and Frauenrath, Tobias and Pfeiffer, Harald and Niendorf, Thoralf} } @Proceedings { , title = {Towards a shock tubemethod for the dynamic calibration of pressure sensors}, year = {2014}, month = {7}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {1-17}, keywords = {dynamic measurement, pressure sensor calibration, shock tube}, web_url = {http://rsta.royalsocietypublishing.org/content/372/2023/20130299}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Cambridge, UK}, event_name = {Philosophical Transactions A of the Royal Society}, event_date = {09-09-2014 to 11-09-2014}, language = {30}, DOI = {10.1098/rsta.2013.0299}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Downes, S. and Knott, A. and Robinson, I.} } @Article { , title = {Feedback control of coherent spin states using weak nondestructive measurements}, journal = {Phys. Rev. A}, year = {2014}, month = {6}, day = {25}, volume = {89}, number = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {063619}, keywords = {37.25.+k,03.67.Pp,03.65.Yz}, web_url = {http://arxiv.org/abs/1405.4749}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1094-1622}, DOI = {10.1103/PhysRevA.89.063619}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vanderbruggen, T and Kohlhaas, R and Bertoldi, A and Cantin, E and Landragin, A and Bouyer, P} } @Thesis { , title = {Characterisation of Ultrasonic Transducers Used in Medical Applications and Investigation of Their Effects in Phantom Tissue}, year = {2014}, month = {6}, day = {24}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, keywords = {Ultrasound, HIFU, pressure field, temperature distribution, KZK model, metrology, input electrical power measurement}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Yeditepe University}, address = {İstanbul}, school = {Istanbul Yeditepe University, Turkey}, language = {30}, ISBN = {---}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-6-1}, author = {Karab{\"o}ce, Baki and Society, Turkish} } @Article { , title = {Self-Referenced Single-Electron Quantized Current Source}, journal = {Physical Review Letters}, year = {2014}, month = {6}, day = {6}, volume = {112}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0031-9007/14/112(22)/226803(5)}, DOI = {10.1103/PhysRevLett.112.226803}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Fricke, L. and Wulf, M. and Kaestner, B. and Hohls, F. and Mirovsky, Ph. and Mackrodt, B. and Dolata, R. and Weimann, Th. and Pierz, K. and Siegner, U. and Schumacher, H. W.} } @Article { ChunnilallDKMS2014, title = {Invited review article: Metrology of single-photon sources and detectors}, journal = {Optical Engineering}, year = {2014}, month = {6}, day = {3}, volume = {53}, number = {8}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {17}, web_url = {http://spie.org/x867.xml}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {1560-2303}, DOI = {10.1117/1.OE.53.8.081910}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Chunnilall, C J and Degiovanni, I P and K{\"u}ck, S and M{\"u}ller, I and Sinclair, A G} } @Article { , title = {Modelling of a dynamic torque calibration device and determination of model parameters}, journal = {Acta IMEKO}, year = {2014}, month = {6}, volume = {3}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {14-18}, keywords = {Dynamic torque calibration Mass moment of inertia Torsional stiffness Sinusoidal excitation Modeling of mechanical systems}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-03\%20(2014)-02-05}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {International Measurement Confederation}, address = {Budapest}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v3i2.79}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Klaus, L. and Bruns, Th. and Kobusch, M.} } @Article { , title = {Towards reliable charge-mobility benchmark measurements for organic semiconductors}, journal = {Organic Electronics}, year = {2014}, month = {6}, volume = {15}, number = {6}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1263-1272}, keywords = {Mobility, Space-charge limited current, Injection-limited current, Charge-carrier mobility, Mobility benchmark}, web_url = {http://www.sciencedirect.com/science/article/pii/S1566119914000469}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, ISSN = {1566-1199}, DOI = {10.1016/j.orgel.2014.02.008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Blakesley, JCB and Castro, FAC and Kylberg, WK and Dibb, GFAD and Valaskib, RV and Cremona, WC and Arantes, CA and Kim, JSK and Kim, JSK} } @Article { , title = {Mathematical modelling to support traceable dynamic calibration of pressure sensors}, journal = {Metrologia}, year = {2014}, month = {5}, day = {28}, volume = {51}, number = {3}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {1-22}, keywords = {Traceability, dynamic measurement, pressure sensor calibration, shock tube, drop-weight system}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/51/3/326/meta}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing Ltd}, address = {Bristol}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/3/326}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Matthews, CM and Pennecchi, FP and Eichstadt, SE and Malengo, AM and Esward, TE and Smith, IS and Elster, CE and Knott, AK and Arrh{\'e}n, FA and Lakka, AL} } @Article { ByunKBHSOCYCBSSCSP2014, title = {Electrical control of nanoscale functionalization in graphene by the scanning probe technique}, journal = {NPG Asia Materials (2014) 6}, year = {2014}, month = {5}, day = {23}, volume = {102}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {atomic force microscopy lithography; graphene; graphene functionalization; graphene hydrogenation; graphene oxidation; scanning photoelectron microscope; X-ray photoemission spectroscopy}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1038/am.2014.24}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Byun, Ik-Su and Kim, Wondong and Boukhvalov, Danil W and Hwang, Inrok and Son, Jong Wan and Oh, Gwangtaek and Choi, Jin Sik and Yoon, Duhee and Cheong, Hyeonsik and Baik, Jaeyoon and Shin, Hyun-Joon and Shiu, Hung Wei and Chen, Chia-Hao and Son, Young-Woo and Park, Bae Ho} } @Article { ChuaCLYLKKFYPJTS2014, title = {Quantum Hall Effect and Quantum Point Contact in Bilayer-Patched Epitaxial Graphene}, journal = {Nano Letters}, year = {2014}, month = {5}, day = {21}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {SiC epitaxial graphene, quantum hall e ff ect, scanning gate microscopy, monolayer and bilayer graphene, resistance metrology, quantum point contact}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1021/nl5008757}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Chua, Cassandra and Connolly, Malcolm and Lartsev, Arseniy and Yager, Tom and Lara-Avila, Samuel and Kubatkin, Sergey and Kopylov, Sergey and Falko, Vladimir and Yakimova, Rositza and Pearce, Ruth and Janssen, T. J. B. M. and Tzalenchuk, Alexander and Smith, Charles G.} } @Article { , title = {A compact new-concept ellipsometer for accurate large scale thin films measurements}, journal = {Journal of Optics}, year = {2014}, month = {5}, day = {8}, volume = {16}, number = {6}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, keywords = {ellipsometry, thin films, large area}, web_url = {http://iopscience.iop.org/article/10.1088/2040-8978/16/6/065701/meta}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {2040-8978}, DOI = {10.1088/2040-8978/16/6/065701}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Koops, RK and Sonin, PS and Veghel, MV and El Gawhary, OEG} } @Article { , title = {Sub-kHz traceable characterization of stroboscopic scanning white light interferometer}, journal = {SPIE proceedings}, year = {2014}, month = {5}, day = {1}, volume = {9132}, number = {1}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {913218}, keywords = {Scanning white light interferometry (SWLI), metrology, MEMs, NEMs,}, web_url = {http://spie.org/Publications/Proceedings/Paper/10.1117/12.2051622}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, address = {Bellingham}, language = {30}, DOI = {10.1117/12.2051622}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heikkinen, V and Kassamakov, I and Paulin, T and Nolvi, A and Sepp{\"a}, J and Lassila, A and H{\ae}ggstr{\"o}m, E} } @Article { ManaKBBN2014, title = {Revision of the SI: The Determination of the Avogadro Constant as the Base for the Kilogram}, journal = {Key Engineering Materials}, year = {2014}, month = {5}, volume = {613}, number = {May 2014}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {3-10}, keywords = {SI units, kilogram, mass, Avogadro constant, interferometry, silicon single-crystal}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Trans Tech Publications}, language = {30}, ISSN = {1662-9795}, DOI = {10.4028/www.scientific.net/KEM.613.3}, stag_bib_extends_levelofaccess = {NA}, author = {Mana, G. and Kuetgens, U. and Borys, M. and Bettin, H. and Nicolaus, A.} } @Article { SolcKSPG20140, title = {Optimization of a measurement facility for radioactive waste free release by Monte Carlo simulation}, journal = {Applied Radiation and Isotopes}, year = {2014}, month = {5}, volume = {87}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {348-352}, keywords = {Free release measurement, Low activity measurement, Monte Carlo simulation, MCNPX, PENELOPE}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804313004259}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2013.11.005}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Solc, Jaroslav and Kovar, Petr and Suran, Jiri and Peyres, Virginia and Garc{\'i}a-Tora{\~n}o, Eduardo} } @Article { , title = {Agreement between two 88Sr+ optical clocks to 4 parts in 10\verb=^=17}, journal = {Physical Review A (Rapid Communications)}, year = {2014}, month = {5}, volume = {A89}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {http://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.050501}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1050-2947}, DOI = {10.1103/PhysRevA.89.050501}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barwood, GP and Huang, G and Klein, HA and Johnson, LAM and King, SA and Margolis, HS and Szymaniec, K and Gill, P} } @Article { YuJPKHCKHK2014, title = {Structural analysis of graphene synthesized by chemical vapor deposition on copper foil using nematic liquid crystal texture}, journal = {Science Direct, Elsevier Carbon}, year = {2014}, month = {4}, day = {24}, volume = {76}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {133-122}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1016/j.carbon.2014.04.057}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Yu, Jeong-Seon and Jin, Xiaozhan and Park, Jaesung and Kim, Dong Hyun and Ha, Dong-Han and Chae, Dong-Hun and Kim, Wan-Seop and Hwang, Chanyong and Kim, Jong-Hyun} } @Article { , title = {Detecting multiparticle entanglement of Dicke states}, journal = {Phys. Rev. Lett.}, year = {2014}, month = {4}, day = {17}, volume = {112}, number = {15}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {155304}, keywords = {67.85.−d, 03.67.Bg, 03.67.Mn, 03.75.Mn}, web_url = {http://arxiv.org/abs/1403.4542v2}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.112.155304}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\"u}cke, B and Peise, J and Vitagliano, G and Arlt, J and Santos, L and T{\'o}th, G and Klempt, C} } @Article { KrawinkelLS2014, title = {Scheinbare Koordinaten{\"a}nderungen von GPS-Referenzstationen: Einfluss von Auswertestrategien und Antennenwechseln}, journal = {Zeitschrift für Vermessungswesen : ZfV}, year = {2014}, month = {4}, volume = {139}, number = {4/2014}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {252-263}, web_url = {http://geodaesie.info/zfv/zfv-42014/3754}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {German}, DOI = {10.12902/zfv-0027-2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Krawinkel, T. and Lindenthal, N. and Sch{\"o}n, S.} } @Article { , title = {Recent advances in vacuum sciences and applications}, journal = {Journal of Physics D: Applied Physics}, year = {2014}, month = {3}, day = {27}, volume = {47}, number = {15}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, pages = {24}, keywords = {vacuum, surface, plasma, interface, nanoscience}, web_url = {http://iopscience.iop.org/article/10.1088/0022-3727/47/15/153001}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0022-3727}, DOI = {10.1088/0022-3727/47/15/153001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-3-27}, author = {Mozetič, M and Ostrikov, K and Ruzic, D.N and Curreli, D and Cvelbar, U and Tagliaferro, A and Conde, O. and Silvestre, A.J and Giapintzakis, J. and Buljan, M. and Radić, N. and Dražić, G. and Bernstorff, S. and Biederman, H. and Kyli{\'a}n, O. and Hanuš, J. and Miloševič, S. and Galtayries, A. and Dietrich, P. and Unger, W. and Sedlarik, V. and Stana-Kleinschek, K. and Drmota-Petrič, A. and Pireaux, J.J and Rogers, J.,.W and Anderle, M.} } @Article { KraussBKHDP2014, title = {Calorimetric determination of the absorbed dose to water for medium-energy X-rays with generating voltages from 70kV to 280 kV}, journal = {Physics in Medicine and Biology: 57 (2012),19, 6245-6268}, year = {2014}, month = {3}, day = {12}, volume = {57}, number = {19}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {6245-6268}, keywords = {absorbed dose to water, Air Kerma, Medium energy x-rays, water calorimetry, Monte-Carlo calculation, uncertainly budget}, web_url = {http://stacks.iop.org/PMB/57/6245}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {0031-9155}, DOI = {10.1088/0031-9155/57/19/6245}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Krauss, Achim and B{\"u}ermann, Ludwig and Kramer, Hans-Michael and Hans-Joachim and Dosimetry for radiation therapy and diagnostic radiology and PTB,Braunschweig} } @Article { Ken2014, title = {Optical mirror referenced capacitive flatness measurement and straightness evaluation of translation stages}, journal = {Measurement Science and Technology}, year = {2014}, month = {3}, day = {5}, volume = {25}, number = {044017}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {5pp}, keywords = {interferometry, capacitive distance measurement, flatness, three-flat test, translation stage, mirror, diffraction grating, deformation, layer}, web_url = {http://iopscience.iop.org/0957-0233/25/4/044017/}, misc2 = {EMRP A169: Call 2010 Industry}, ISSN = {Online ISSN: 1361-6501. Print ISSN: 0957-0233}, DOI = {10.1088/0957-0233/25/4/044017}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kren, P.} } @Article { HuKLSRRKBNS2014, title = {Magnetothermoelectric figure of merit of Co/Cu multilayers}, journal = {APPLIED PHYSICS LETTERS}, year = {2014}, month = {3}, day = {5}, volume = {104}, number = {092411}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, web_url = {http://scitation.aip.org/content/aip/journal/apl/104/9/10.1063/1.4867700}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, DOI = {10.1063/1.4867700}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hu, X. K. and Krzysteczko, P. and Liebing, N. and Serrano-Guisan, S. and Rott, K. and Reiss, G. and Kimling, J. and B{\"o}hnert, T. and Nielsch, K. and Schumacher, H. W.} } @Article { , title = {Capabilities and limitations of the self-calibration of angle encoders}, journal = {Measurement Science and Technology}, year = {2014}, month = {3}, volume = {25}, number = {5}, number2 = {SIB58: Angles: Angle metrology}, keywords = {angle encoder, rotary encoder, angle measurement, angle standard, calibration}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1088/0957-0233/25/5/055003}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Geckeler, R D and Link, A and Krause, M and Elster, C} } @Article { , title = {Thermal conductivity analysis of delaminated thin films by scanning thermal microscopy}, journal = {Measurement Science and Technology}, year = {2014}, month = {3}, volume = {25}, number = {4}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {044022}, keywords = {scanning thermal microscopy, thin films, thermal conductivity}, web_url = {https://www.researchgate.net/publication/260559141_Thermal_conductivity_analysis_of_delaminated_thin_films_by_scanning_thermal_microscopy}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0957-0233/25/4/044022}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Martinek, JM and Valtr, MV and Cimrman, RC and Klapetek, PK} } @Proceedings { , title = {''Multidimensional reflectometry for industry'' (xD-Reflect) an European research project}, journal = {Proceedings of SPIE}, year = {2014}, month = {2}, day = {24}, volume = {9018}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {901804}, keywords = {Reflectometry ; Metrology ; Modeling ; Optical design ; Optical testing ; Bidirectional reflectance transmission function ; CCD cameras ; Calibration ; Data analysis ; Light sources}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835520}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE - The International Society for Optical Engineering}, address = {Bellingham}, event_place = {San Francisco (USA)}, event_name = {Measuring, Modeling, and Reproducing Material Appearance}, event_date = {4-5 February, 2014}, language = {30}, ISBN = {978-0-8194-9935-6}, ISSN = {0277-786X}, DOI = {10.1117/12.2035981}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {H{\"o}pe, A. and Koo, A. and Verdu, F.-M. and Leloup, F.-B. and Obein, G. and W{\"u}bbeler, G. and Campos, J. and Iacomussi, P. and Jaanson, P. and K{\"a}llberg, S. and Smids, M.} } @Article { TammHLGNKWP2014, title = {Cs-based optical frequency measurement using cross-linked optical and microwave oscillators}, journal = {Physical Review A}, year = {2014}, month = {2}, day = {14}, volume = {89}, number = {2014}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.023820\#abstract}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, DOI = {10.1103/PhysRevA.89.023820}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Tamm, Chr. and Huntemann, N. and Lipphardt, B. and Gerginov, V. and Nemitz, N. and Kazda, M. and Weyers, S. and Peik, E.} } @Article { , title = {Characterization of an in-vacuum PILATUS 1M detector}, journal = {Journal of Synchrotron Radiation}, year = {2014}, month = {2}, day = {12}, volume = {21}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {529-536}, keywords = {hybrid pixel detector; PILATUS detector; solid-state detectors; detector design; small-angle X-ray scattering; SAXS; ASAXS; GISAXS; nanometrology; detector quantum efficiency.}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1107/S160057751400294X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Wernecke, J. and Gollwitzer, C. and M{\"u}ller, P. and Krumrey, M.} } @Article { , title = {Characterization of IgG-protein-coated polymeric nanoparticles using complementary particle sizing techniques}, journal = {Surface and Interface analysis}, year = {2014}, month = {2}, day = {5}, volume = {46}, number = {10-11}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, pages = {663-667}, keywords = {nanoparticle, size, protein coating, core/shell, DLS, DCS, SAXS, DTT}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5381/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley}, address = {New York}, language = {30}, DOI = {10.1002/sia5381}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-2-5}, author = {Minelli,, C. and Garcia-Diez,, R. and Sikora,, A.E and Gollwitzer,, C. and Krumrey,, M. and Shard, A.G} } @Article { , title = {Contact mechanics and tribology of polymer composites}, journal = {Journal of Applied Polymer Science}, year = {2014}, month = {2}, day = {5}, volume = {131}, number = {3}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {39870-39870}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/app.39870/full}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Wiley}, language = {30}, ISSN = {0021-8995}, DOI = {10.1002/app.39870}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Myshkin, NM and Kovalev, AK and Spaltman, DS and Woydt, MW} } @Article { PanchalGLYK2014, title = {Local electric field screening in bi-layer graphene devices}, journal = {Front. Physics 2:3.}, year = {2014}, month = {2}, day = {3}, volume = {2}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {epitaxial graphene, scanning gate microscopy, single-layer graphene, double-layer graphene, electrical gating}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.3389/fphy.2014.00003}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, V and Giusca, CE and Lartsev, A and Yakimova, R and Kazakova, O} } @Proceedings { , title = {High Capacity Reference Transducer For Tensile Forces}, journal = {IMEKO 22nd TC3, 15th TC5 and 3rd TC 22 International Conferences}, year = {2014}, month = {2}, day = {3}, volume = {22}, number = {1}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {5}, keywords = {Reference Transducer, Tensile forces, High Capacity force transducers}, web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-025.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IMEKO}, address = {Budapest}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Kleckers, T. and Graef, M.} } @Article { , title = {The growth of the oxide layer on silicon spheres and its influence on their mass stability}, journal = {New SI, kilogram, Avogadro project, Si}, year = {2014}, month = {2}, day = {3}, volume = {22}, number = {22}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {1 - 6}, keywords = {New SI, kilogram, Avogadro project, Si spheres, mass stability, silicon oxide}, web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-026.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IMEKO}, address = {Budapest}, language = {30}, ISSN = {NA}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Borys, M and Mecke, M and Kuetgens, U and Busch, I and Krumrey, M and Fuchs, P and Marti, K and Bettin, H} } @Proceedings { , title = {Towards a better understanding of the color shift of effect coatings by densely sampled spectral BRDF measurement}, journal = {Measuring, Modeling, and Reproducing Material Appearance 2014}, year = {2014}, month = {2}, day = {2}, volume = {9018}, number = {90180K}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {90180K-1 - 90180K-11}, keywords = {Special effect coatings, spectral BRDF, interference pigments, metallic coatings, rendering, spectrophotometry}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835535}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, address = {Bellingham WA, USA}, event_place = {San Francisco, California, USA}, event_name = {IS\&T/SPIE Electronic Imaging}, event_date = {2-6 February, 2014}, language = {30}, ISBN = {9780819499356}, ISSN = {0277786X}, DOI = {10.1117/12.2036726}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, Alejandro and Bernad, Berta and Campos, Joaqu{\'i}n and Mart{\'i}nez-Verd{\'u}, Francisco M and Perales, Esther and van de Lans, Ivo and kirchner, Eric} } @Article { , title = {Nanoscale optical spectroscopy: an emerging tool for the characterization of graphene and related 2-D materials}, journal = {journal of Materials NanoScience}, year = {2014}, month = {2}, day = {1}, volume = {1}, number = {1}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {39-49}, keywords = {Raman spectroscopy, tip-enhanced Raman spectroscopy (TERS), photoluminescence, defects, contamination, 2-D materials}, web_url = {http://www.pubs.iscience.in/journal/index.php/jmns/article/view/195}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Intergrated Science}, address = {New Delhi}, language = {30}, ISSN = {2394-0867}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Pollard, A.J. and Kumar, N. and Rae, A. and Mignuzzi, S. and Su, W. and Roy, D.} } @Article { , title = {Spatially resolved electrical characterisation of graphene layers by an evanescent field microwave microscope}, journal = {Physica E: Low dimensional systems and nanostructures}, year = {2014}, month = {2}, day = {1}, volume = {56}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {431 - 434}, keywords = {evanescent field microwave microscope, traceable measurements, graphene}, web_url = {http://www.sciencedirect.com/science/article/pii/S1386947712004018}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {n/a}, DOI = {10.1016/j.physe.2012.10.006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-2-1}, author = {Gregory, A and Hao, L and Klein, N and Gallop, J and Mattevi, C and Shaforost, O and Lees, K and Clarke, B} } @Article { KivelPGVG2014, title = {Modeling of the plasma extraction efficiency of an inductively coupled plasma-mass spectrometer interface using the direct simulation Monte Carlo method}, journal = {Spectrochimica Acta Part B}, year = {2014}, month = {1}, day = {27}, volume = {B 93}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {34-40}, keywords = {Multi-collector-ICP-MS, Mass discrimination, Shock wave formation, Direct Simulation Monte Carlo, High performance computing}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1016/j.sab.2013.12.010.}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kivel, Niko and Potthast, Heiko-Dirk and G{\"u}nther-Leopold, Ines and Vanhaecke, Frank and G{\"u}nther, Detlef} } @Article { D039AgostinoBGOKR2014, title = {Use of Instrumental Neutron Activation Analysis to investigate the distribution of trace elements among subsamples of solid materials}, journal = {Metrologia}, year = {2014}, month = {1}, day = {16}, volume = {51}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {48-53}, keywords = {Instrumental Neutron Activation Analysis, homogeneity, rhodium, uncertainty}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1088/0026-1394/51/1/48}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {D'Agostino, Giancarlo and Bergamaschi, Luigi and Giordani, Laura and Oddone, Massimo and Kipphardt, Heinrich and Richter, Silke} } @Article { , title = {Tip-enhanced Raman Spectroscopy – 1 An Interlaboratory Reproducibility and Comparison Study}, journal = {Journal of Raman Spectroscopy}, year = {2014}, month = {1}, day = {9}, volume = {45}, number = {1}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {22-31}, keywords = {tip-enhanced Raman spectroscopy, interlaboratory comparison study, thiophenol self- assembled monolayer, spectra interpretation, metrology}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/jrs.4423/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Wiley Online}, address = {Hoboken}, language = {30}, ISSN = {0377-0486}, DOI = {10.1002/jrs.4423}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Blum, C. and Opilik, L. and Atkin, J.M. and Braun, K. and Kammer, S.B and Kravtsov, V. and Kumar, N. and Lemeshko, S. and Li, J.F and Luszcz, K. and Makeki, T. and Meixner, A.J. and Minne, S. and Raschke, M.B. and Ren, B. and Rogalski, J. and Roy, D. and Stephanidis, B. and Wang, X. and Zhang, D. and Zhong, J.H. and Zenobi, R.} } @Proceedings { , title = {Traceable Quasi-dynamic Stroboscopic Scanning White Light Interferometry}, journal = {Fringe 2013}, year = {2014}, month = {1}, day = {1}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {491 - 496}, keywords = {SSWL (Stroboscopic Scanning White Light Interferometry), Metrology Transfer standards}, web_url = {http://link.springer.com/book/10.1007/978-3-642-36359-7}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer Berlin Heidelberg}, address = {Berlin}, event_place = {Nurtingen, Germany}, event_name = {7th International Workshop on Advanced Optical Imaging and Metrology}, event_date = {01-01-2014}, language = {30}, ISBN = {9783642363597}, DOI = {10.1007/978-3-642-36359-7_86}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heikkinen, V and Nolvi, A and Paulin, T and Sepp{\"a}, J and Kassamakov, I and Lassila, A and H{\ae}ggstr{\"o}m, E} } @Proceedings { , title = {Recent process with the SINIS turnstile}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {534-535}, keywords = {Error counting experiment, hybrid turnstile, quantum current standard, quantum metrological triangle}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mykk{\"a}nen, E. and Kemppinen, A. and Maisi, V. F. and Meschke, M. and Mannila, E. and Peltonen, J. T. and Pekola, J. P. and Manninen, A. J.} } @Proceedings { , title = {A self-referenced single-electron current source}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {665-665}, keywords = {Charge pumps, Current measurement, Error accounting, Single electron devices, Single electron transistors}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hohls, F. and Fricke, L. and Wulf, M. and Kaestner, B. and Mirovsky, Ph. and Mackrodt, B. and Dolata, R. and Weimann, Th. and Pierz, K. and Siegner, U. and Schumacher, H. W.} } @Proceedings { , title = {Modeling of an adiabatic tunable-barrier electron pump}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {446-447}, keywords = {Electron Pump, Simulation, Coulomb Blockade, Si-CMOS, Charge Pumping}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISSN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ray, S. J. and Clapera, P. and Jehl, X. and Charron, T. and Djordjevic, S. and Devoille, L. and Potanina, E. and Barinovs, G. and Kashcheyevs, V.} } @Proceedings { , title = {Modeling of a tunable-barrier non-adiabatic electron pump beyond the decay cascade model}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {536-537}, keywords = {electron pump, quantum dot, quantum metrology, tunneling, single-electron transport}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kashcheyevs, Vyacheslavs and Timoshenko, Janis} } @Proceedings { KohlmannBKDSSTGMJONLIWLVBECHvO2014, title = {A quantum standard for sampled electrical measurements - main goals and first results of the EMRP project Q-WAVE}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {522 - 523}, keywords = {AC Josephson voltage standards European Metrology Research Programme (EMRP) binary-divided Josephson series arrays pulse-driven Josephson series arrays}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898489}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kohlmann, J. and Behr, R. and Kieler, O. and Diaz de Aguilar Rois, J. and Sira, M. and Sosso, A. and Trinchera, B. and Gran, J. and Malmbekk, H. and Jeanneret, B. and Overney, F. and Nissil{\"a}, J. and Lehtonen, T. and Ireland, J. and Williams, J. and Lapuh, R. and Voljc, B. and Bergsten, T. and Eklund, G. and Coskun Ozturk, T. and Houtzager, E. and van den Brom, H.E. and Ohlckers, P.} } @Proceedings { KohlmannMKSEWB2014, title = {Josephson series arrays with NbSi barrier for ac voltage standards}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {466 - 467}, keywords = {AC Josephson voltage standards NbSi barrier Josephson junctions SNS Josephson junctions binary-divided Josephson series arrays pulse-driven Josephson series arrays}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898461}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kohlmann, J. and Müller, F. and Kieler, O. and Scheller, T. and Egeling, B. and Wendisch, R. and Behr, R.} } @Proceedings { IrelandHWKKBGMLT2014, title = {An opto-electronic coupling for pulsedriven Josephson junction arrays}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {124 - 125}, keywords = {Measurement, metrology, voltage measurement, Josephson arrays, opto-electronics, Josephson arbitrary waveform synthesizer.}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898290}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ireland, J. and Henderson, D. and Williams, J. and Kieler, O. and Kohlmann, J. and Behr, R. and Gran, J. and Malmbekk, H. and Lind, K. and Tang, Chi Kwong} } @Proceedings { OzturkKKMBCATA2014, title = {ERROR ANALYSIS IN WAVEFORMS SYNTHESIZED WITH A COMBINED JOSEPHSON SYSTEM FOR AC COMPONENT CHARACTERIZATION}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {734 - 735}, keywords = {analog to digital converter, error analysis, Josephson voltage standards, sampling techniques}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6898595\&refinements\%3D4270696875\%26queryText\%3DCPEM+2014}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898595}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {{\"O}zt{\"u}rk, T. C. and Kohlmann, J. and Kieler, O. and M{\"o}hring, T. and Behr, R. and \c{C}aycı, H. and Arifovi\c{c}, M. and Turhan, S. and Ata, L.D.} } @Article { MonteGAKEOH2014, title = {Radiometric calibration of the in-flight blackbody calibrationsystem of the GLORIA interferometer}, journal = {Atmos. Meas. Tech}, year = {2014}, volume = {7}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {Radiation Thermometry, Radiance, Remote Sensing, Vacuum, Emissivity}, web_url = {http://www.atmos-meas-tech.net/7/13/2014/amt-7-13-2014.html}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, DOI = {10.5194/amt-7-13-2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Gutschwager, B. and Adibekyan, A. and Kehrt, M. and Ebersoldt, A. and Olschewski, F. and Hollandt, J.} } @Proceedings { KummeTRBGA2014, title = {Force traceability within the meganewton range}, journal = {Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque}, year = {2014}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {2}, keywords = {Force, Build-up Systems, Mega Newton}, web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-027.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Cape Town, Republic of South Africa}, event_name = {IMEKO 22nd TC3, 15th TC5 and 3rd TC22 International Conferences}, event_date = {3 to 5 February}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kumme, R. and Tegtmeier, F. and R{\"o}ske, D. and Barthel, A. and Germak, A. and Averlant, P.} } @Proceedings { PulliKSMPI2014, title = {Realization of Improved Solar UV Diffusers}, journal = {Proceedings of the Newrad 2014}, year = {2014}, number2 = {ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation}, pages = {79 to 80}, web_url = {http://newrad2014.aalto.fi/Newrad2014_Proceedings.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Espoo, Finland}, event_name = {NEWRAD 2014}, event_date = {24 to 27 June 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pulli, Tomi and K{\"a}rh{\"a}, Petri and Schreder, Josef and Mes, Joop and Partosoebroto, Allard and Ikonen, Erkki} } @Article { JoustenK2014, title = {The work of ISO TC 112 towards standardization for specification and calibration of quadrupole mass spectrometers}, journal = {Vacuum}, year = {2014}, volume = {101}, number = {March 2014}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, pages = {457-461}, keywords = {Vacuum metrology, standardization, ISO, quadrupole mass spectrometers}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2013.07.013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Jousten, K and Kim, Jin-Tae} } @Article { PeksaGJVSKP2014_2, title = {Implementation of multi-opening orifices in the primary metrology of vacuums and small gas throughputs}, journal = {Vacuum}, year = {2014}, volume = {101}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {orifice, multi-opening-orifice, orifice flow standard, gas throughput}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0042-207X/$}, DOI = {10.1016/j.vacuum.2013.10.014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Peksa, Ladislav and Gronych, Tom{\'a}š and Jeř{\'a}b, Martin and Vičar, Martin and Staněk, František and Kraj{\'i}ček, Zdeněk and Praž{\'a}k, Dominik} } @Proceedings { Kurtz2014, title = {Is the airborne sound power level of a source unambiguous?}, journal = {INTER-NOISE 2014}, year = {2014}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, pages = {1933 to 1942 (10)}, keywords = {Sound power level, sound intensity/sound pressure scanning.}, web_url = {http://ince.publisher.ingentaconnect.com/content/ince/incecp/2014/00000249/00000006}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Melbourne}, event_name = {Internoise 2014}, event_date = {November 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kurtz, P} } @Article { PlotnikovPRKH2014, title = {Determination of Major Non-Metallic Impurities in Magnesium by Glow Discharge Mass Spectrometry with a Fast Flow Source Using Sintered and Pressed Powder Samples}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, number = {406}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {7463-7471}, keywords = {Glow discharge mass spectrometry, Magnesium matrix, nonmetallic impurities, fast flow source, electrical parameters, calibration samples.}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1007/s00216-014-8185-x}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Plotnikov, A. and Pfeifer, J. and Richter, S. and Kipphardt, H. and Hoffmann, V.} } @Article { KaltenbachNGPRKKJRG2014, title = {Gravimetric preparation and characterization of primary reference solutions of molybdenum and rhodium}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, keywords = {Digestion. Rhodium. Molybdenum. Reference solution. Metrological traceability. ICP OES. MC-ICP-MS}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1007/s00216-014-8395-2}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kaltenbach, A. and Noordmann, J. and G{\"o}rlitz, V. and Pape, C. and Richter, S. and Kipphardt, H. and Kopp, G. and J{\"a}hrling, R. and Rienitz, O. and G{\"u}ttler, B.} } @Article { NouiraBKPHS2014, title = {Ultra-high precision CMMs as well as tactile and optical single scanning probes evaluation in dimensional metrology}, journal = {International Journal of Metrology and Quality Engineering}, year = {2014}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {measuring machine, chromatic confocal probe; tactile probe, error sources; dimensional and mechanical metrology, evaluation}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {2107-6839}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nouira, H and Bergmans, R H and K{\"u}ng, A. and Piree, H and Henselmans, R. and Spaan, H.A.M.} } @Proceedings { LapuhVKPSL2014, title = {Measurement of Repetitive Arbitrary Waveform RMS Value}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {420 - 421}, keywords = {Asynchronous sampling, arbitrary signals, time-domain windows, estimators, noise.}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898438}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lapuh, Rado and Voljc, Bostjan and Kokalj, Miha and Pinter, Borut and Svetik, Zoran and Lindic, Matjaz} } @Proceedings { , title = {Development of coaxial adapter for calibration of EMC devices}, journal = {Conference on Precision Electromagnetic Measurements}, year = {2014}, volume = {2016}, number = {2016}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-2}, keywords = {adapter, calibration, EMC, EMRP, LISN, project, traceability}, web_url = {http://ieeexplore.ieee.org/document/6898521/?reload=true\&arnumber=6898521}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Conference on Precision Electromagnetic Measurements 2014}, address = {Rio de Janeiro}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements 2014}, event_date = {24-08-2014 to 29-08-2014}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2014.6898521}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kokalj, M. and Pinter, B. and Lindič, M. and Ziade, F. and Kokalj, Miha} } @Proceedings { PalafoxRKOCGZNELGFKR2014, title = {AIM QuTE: Automated Impedance Metrology extending the Quantum Toolbox for Electricity}, journal = {Digest}, year = {2014}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2013/01/metrology_metr2013_11001/metrology_metr2013_11001.html}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Paris, France}, event_name = {16th International Congress of Metrology}, event_date = {7-10 October 2013}, language = {English}, DOI = {10.1051/metrology/201311001}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Palafox, L. and Raso, F. and Kucera, J. and Overney, F. and Callegaro, L. and Gournay, P. and Ziołek, A. and Nissil{\"a}, J. and Eklund, G. and Lippert, T. and G{\"u}lmez, Y. and Fleischmann, P. and Kampik, M. and Rybski, R.} } @Proceedings { NissilaOKKMCOCCDTPOKPR2014, title = {A precise two-channel digitally synthesized AC voltage source for impedance metrology}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {768 - 769}, keywords = {Digital signal source, digital-to-analog converter, impedance ridge, standard}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898612}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nissil{\"a}, J. and Ojasalo, K. and Kampik, M. and Kaasalainen, J. and Maisi, V. and Casserly, M. and Overney, F. and Christensen, A. and Callegaro, L. and D'Elia, V. and Tran, N. T. M. and Pourdanesh, F. and Ortolano, M. and Kim, D. B. and Penttil{\"a}, J. and Roschier, L.} } @Proceedings { CallegaroDKBOP2014, title = {Experiences with a two terminal-pair digital impedance bridge}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {222 - 223}, keywords = {Metrology, impedance, admittance, measurement standards, precision measurements, bridge circuits.}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898339}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898339}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Callegaro, Luca and D'Elia, V. and Kampik, Marian and Bee Kim, Dan and Ortolano, Massimo and Pourdanesh, Faranak} } @Proceedings { LeeNKB2014, title = {A quantum voltmeter for precision AC measurements}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {732 - 733}, keywords = {AC voltage measurement, programmable Josephson system, signal synthesis, standards}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898594}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898594}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lee, Jinni and Nissil{\"a}, Jaani and Katko, Alexander and Behr, Ralf} } @Proceedings { GulmezGKEHG2014, title = {Sıcaklık Kontroll{\"u} Pasif Faz Standardı Yapımı}, journal = {URSI-T{\"U}RKİYE’2014 VII. Bilimsel Kongresi, 28-30 Ağustos 2014, ELAZIĞ}, year = {2014}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {436-438}, web_url = {http://www.ursi.org.tr/2014-Kongre/bildiriler/TAM_155.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Elazığ TURKEY}, event_name = {URSI-T{\"U}RKİYE’2014 VII. Bilimsel Kongresi, 28-30 Ağustos}, event_date = {28 - 30 August 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://web.firat.edu.tr/ursi/download/URSI_TUM_KITAP_PAGE.pdf}, author = {G{\"u}lmez, G. and G{\"u}lmez, Y and Karacadağ, H. and Erkan, {\"O}. and Hayırlı, C. and Gali\c{c}, N.} } @Proceedings { CallegaroDPOBK2014, title = {Ponti digitali automatici per la metrologia di impedenza}, journal = {Atti del XXXI Congresso Nazionale del Gruppo di Misure Elettriche ed Elettroniche}, year = {2014}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {285-291}, keywords = {Metrology, impedance, admittance, measurement standards, precision measurements, bridge circuits.}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Ancona, Italy}, event_name = {XXXI Congresso Nazionale del Gruppo di Misure Elettriche ed Elettroniche}, event_date = {11-13 September 2014}, language = {Italian}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Callegaro, Luca and D'Elia, V. and Pourdanesh, Faranak and Ortolano, Massimo and Bee Kim, Dan and Kampik, Marian} } @Proceedings { , title = {Establishment of wavelength traceability of a DSR-facility using array spectroradiometers and a Fourier-Transform Spectroradiometer}, journal = {Proceedings of the 29th European PV Solar Energy Conference and Exhibition}, year = {2014}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {3447 - 3451}, keywords = {Calibration, Traceability, Experimental Methods}, web_url = {http://www.eupvsec-proceedings.com/proceedings?paper=28905}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Netherlands, Amsterdam}, event_name = {29th European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {22 - 26 September 2014}, language = {30}, ISBN = {3-936338-34-5}, DOI = {10.4229/EUPVSEC20142014-5DV.3.51}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kr{\"o}ger, Ingo and Plag, Fabian and Fey, Thomas and Witt, Florian and Winter, Stefan} } @Proceedings { , title = {Sub-ppm measurements of single-electron pump currents}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {444-445}, keywords = {Electron pumps, small currents, SI system}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Giblin, S. P. and Janssen, T. J. B. M. and Fletcher, J. D. and See, P. and Kataoka, M.} } @Proceedings { , title = {Ultrastable Low-Noise Current Amplifier}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {656-657}, keywords = {Ammeters, calibration, current measurement, measurement uncertainty, precision measurements}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Drung, D. and Krause, Ch. and Becker, U. and Scherer, H. and Ahlers, F. J.} } @Article { , title = {Projekt EMPR JRP ENV07 Metrologia dla meteorologii zakończony}, journal = {Metrologia i Probiernictwo}, year = {2014}, volume = {4 (7)}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {34-39}, keywords = {temperature, humidity, pressure, measurement traceability, climate change}, misc2 = {EMRP A169: Call 2010 Environment}, language = {91}, ISSN = {2300-8806}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Szmyrka-Grzebyk, A and Grudniewicz, E and Grykałowska, A and Kowal, A and Kołodziej, B and Wełna, A and Kozicki, M and Wiśniewska, B} } @Proceedings { , title = {Comparison of the Input Electrical Power Measurement Methods for HIFU Transducers}, journal = {IEEE Xplore Conference Publications}, year = {2014}, volume = {-}, number = {-}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1-6}, keywords = {HIFU; ultrasonic power measurements; electrical power measurements; metrology; comparison}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6860141}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IEEE}, address = {-}, event_place = {-}, event_name = {-}, event_date = {-}, language = {30}, ISBN = {-}, ISSN = {978-1-4799-2921-4/14/$31.00 ©2014 IEEE}, DOI = {10.1109/MeMeA.2014.6860141}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Karab{\"o}ce, Baki and G{\"u}lmez, Yakup and Bilgi\c{c}, Ey{\"u}p and Sadıkoğlu, Enver and İnce, Ahmet T. and Skarlatos, Yani} } @Article { , title = {Evaluation of the measurement system for determination of frequency characteristics of functional blocks used in AC impedance bridges}, journal = {PRZEGLĄD ELEKTROTECHNICZNY}, year = {2014}, volume = {R 90}, number = {11/2014}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {45 - 47}, keywords = {measurement system, voltage ratio measurement, calibration}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Ryszard RYBSKI}, address = {UZG, Zielona G{\'o}ra}, language = {30}, ISSN = {0033-2097}, DOI = {10.12915/pe.2014.11.14}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {RYBSKI, Ryszard and KACZMAREK, Janusz and KOZIOL, Miroslaw and Kampik, Marian and DUDEK, Edyta and ZIOLEK, Adam} } @Proceedings { , title = {A measurement system for determination of frequency characteristics of functional blocks used in AC impedance bridges}, journal = {Proc. of X Scientific Conference ''Measurement Systems in Research and Industry SP'2014''}, year = {2014}, volume = {-}, number = {-}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {107 - 110}, keywords = {measurement system, voltage ratio measurement, calibration}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Ryszard RYBSKI}, address = {UZG, Zielona G{\'o}ra}, event_place = {Lagow Lubuski, Poland}, event_name = {X Scientific Conference ''Measurement Systems in Research and Industry SP'2014”}, event_date = {2014-06 -1-4}, language = {30}, ISBN = {978-83-7842-127-6}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {RYBSKI, Ryszard and KACZMAREK, Janusz and KOZIOL, Miroslaw and Kampik, Marian and ZIOLEK, Adam} } @Proceedings { , title = {A precise buffer for impedance metrology}, journal = {Mat. Konferencji Naukowo-Technicznej Podstawowe Problemy Metrologii PPM'14, Prace Komisji Metrologii Oddziału PAN w Katowicach}, year = {2014}, volume = {19}, number = {-}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {13-16}, keywords = {measurement system, voltage ratio measurement, calibration}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Marian Kampik}, address = {SUT, Gliwice, Poland}, event_place = {Koscielisko, Poland}, event_name = {Podstawowe Problemy Metrologii (Problems and Progress in Metrology), PPM'14}, event_date = {2014-06- 15-18}, language = {30}, ISBN = {978-83-930505-9-8}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kampik, Marian and TOKARSKI, Janusz and BARWINEK, Wojciech and RYBSKI, Ryszard and KACZMAREK, Janusz and KOZIOŁ, Mirosław} } @Article { , title = {PTB's enhanced stitching approach for the high-accuracy interferometric form error characterization of spheres}, journal = {Meas. Sci. Technol.}, year = {2014}, volume = {25}, number = {-}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {064002 (8pp)}, keywords = {sub-aperture stitching, form error, silicon sphere, roundness, sphere interferometer}, web_url = {-}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP}, address = {UK}, language = {30}, ISSN = {-}, DOI = {10.1088/0957-0233/25/6/064002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bartl, Guido and Krystek, Michael and Nicolaus, Arnold} } @Proceedings { , title = {Form measurement with the sphere interferometers of PTB}, journal = {Classical Optics 2014}, year = {2014}, volume = {-}, number = {-}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {OTh3B.3}, keywords = {-}, web_url = {-}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {OSA}, address = {-}, event_place = {Hawaii}, event_name = {Optical Fabrication and Testing 2014}, event_date = {June 2014}, language = {30}, ISBN = {978-1-55752-747-9}, ISSN = {-}, DOI = {10.1364/OFT.2014.OTh3B.3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bartl, Guido and Krystek, Michael and Mai, Torsten and Nicolaus, Arnold and Peter, Andreas and Spolaczyk, Reiner} } @Proceedings { , title = {High-accuracy characterisation of spheres using PTB's sphere interferometer with an enhanced stitching procedure}, journal = {FRINGE 2013 Proceedings}, year = {2014}, volume = {-}, number = {-}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {267-270}, keywords = {-}, web_url = {-}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Berlin Heidelberg}, event_place = {N{\"u}rtingen}, event_name = {FRINGE 2013}, event_date = {September 2013}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1007/978-3-642-36359-7_43}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bartl, Guido and Krystek, Michael and Nicolaus, Arnold} } @Proceedings { , title = {xD-Reflect - ''Multidimensional Reflectometry for Industry'' a research project of the European Metrology Research Program (EMRP)}, journal = {Proceedings of NEWRAD 2014}, year = {2014}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {295-297}, web_url = {http://newrad2014.aalto.fi/Newrad2014_Proceedings.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Seongchong Park}, address = {Yuseong-gu}, event_place = {Helsinki}, event_name = {NEWRAD 2014}, event_date = {2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}pe, A. and Koo, A. and Forthmann, C. and Verd{\'u}, F. M. and Manoocheri, F. and Leloup, F. B. and Obein, G. and W{\"u}bbeler, G. and Ged, G. and Campos, J. and Hauer, K. O. and Yang, L. and Šm{\'i}d, M. and Langovoy, M. and Iacomussi, P. and Jaanson, P. and K{\"a}llberg, S.} } @Article { , title = {Optical frequency transfer via a 660 km underground fiber link using a remote Brillouin amplifier}, journal = {Optics Express}, year = {2014}, volume = {22}, number = {22}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, web_url = {http://arxiv.org/abs/1407.4907}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/OE.22.026537}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Raupach, S. M. F. and Koczwara, A. and Grosche, G.} } @Proceedings { , title = {A 5 degrees of freedom \(\mu\)CMM}, journal = {Proceedings of the 14th international conference of the european society for precision engineering and nanotechnology}, year = {2014}, volume = {II}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {P4.28, 269V1}, keywords = {3D micro coordinate metrology}, web_url = {http://www.euspen.eu/Portals/0/Content/2000-2013/Resources/Proceedings/2014\%20Dubrovnik\%20Contents\%20Pages.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {EUSPEN}, address = {Bedford}, event_place = {Dubrovnik, Croatia}, event_name = {14th international conference of the european society for precision engineering and nanotechnology}, event_date = {June 2-6, 2014}, language = {30}, ISBN = {978-0-9566790-3-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"u}ng, A. and Meli, F. and Nicolet, A.} } @Article { , title = {Investigation of nonlinear superconducting microwave resonators including Nb Josephson junctions and SQUID arrays}, journal = {Journal of Physics:Conference Series}, year = {2014}, volume = {507 (2014)}, number = {Part 4, 2014 (042001-042051)}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {042016}, keywords = {superconducting microwave resonators, Josephson junction, SQUID}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/507/4/042016}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {1742-6596}, DOI = {10.1088/1742-6596/507/4/042016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Khabipov, M and Mackrodt, B and Dolata, R and Scheller, T and Zorin, A} } @Proceedings { , title = {Towards Quantum Resistance Metrology Based on Graphene}, journal = {The EMRP Project GraphOhm - Towards Quantum Resistance Metrology Based on Graphene}, year = {2014}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {548-549}, keywords = {Measurement standards, resistance, quantum hall effect, graphene, C, Calibration, EMRP project GraphOhm, Electrical resistance measurement, Hall effect devices, JRP, Materials, Metrology, Resistance, Standards, electric resistance measurement, electrical measurement, intrinsically referenced resistance standard disse, joint research project, quantum resistance metrology standard, semiconductor quantum Hall device}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898502}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_date = {24-29 Aug. 2014}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898502}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ahlers, F. and Kučera, J. and Poirier, W. and Jeanneret, B. and Satrapinski, A. and Tzalenchuk, A. and Vrabček, P. and Bergsten, T. and Hwang, C. and Yakimova, R. and Kubatkin, S.} } @Article { , title = {Effect of Impurities on Water Triple Point Cells}, journal = {International Journal of Thermophysics}, year = {2014}, volume = {35}, number = {-}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {1084-1096}, keywords = {Impurities; Raoult’s law; Water triple point cells;}, web_url = {http://link.springer.com/article/10.1007/s10765-014-1702-5}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer US}, address = {-}, language = {30}, ISSN = {ISSN: 1572-9567}, DOI = {10.1007/s10765-014-1702-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Peruzzi, A. and Dobre, M. and van Geel, J. and Uytun, A. and Kalemci, M. and Uysa, E. and Strouse, G. and Davis, C.} } @Proceedings { , title = {Stability tests of electronic calibration units}, journal = {CPEM 2014 Digest}, year = {2014}, volume = {2014}, number = {2014}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {16-17}, keywords = {Measurement technique, calibration, stability analysis, temperature dependence, scattering parameters, network analysis, electronic calibration}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {n/a}, event_place = {Rio de Janeiro, Brazil}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {25-08-2014 to 29-08-2014}, language = {30}, ISBN = {978-1-4799-5205-2}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898236}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Zeier, M and Hoffmann, J and Huerlimann, P and Ruefenacht, J and Wollensack, M and Judaschke, R and Kuhlmann, K} } @Proceedings { , title = {EXPERIMENTAL METHOD FOR THE NON-CONTACT MEASUREMENT OF ROTATIONAL DAMPING}, year = {2014}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, keywords = {damping measurement rotational vibration rotational dampig}, web_url = {www.imeko.org/publications/tc22-2014/IMEKO-TC3-TC22-2014-003.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {International Measurement Conferderation}, address = {Budapest}, event_place = {Cape Town, Republic of South Africa}, event_name = {Joint IMEKO Conference TC3, TC5 \& TC22}, event_date = {03-05, February, 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klaus, L. and Kobusch, M.} } @Proceedings { , title = {MODEL PARAMETER IDENTIFICATION FROM MEASUREMENT DATA FOR DYNAMIC TORQUE CALIBRATION}, year = {2014}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, keywords = {model parameter identification dynamic torque calibration dynamic measurement mechanical model}, web_url = {www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-018.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {International Measurement Conferderation}, address = {Budapest}, event_place = {Cape Town, Republic of South Africa}, event_name = {Joint IMEKO Conference TC3, TC5 \& TC22}, event_date = {03-05, February, 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klaus, L. and Arendack{\'a}, B. and Kobusch, M. and Bruns, Th.} } @Proceedings { , title = {DYNAMIC CALIBRATION OF FORCE, TORQUE AND PRESSURE SENSORS}, year = {2014}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, keywords = {dynamic calibration, torque, force, pressure, modelling}, web_url = {www.imeko.org/publications/tc22-2014/IMEKO-TC3-TC22-2014-007.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {International Measurement Conferderation}, address = {Budapest}, event_place = {Cape Town, Republic of South Africa}, event_name = {Joint IMEKO Conference TC3, TC5 \& TC22}, event_date = {03-02-2014 to 05-02-2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bartoli, C. and Beug, M. and Bruns, Th. and Eichst{\"a}dt, S. and Esward, T. and Klaus, L. and Knott, A. and Kobusch, M. and Schlegel, C.} } @Proceedings { , title = {UNCERTAINTY CONTRIBUTIONS IN SINUSOIDAL FORCE MEASUREMENT}, year = {2014}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, keywords = {dynamic force, sinusoidal excitation, laser vobrometer, rocking motion, traxial acceleration}, web_url = {www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-014.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {International Measurement Conferderation}, address = {Budapest}, event_place = {Cape Town, Republic of South Africa}, event_name = {Joint IMEKO Conference TC3, TC5 \& TC22}, event_date = {03-02-2014 to 05-02-2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schlegel, C. and Kieckenap, G. and Kumme, R.} } @Proceedings { , title = {DETERMINATION OF PRESSURE TRANSDUCER SENSITIVITY TO HIGH FREQUENCY VIBRATION}, year = {2014}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, keywords = {laser vibrometry, pressure, transducer, acceleration, sensitivity, shock tube}, web_url = {www.imeko.org/publications/tc22-2014/IMEKO-TC3-TC22-2014-002.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {International Measurement Conferderation}, address = {Budapest}, event_place = {Cape Town, Republic of South Africa}, event_name = {Joint IMEKO Conference TC3, TC5 \& TC22}, event_date = {03-02-2014 to 05-02-2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Downes, S. and Knott, A. and Robinson, I.} } @Article { , title = {In-Situ Measurement of High Frequency Emission Caused by Photo Voltaic Inverters}, journal = {Proceedings of the 2014 International Symposium on EMC (EMC Europe) Gothenburg, Sweden}, year = {2014}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {74-78}, keywords = {EMC Directive, Solar Panels, PhotoVoltaic inverters, interference Ham Radio.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6930880}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {2325-0356}, DOI = {10.1109/EMCEurope.2014.6930880}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Keyer, C.H. and Timens, R.B. and Buesink, F.J.K. and Leferink, F.B.J.} } @Proceedings { , title = {Novel Equipment for in-situ Alpha Spectrometry}, journal = {Conference Proceedings: 8th International Conference on High Levels of Natural Radiation and Radon Areas held in Hotel Diplomat Prague, Czech Republic, 1-5 September 2014}, year = {2014}, volume = {-}, number = {-}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {96-101}, keywords = {alpha spectrometry, spectrum unfolding}, web_url = {http://www.ichlnrra2014prague.cz/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {-}, address = {-}, event_place = {Hotel Diplomat, Prague, Czech Republic}, event_name = {8th International Conference on High Levels of Natural Radiation and Radon Areas held in Hotel Diplomat Prague, Czech Republic}, event_date = {1-5 September 2014}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {P{\"o}ll{\"a}nen, R. and Turunen, J. and Karhunen, T. and Per{\"a}j{\"a}rvi, K. and Siiskonen, T. and Wirta, M. and Turunen, A.} } @Article { , title = {Characterization of Semiconductor Materials using Synchrotron Radiation-based Near-Field Infrared Microscopy and nano-FTIR Spectroscopy}, journal = {Optics Express}, year = {2014}, volume = {22}, number = {15}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {17948-17958}, keywords = {Instrumentation, measurement, and metrology, Near-field microscopy, Optics at surfaces, Spectroscopy, Thin films, optical properties}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-22-15-17948}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Optical Society of America (OSA)}, address = {Washington}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.22.017948}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hermann, PH and Hoehl, AH and Ulrich, GU and Fleischmann, CF and Hermelink, AH and K{\"a}stner, BK and Patoka, PP and Hornemann, AH and Beckhoff, BB and R{\"u}hl, ER and Ulm, GU} } @Article { , title = {Enhancing the sensitivity of mid-IR quantum cascade laser-based cavity-enhanced absorption spectroscopy using RF current perturbation}, journal = {Optics Letters}, year = {2014}, volume = {39}, number = {24}, number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments}, pages = {6811-6814}, keywords = {Semiconductor lasers, quantum cascade; Spectroscopy, infrared}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-39-24-6811}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Optical Society of America}, address = {Washington DC}, language = {30}, ISSN = {0146-9592}, DOI = {10.1364/OL.39.006811}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Manfred, KM and Kirkbride, JMR and Ciaffoni, L and Peverall, R and Ritchie, GAD} } @Proceedings { , title = {The new TSI radiometer CLARA}, journal = {Published in Proceedings Volume 9264: Earth Observing Missions and Sensors: Development, Implementation, and Characterization III}, year = {2014}, volume = {Conference Volume 9264 : December 2014}, number = {Proc. SPIE 9264, Earth Observing Missions and Sensors: Development, Implementation, and Characterization III, 92641S (November 19, 2014); doi:10.1117/12.2069614}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {Not relevant}, keywords = {TSI, radiometer, solar irradiance}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1939360\&resultClick=1}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {SPIE : International Society for Optics and Photonics}, address = {Cardiff, CF24 2SA}, event_place = {Xiaoxiong Xiong; Haruhisa Shimoda, Beijing, China}, event_name = {Earth Observing Missions and Sensors: Development, Implementation, and Characterization III , Xiaoxiong Xiong; Haruhisa Shimoda, Beijing, China}, event_date = {October 13, 2014}, language = {30}, ISBN = {Not Relevant}, ISSN = {Proc. SPIE 9264,}, DOI = {10.1117/12.2069614}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Koller, S and Finsterle, W and Beck, I and Spescha, M and Suter, M and Walter, B and Schmutz, W} } @Proceedings { , title = {New Material Standards For Traceability Of Roundness Measurements Of Large Scale Rotors}, journal = {Proceedings of the 58th Ilmenau Scientific Colloquium}, year = {2014}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, keywords = {Material standard, roundness, paper machine roll, steel mill roll, measurement uncertainty}, web_url = {https://www.db-thueringen.de/receive/dbt_mods_00025013}, web_url2 = {http://nbn-resolving.de/urn:nbn:de:gbv:ilm1-2014iwk-136:5}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {TU Ilmenau}, address = {Ilmenau}, event_place = {Ilmenau, Germany}, event_name = {58th Ilmenau Scientific Colloquium}, event_date = {08-09-2014 to 12-09-2014}, language = {30}, ISSN = {Online PPN: 802503594}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://nbn-resolving.de/urn:nbn:de:gbv:ilm1-2014iwk-136:5}, author = {Widmaier, T. and Kuosmanen, P. and Esala, V.-P. and Brabandt, D. and Haiko, J.} } @Article { , title = {Quasidynamic calibration of stroboscopic scanning white light interferometer with a transfer standard}, journal = {Optical Engineering}, year = {2013}, month = {12}, day = {20}, volume = {51}, number = {12}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {124104}, keywords = {Micro(nano)electromechanical systems, Scanning white light interferometry, stroboscopic scanning white light interferometry, traceability}, web_url = {http://opticalengineering.spiedigitallibrary.org/article.aspx?articleid=1790550}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, address = {not known}, language = {30}, ISSN = {N/A}, DOI = {10.1117/1.OE.52.12.124104}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Seppa, J and Kassamakov, I and Heikkenen, V and Nolvi, A and Paulin, T and Lassila, A and Haeggstrom, E} } @Article { , title = {Design and uncertainty assessment of a setup for calibration of microfluidic devices down to 5 nL min−1}, journal = {Measurement Science and Technology}, year = {2013}, month = {12}, day = {13}, volume = {25}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {1-9}, keywords = {microfluidics, micro-flow, flow measurement, front tracking, meniscus, uncertainty, calibration}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1088/0957-0233/25/1/015301}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ahrens, M. and Klein, S. and Nestler, B. and Damiani, C.} } @Article { , title = {Spontaneous symmetry breaking in spinor Bose-Einstein condensates}, journal = {Phys. Rev. A}, year = {2013}, month = {11}, day = {19}, volume = {88}, number = {5}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {053624}, keywords = {67.85.Fg, 03.75.Lm, 03.75.Mn, 11.30.Qc}, web_url = {http://arxiv.org/abs/1309.0424}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1094-1622}, DOI = {10.1103/PhysRevA.88.053624}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Scherer, M and L{\"u}cke, B and Peise, J and Topic, O and Gebreyesus, G and Deuretzbacher, F and Ertmer, W and Santos, L and Klempt, C and Arlt, J J} } @Proceedings { SalhiKKPKS2013, title = {Broadband channel propagation measurements on millimeter and sub-millimeter waves in a desktop download scenario}, year = {2013}, month = {11}, day = {5}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {Broadband communications, Terahertz communications, VNA channel sounding, electromagnetic wave propagation, indoor communications, millimeter waves}, web_url = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=6695037\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fxpls\%2Fabs_all.jsp\%3Farnumber\%3D6695037}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, event_place = {Seoul, Korea}, event_name = {Asia-Pacific Microwave Conference (APMC 2013)}, event_date = {5 to 8 November}, language = {English}, DOI = {10.1109/APMC.2013.6695037}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Salhi, M and Kleine-Ostmann, T and Kannicht, M and Priebe, S and K{\"u}rner, T and Schrader, T} } @Proceedings { SalhiPBKS2013, title = {Characterization of 4x4 Planar Antenna Arrays for the Frequencies 77 GHz and 94 GHz using an Antenna Scanning System}, year = {2013}, month = {11}, day = {5}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {Antenna Arrays, Antenna Radiation Pattern, Measurement techniques, Millimeter wave measurements, Patch Antennas, Phased Arrays}, web_url = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=6695036\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fiel7\%2F6679378\%2F6694817\%2F06695036.pdf\%3Farnumber\%3D6695036}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Seoul, Korea}, event_name = {Asia-Pacific Microwave Conference (APMC 2013)}, event_date = {5 to 8 November, 2013}, DOI = {10.1109/APMC.2013.6695036}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Salhi, M and Peiss, C and Botschka, M and Kleine-Ostmann, T and Schrader, T} } @Article { KielerSK2013, title = {Cryocooler operation of a pulse-driven AC Josephson voltage standard at PTB}, journal = {World Journal of Condensed Matter Physics}, year = {2013}, month = {11}, day = {4}, volume = {3}, number = {4}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {5}, keywords = {Josephson Voltage Standard, Josephson Arbitrary Waveform Synthesizer (JAWS), SNS Josephson Junction, Cryocooler, Helium-Free Setup}, web_url = {http://www.scirp.org/journal/PaperInformation.aspx?PaperID=38949\#.U2EDZKL-poQ}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, ISSN = {2160-6927}, DOI = {10.4236/wjcmp.2013.34031}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kieler, O. and Scheller, T. and Kohlmann, J.} } @Proceedings { , title = {Novel Method to Measure the Conversion-Losses (C.L.) of Microwave and mm-Wave Mixers}, year = {2013}, month = {11}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {731 - 733}, keywords = {mm-waves, mixer, power measurement, conversion-losses, VNA}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Seoul, Korea}, event_name = {Asia-Pacific Microwave Conference Proceedings (APMC 2013)}, event_date = {5-8 Nov. 2013}, language = {30}, DOI = {10.1109/APMC.2013.6694912}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kazemipour, A. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Proceedings { , title = {Analytical Study of mm-Wave and THz Beams, Application to RF Metrology}, year = {2013}, month = {11}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {1206 - 1208}, keywords = {THz, mm-wave, Gaussian-beam, wave-front phase, RF metrology}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Seoul, Korea}, event_name = {Asia-Pacific Microwave Conference Proceedings (APMC 2013)}, event_date = {5-8 Nov. 2013}, language = {30}, DOI = {10.1109/APMC.2013.6695072}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kazemipour, A. and Kleine-Ostmann, T. and Schrader, T.} } @Article { OlschewskiEFGHKMPPRSK2013, title = {The in-flight blackbody calibration system for the GLORIA interferometer on board an airborne research platform}, journal = {Atmospheric Measurement Techniques (AMT)}, year = {2013}, month = {11}, volume = {6}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, web_url = {http://www.atmos-meas-tech.net/6/3067/2013/amt-6-3067-2013.html}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, DOI = {10.5194/amt-6-3067-2013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Olschewski, F. and Ebersoldt, A. and Friedl-Vallon, F. and Gutschwager, B. and Hollandt, J. and Kleinert, A. and Monte, C. and Piesch, C. and Preusse, P. and Rolf, C. and Steffens, P. and Koppmann, R.} } @Proceedings { , title = {A multi-institute european project for providing improved and simpler traceability to the kelvin}, year = {2013}, month = {10}, day = {7}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2013/01/metrology_metr2013_15006/metrology_metr2013_15006.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Paris}, event_name = {16th International Congress of Metrology}, event_date = {October 7-10, 2013}, language = {30}, DOI = {10.1051/metrology/201315006}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {del Campo, Dolores and Bojkovski, Jovan and Dobre, Miruna and Filipe, Eduarda and Kalemci, Murat and Merlone, Andrea and Pearce, Jonathan and Peruzzi, Andrea and Sparasci, Fernando and Strnad, Radek and Taubert, Dietert and Turz{\'o}-Andr{\'a}s, Emese} } @Proceedings { , title = {Novel mathematical and statistical approaches to uncertainty evaluation in the context of regression and inverse problems}, journal = {16th International Congress of Metrology}, year = {2013}, month = {10}, day = {7}, volume = {-}, number = {2013}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {04003}, keywords = {-}, tags = {MAT}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_04003.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {EDP Sciences}, address = {Les Ulis \& London}, event_place = {Paris}, event_name = {16th International Congress of Metrology}, event_date = {07-10-2013 to 10-10-2013}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/201304003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Elster, C and Klauenberg, K and B{\"a}r, M and Allard, A and Fischer, N and Kok, G and van der Veen, A and Harris, P and Cox, M and Smith, I and Cowen, S and Wilson, P and Ellison, S} } @Article { , title = {Establishing traceability of photometric absorbance values for accurate measurements of the haemoglobin concentration in blood}, journal = {Metrologia}, year = {2013}, month = {10}, day = {3}, volume = {50 / 2013}, number = {5}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {539 - 548}, keywords = {traceability, haemoglobin concentration, photometric absorbance}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/50/5/539/meta}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP}, address = {Bristol}, language = {30}, ISSN = {0026-1394 (print) ; 1681-7575 (online)}, DOI = {10.1088/0026-1394/50/5/539}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Witt, K. and Wolf, H. U. and Heuck, C. and Kammel, M. and Kummrow, A. and Neukammer, J.} } @Article { , title = {Linking dynamic to static pressure by laser interferometry.}, journal = {Metrologia}, year = {2013}, month = {10}, volume = {50}, number = {6}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {580-585}, keywords = {dynamic pressure calibration, refractive index, interferometry}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP}, address = {Bristol}, language = {30}, ISSN = {ISSN 0026-1394 (print) ; ISSN 1681-7575 (online)}, DOI = {10.1088/0026-1394/50/6/580}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, stag_bib_extends_persistent_identifier = {https://stacks.iop.org/Met/50/580}, author = {Bruns, Th. and Franke, E. and Kobusch, M.} } @Proceedings { PiacentiniGMDGBPPKTLRPMBG2013, title = {Some recent progresses in quantum tomography realised at INRIM}, journal = {Proc. SPIE 8875, Quantum Communications and Quantum Imaging XI}, year = {2013}, month = {9}, day = {26}, volume = {8875}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {13}, web_url = {http://spie.org}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Diego, California, United States}, event_name = {Quantum Communications and Quantum Imaging XI}, event_date = {August 25, 2013}, language = {English}, DOI = {10.1117/12.2023067}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F and Goldschmidt, E. A and Mingolla, Maria G and Degiovanni, I. P and Gramegna, M and Berchera, I. R and Polyakov, S. V and Peters, S and K{\"u}ck, S and Taralli, E and Lolli, L and Rajteri, M and Paris, M. G. A and Migdall, A and Brida, G and Genovese, M} } @Article { , title = {Microwave surface impedance measurements on reduced graphene oxide}, journal = {Applied Physics Letters}, year = {2013}, month = {9}, day = {17}, volume = {103}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {123103}, keywords = {grapheme, permittivity, quartz, sapphire}, web_url = {http://scitation.aip.org/content/aip/journal/apl/103/12/10.1063/1.4821268}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, address = {Melville, NY}, language = {30}, ISSN = {n/a}, DOI = {10.1063/1.4821268}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-9-17}, author = {Hao, L and Gallop, J and Goniszewski, S and Shaforost, O and Klein, N and Yakimova, R} } @Article { , title = {Grazing-incidence x-ray fluorescence analysis for non-destructive determination of In and Ga depth profiles in Cu(In,Ga)Se2 absorber films}, journal = {Applied Physics Letters}, year = {2013}, month = {9}, day = {12}, volume = {103}, number = {11}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1-12}, keywords = {Fluorescence, copper, synchrotron radiation, x-ray fluorescence spectroscopy, solar cells}, web_url = {http://scitation.aip.org/content/aip/journal/apl/103/11/10.1063/1.4821267}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {AIP Publishing}, address = {New York}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4821267}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Streeck, CS and Brunken, SB and Gerlach, MG and Herzog, CHB and H{\"o}nicke, PH and Kaufmann, CAK and Lubeck, JL and Malzer, WM and Pollakowski, BP and Unterumsberger, RU and Weber, AW and Beckhoff, BB and Kanngie{\ss}er, BK and Schock, HWS and Mainz, RM} } @Proceedings { , title = {Measurement of thermodynamic temperature of high temperature fixed points}, journal = {AIP Conference Proceedings}, year = {2013}, month = {9}, day = {11}, volume = {1552}, number = {329}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1-7}, keywords = {Radiation thermometry  High temperature fixed point  Thermodynamic temperature  Trap detector  Filter radiometer  Spectral responsivity  Blackbody.}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4819561}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Scitation}, address = {Melville}, event_place = {Los Angeles, California, USA}, event_name = {TEMPERATURE: ITS MEASUREMENT AND CONTROL IN SCIENCE AND INDUSTRY, VOLUME 8: Proceedings of the Ninth International Temperature Symposium}, event_date = {19–23 March 2012}, language = {30}, ISBN = {978-0-7354-1178-4}, DOI = {10.1063/1.4819561}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gavrilov, V.R and Khlevnoy, B.B and Otrayaskin, D.A and Grigorieva, I.A and Samoylov, M.L and Sapritsky, V.I} } @Proceedings { , title = {Comparison of Co-C eutectic fixed-point cells between VNIIM and VNIIOFI}, journal = {AIP Conference Proceedings}, year = {2013}, month = {9}, day = {11}, volume = {1552}, number = {771}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1-7}, keywords = {fixed points, cobalt, eutectic, comparison, radiation temperature.}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821405}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Scitation}, address = {Melville}, event_place = {Los Angeles, California, USA}, event_name = {TEMPERATURE: ITS MEASUREMENT AND CONTROL IN SCIENCE AND INDUSTRY, VOLUME 8: Proceedings of the Ninth International Temperature Symposium}, event_date = {19–23 March 2012}, language = {30}, ISBN = {978-0-7354-1178-4}, ISSN = {NA}, DOI = {10.1063/1.4821405}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Slid, Y and Khlevnoy, B and Matveyev, M and Grigorieva, I.A and Fuksov, V.M} } @Article { , title = {Magnetoencephalography of Deep Lying Auditory Sources Using Acoustical Devices for Infra- and Ultrasound Stimulation}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2013}, month = {9}, day = {7}, volume = {58\verb=^=}, number = {1E}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {2}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Biomedical Engineering / Biomedizinische Technik - DE GRUYTER}, address = {Berlin}, language = {30}, ISSN = {ISSN (Online) 1862-278X, ISSN (Print) 0013-5585}, DOI = {10.1515/bmt-2013-4135}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bauer, M and Baker, C and Barham, R and Hensel, J and Kling, C and Trahms, L and Koch, C and Sander, T} } @Article { LittletonKFR2013, title = {Spectral Interferometric Implementation with Passive Polarisation Optics of Coherent Anti-Stokes Raman Scattering}, journal = {Physical Review Letters}, year = {2013}, month = {9}, day = {5}, volume = {111}, number = {0031-9007}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, keywords = {coherent anti-Stokes Raman scattering, non-resonant background, hyperspectral imaging, vibrational imaging}, web_url = {http://journals.aps.org/prl/abstract/10.1103/PhysRevLett.111.103902}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {Englisch}, DOI = {10.1103/PhysRevLett.111.103902}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Littleton, B. and Kavanagh, T. and Festy, F. and Richards, D.} } @Proceedings { KleineOstmann2013, title = {THz Metrology}, year = {2013}, month = {9}, day = {1}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {THz Metrology, THz Time-Domain Spectroscopy, Vector Network Analysis, THz Radiometry}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6665913}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Mainz, Germany}, event_name = {The 38th International Conference on Infrared, Milimeter and Terahertz Waves (IRMMW-THz 2013)}, event_date = {1 to 6 September 2013}, language = {English}, DOI = {10.1109/IRMMW-THz.2013.6665913}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kleine-Ostmann, T} } @Proceedings { SalhiKS2013, title = {Design and characterization of 4\(\times\)4-phased-array patch antennas at 77 GHz and 94 GHz}, year = {2013}, month = {9}, day = {1}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {Patch Antenna Arrays, THz Radiation}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6665641}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Mainz, Germany}, event_name = {The 38th International Conference on Infrared, Milimeter and Terahertz Waves (IRMMW-THz 2013)}, event_date = {1 to 6 September, 2013}, language = {English}, DOI = {10.1109/IRMMW-THz.2013.6665641}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Salhi, M and Kleine-Ostmann, T and Schrader, T} } @Proceedings { KleineOstmannSKPKS2013, title = {Broadband Channel Measurements between 50 GHz and 325 GHz: Comparison of Different Propagation Scenarios}, year = {2013}, month = {9}, day = {1}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {THz communications, sub-mm wave channel characterization}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6665493}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Mainz, Germany}, event_name = {The 38th International Conference on Infrared, Milimeter and Terahertz Waves (IRMMW-THz 2013)}, event_date = {1 to 6 September, 2013}, language = {English}, DOI = {10.1109/IRMMW-THz.2013.6665493}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kleine-Ostmann, T and Salhi, M and Kannicht, M and Priebe, S and K{\"u}rner, T and Schrader, T} } @Article { , title = {Novel Broadband THz-Detector}, journal = {Infrared, Millimeter, and Terahertz Waves (IRMMW-THz), 2013, 38th International Conference on}, year = {2013}, month = {9}, day = {1}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {2}, keywords = {THz detector, traceability to SI, radiometry, pyroelectric detector}, web_url = {http://www.theconference2013.com}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {Mainz}, language = {30}, DOI = {10.1109/IRMMW-THz.2013.6665749}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {INSPEC Accession Number: 13915728}, author = {Muller, Ralf and Kehrt, Mathias and Monte, Christian and Steiger, Andreas and Bohmeyer, Werner and Lange, Karsten} } @Article { , title = {Comparative measurements on atomic layer deposited Al2O3 thin films using ex situ table top and mapping ellipsometry, as well as X-ray and VUV reflectometry}, journal = {Thin Solid Films}, year = {2013}, month = {8}, day = {31}, volume = {541}, number = {Current Trends in Optical and X-Ray Metrology of Advanced Materials for Nanoscale Devices III}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {131-135}, keywords = {Spectroscopic ellipsometry, X-ray reflectometry, VUV reflectometry, Atomic layer deposition, Ultra-thin layer}, web_url = {http://www.sciencedirect.com/science/article/pii/S0040609013000175}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, language = {30}, ISSN = {0040-6090}, DOI = {10.1016/j.tsf.2012.12.091}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Petrik, PP and Gumprecht, TG and Nutsch, AN and Roeder, GR and Lemberger, ML and Juhasz, GJ and Polgar, OP and Major, CM and Kozma, PK and Janosov, MJ and Fodor, BF and Agocs, EA and Fried, MF} } @Proceedings { , title = {Microwave characterization of large area graphene using a TE011 dielectric resonator}, journal = {Proceedings of Microwaves, Millimeter and Submillimeter Waves}, year = {2013}, month = {8}, day = {13}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {427-429}, keywords = {graphene, dielectrics, resonators, microwave, Substrates, Microwave theory and techniques, Resistance, Apertures, Electric fields}, web_url = {http://ieeexplore.ieee.org/document/6622095/?arnumber=6622095}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {Melville}, event_place = {Kharkov, Ukraine}, event_name = {International Kharkov Symposium on Physics and Engineering of Microwaves, Millimeter and Submillimeter Waves}, event_date = {23-06-2013 to 28-06-2013}, language = {30}, ISBN = {978-1-4799-1068-7}, DOI = {10.1109/MSMW.2013.6622095}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaforost, O and Wang, K and Adabi, M and Guo, Zh and Hao, L and Gallop, J and Klein, N} } @Article { CappellaBSKLWH, title = {High Temperature Thermal Conductivity of Amorphous Al2O3 Thin Films Grown by Low Temperature ALD}, journal = {Advanced Engineering Materials}, year = {2013}, month = {8}, day = {6}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, keywords = {ALD, amorphous alumina, modulated photothermal radiometry, thermal conductivity}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1002/adem.201300132}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Cappella, Andrea and Battaglia, Jean-Luc and Schick, Vincent and Kusiak, Andrzej and Lamperti, Alessio and Wiemer, Claudia and Hay, Bruno} } @Article { , title = {Acoustic field characterization of the Duolith: Measurements and modeling of a clinical shock wave therapy device}, journal = {Journal of the Acoustical Society of America}, year = {2013}, month = {8}, volume = {134}, number = {2}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1663-1674}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Acoustical Society of America}, address = {Melville}, language = {30}, ISSN = {0001-4966}, DOI = {10.1121/1.4812885]}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Perez, C and Chen, H and Matula, TJ and Karzova, M and Khokhlova, VA} } @Article { PykaHKM2013, title = {A high-precision segmented Paul trap with minimized micromotion for an optical multiple-ion clock}, journal = {Applied Physics B}, year = {2013}, month = {7}, day = {25}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {http://link.springer.com/article/10.1007\%2Fs00340-013-5580-5/fulltext.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer-Verlag Berlin Heidelberg 2013}, DOI = {10.1007/s00340-013-5580-5}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pyka, K. and Herschbach, N. and Keller, J. and Mehlst{\"a}ubler, T. E.} } @Proceedings { , title = {Thin-film microsusceptometer with integrated nanoloop}, journal = {IEEE 14th International Proceedings of Superconductive Electronics Conference}, year = {2013}, month = {7}, day = {20}, volume = {n/a}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1-3}, keywords = {thin film, microsusceptometers, nanoloops}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6604262\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fiel7\%2F6598362\%2F6604250\%2F06604262.pdf\%3Farnumber\%3D6604262}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, event_place = {Cambridge, MA}, event_name = {IEEE 14th International Proceedings of Superconductive Electronics Conference}, event_date = {7-11 July 2013}, language = {30}, ISBN = {978-1-4673-6369-3}, ISSN = {n/a}, DOI = {10.1109/ISEC.2013.6604262}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Drung, D and Storm, J. H. and Ruede, F and Kirste, A and Regin, M and Schurig, T and Repoll{\'e}s, A. M. and Ses{\'e}, J and Luis, F} } @Article { , title = {Measurement of the thermodynamic temperature of high-temperature fixed points}, journal = {Measurement Techniques}, year = {2013}, month = {7}, day = {19}, volume = {56}, number = {4}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {433-439}, keywords = {radiation thermometry, high-temperature fixed point, thermodynamic temperature, spectral sensitivity.}, web_url = {http://link.springer.com/article/10.1007/s11018-013-0224-z}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Link}, address = {Europe/Asia/Africa}, language = {30}, DOI = {10.1007/s11018-013-0224-z}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Khlevnoi, B.B and Gavrilov, V.R and Otryaskin, D.A and Grigor'eva, I.A and Solodilov, M.V and Samoilov, M.L and Sapritskii, V.I} } @Article { GoldschmidtPRPPKBDMG2013, title = {Mode reconstruction of a light field by multi-photon statistics}, journal = {Physical Review A}, year = {2013}, month = {7}, day = {15}, volume = {88}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {013822 [1-5]}, web_url = {http://journals.aps.org/pra/abstract/10.1103/PhysRevA.88.013822}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {1050-2947}, DOI = {10.1103/PhysRevA.88.013822}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Goldschmidt, E. and Piacentini, F. and Ruo Berchera, I. and Polyakov, S. and Peters, S. and Kueck, S. and Brida, G. and Degiovanni, I. and Migdall, A. and Genovese, M.} } @Article { RajkumarMCSTK2013, title = {3-D Mapping of Sensitivity of Graphene Hall Devices to Local Magnetic and Electrical Fields}, journal = {IEEE Transactions on Magnetics}, year = {2013}, month = {7}, volume = {49}, number = {7}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {Epitaxial graphene, Hall sensor, numerical modeling}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6559189}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2013.2243708}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rajkumar, R.K and Manzin, A and Cox, D.C and Silva, S.R.P and Tzalenchuk, A and Kazakova, O} } @Article { PanchalILYAK2013, title = {Magnetic Scanning Probe Calibration Using Graphene Hall Sensor}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2013}, month = {7}, volume = {49}, number = {7}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {Epitaxial graphene, Hall sensor, Kelvin probe force microscopy (KPFM), magnetic probe calibration}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6558904}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2013.2243127}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, Vishal and Iglesias-Freire, {\'O}scar and Lartsev, Arseniy and Yakimova, Rositza and Asenjo, Agustina and Kazakova, Olga} } @Proceedings { KungMN2013, title = {Virtual CMM method applied to aspherical lens parameters calibration}, year = {2013}, month = {5}, day = {29}, volume = {1}, number = {O2.4}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {Micro coordinate metrology, asphere, measurement uncertainty, Monte Carlo simulation, virtual CMM}, web_url = {http://www.euspen.eu/Library/ProceedingsPresentations.aspx}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Berlin, Germany}, event_name = {13th International Conference of the European Society for precision engineering and nanotechnology (Euspen'13)}, event_date = {May 29, 2013}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ng, A. and Meli, F. and Nicolet, A.} } @Article { , title = {Nanoscale imaging reveals laterally expanding antimicrobial pores in lipid bilayers}, journal = {PNAS}, year = {2013}, month = {5}, day = {28}, volume = {110}, number = {22}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {8918-8923}, keywords = {innate host defense de novo protein design nanometrology antibiotics nanoscopy}, web_url = {http://www.pnas.org/content/110/22/8918.abstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1073/pnas.1222824110}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rakowska, Paulina and Jiang, Haibo and Ray, Santanu and Pyne, Alice and Lamarre, Baptiste and Carr, Matthew and Judge, Peter and Ravi, Jascindra and Gerling, Ulla I. M. and Koksch, Beate and Martyna, Glenn J. and Hoogenboom, Bart W. and Watts, Anthony and Crain, Jason and Grovenor, Chris R. M. and Ryadnov, Maxim G.} } @Article { , title = {Feedback control of trapped coherent atomic ensembles}, journal = {Phys. Rev. Lett.}, year = {2013}, month = {5}, day = {23}, volume = {110}, number = {21}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {210503}, keywords = {03.67.-a, 03.65.Yz, 37.30.+i}, web_url = {http://arxiv.org/abs/1207.3203}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.110.210503}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vanderbruggen, T and Kohlhaas, R and Bertoldi, A and Bernon, S and Aspect, A and Landragin, A and Bouyer, P} } @Article { , title = {Reducing effects of thermal noise in optical cavities}, journal = {Applied Physics B}, year = {2013}, month = {5}, day = {18}, volume = {113}, number = {2013}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {233-242}, web_url = {http://download.springer.com/static/pdf/221/art\%253A10.1007\%252Fs00340-013-5464-8.pdf?auth66=1386329855_1ff0f343cbf51cf62e1a31453bdb0df2\&ext=.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1007/s00340-013-5464-8}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Amairi, S. and Legero, T. and Kessler, T. and Sterr, U. and W{\"u}bbena, J. and Mandel, O. and Schmidt, O.} } @Proceedings { BinderMK2013, title = {Elimination of Signal Time Delays for Precise IGBT Switching Loss Measurement}, year = {2013}, month = {5}, day = {16}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Nuremberg, Germany}, event_name = {PCIM Europe 2013}, event_date = {May 14-16, 2013}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Binder, O. and Meisner, J. and Kurrat, M.} } @Proceedings { , title = {Static and (quasi)dynamic calibration of stroboscopic scanning white light interferometer}, journal = {Proceedings of Society of Photo Optical Instrumentation Engineers}, year = {2013}, month = {5}, day = {13}, volume = {8788}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {87883J}, keywords = {stroboscopic scanning light interferometer, M(N)EMS devices, Interferometers ; Calibration ; Scanning ; Transducers ; Mirrors ; Equipment and services ; Heterodyning ; Lasers ; Light sources ; Metrology}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1687502}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, address = {n/a}, event_place = {Munich, Germany}, event_name = {Optical Measurement Systems for Industrial Inspection VIII}, event_date = {13-05-2013}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1117/12.2020525}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sepp{\"a}, J and Kassamakov, I and Nolvi,, A and Heikkinen, V and Paulin, T and Hao, L and Lassila, A and H{\ae}ggsr{\"o}m, E} } @Article { , title = {COMPARATIVE INVESTIGATIONS OF COBALT–CARBON EUTECTIC HIGH-TEMPERATURE FIXED POINT CELLS CONSTRUCTED AT THE VNIIM AND VNIIOFI}, journal = {Measurement Techniques}, year = {2013}, month = {5}, day = {10}, volume = {56}, number = {1}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {72-78}, keywords = {fixed point, cobalt, carbon, eutectic, comparison, radiation temperature, thermometry, black body.}, web_url = {http://link.springer.com/article/10.1007/s11018-013-0161-x}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Link}, address = {Europe/Asia/Africa}, language = {30}, ISSN = {NA}, DOI = {10.1007/s11018-013-0161-x}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Khlevnoy, B.B and Sil'd, Yu.A and Mateev, M.S and Grigorieva, I.A and Fuksov, V.M} } @Proceedings { , title = {Quantitative assessment of nano wear of DLC coated samples using AFM and optical confocal microscopy}, journal = {Proceedings of Euspen Conference, 13th International Conference of the european society for precision engineering and nanotechnology, At Berlin}, year = {2013}, month = {5}, volume = {Proceedings of the 13th International Conference of the European Society for Precision Engineering and Nanotechnology}, number = {1}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {124-127}, web_url = {https://www.researchgate.net/publication/272810775_Quantitative_assessment_of_nano_wear_of_DLC_coated_samples_using_AFM_and_optical_confocal_microscopy}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {ResearchGate}, address = {Berlin}, event_place = {Berlin, Germany}, event_name = {13th International Conference of the European Society for Precision Engineering and Nanotechnology}, event_date = {27-05-2013 to 31-05-2013}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Dai, GD and Pohlenz, FP and Bosse, HB and Kovalev, AK and Spaltmann, DS and Woydt, MW} } @Article { RossommeDMBLSAAPTK2013, title = {Fluence correction factors for graphite calorimetry in a low-energy clinical proton beam: I. Analytical and Monte Carlo simulations}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {4}, day = {30}, volume = {58}, number = {10}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {3481-3499}, keywords = {graphite calorimetry, monte carlo, fluence correction, proton beam}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/58/10/3481}, stag_bib_extends_levelofaccess = {NA}, author = {Rossomme, S and Dobrovodsk{\'y}, J and Martinkovič, J and Bassler, N and L{\"u}hr, A and Shipley, D and Andreo, P and Al-Sulaiti, L and Palmans, H and Thomas, R A S and Kacperek, A} } @Article { , title = {Quantitative analysis of nano-wear on DLC coatings by AFM}, journal = {CIRP Annals - Manufacturing Technology}, year = {2013}, month = {4}, day = {10}, volume = {62}, number = {1}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {543-546}, keywords = {Surface analysis, Diamond coating, Wear}, web_url = {http://www.sciencedirect.com/science/article/pii/S0007850613000231}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, ISSN = {0007-8506}, DOI = {10.1016/j.cirp.2013.03.022}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Dai, GD and Pohlenz, FP and Felgner, AF and Bosse, HB and Kunzmann, HK} } @Article { KazakovaBPYY2013, title = {Epitaxial graphene on SiC(0001): Functional electrical microscopy studies and effect of atmosphere}, journal = {Nanotechnology}, year = {2013}, month = {4}, volume = {24}, number = {21}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, web_url = {http://iopscience.iop.org/0957-4484/24/21/215702/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0957-4484}, DOI = {10.1088/0957-4484/24/21/215702}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazakova, O and Burnett, T. L and Patten, J and Yang, L and Yakimova, R} } @Article { AntonKKVGZM2013, title = {Difference in the relative response of the alanine dosimeter to megavoltage x-ray and electron beams}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {3}, day = {24}, volume = {58 (2013)}, number = {10}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {3259 - 3282}, keywords = {EPR, alanine, response, dosimetry, absorbed dose to water, megavoltage x-rays, high energy electrons}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {0031-9155 (print) ; 1361-6560 (online)}, DOI = {10.1088/0031-9155/58/10/3259}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Anton, Mathias and Kapsch, Ralf-Peter and Krauss, Achim and Voigts-Rhetz, Philip von and Giessen-Friedberg, Giessen and Zink, Klemens and McEwen, Malcolm} } @Article { , title = {Subhertz-linewidth infrared frequency source with a long-term instability below 5\(\times\)10\verb=^=-15}, journal = {Applied Physics B}, year = {2013}, month = {3}, day = {1}, volume = {110}, number = {4}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {465-470}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {Print: 0946-2171, Online: 1432-0649}, DOI = {10.1007/s00340-012-5280-6}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Raupach, S. M. F. and Legero, T. and Grebing, C. and Hagemann, Ch. and Kessler, T. and Koczwara, A. and Lipphardt, B. and Misera, M. and Schnatz, H. and Grosche, G. and Sterr, U.} } @Article { KazakovaPB2013, title = {Epitaxial Graphene and Graphene–Based Devices Studied by Electrical Scanning Probe Microscopy}, journal = {Cystals}, year = {2013}, month = {3}, volume = {3}, number = {1}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {Pitaxial graphene; SiC; adsorbates; Kelvin Probe Force Microscopy (KPFM); Electrostatic Force Microscopy (EFM); surface potential; work function; wettability}, web_url = {http://www.mdpi.com/2073-4352/3/1/191}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, ISSN = {2073-4352}, DOI = {10.3390/cryst3010191}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazakova, Olga and Panchal, Vishal and Burnett, Tim. L} } @Article { , title = {Providing 10\verb=^=-16 short-term stability of a 1.5 \(\mu\)m laser to optical clocks}, journal = {IEEE TIM (Transactions on Instrumentation and Measurement)}, year = {2013}, month = {2}, day = {21}, volume = {62}, number = {6}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {1556 - 1562}, keywords = {Atomic clocks, femtosecond frequency combs, frequency control, laser stability, optical phase-locked loops, stability transfer, transfer oscillator}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2013.2242597}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hagemann, C and Grebing, C and Kessler, T and Falke, St. and Lisdat, C and Schnatz, H and Riehle, F and Sterr, U} } @Article { , title = {Chemical speciation at buried interfaces in high-temperature processed polycrystalline silicon thin-film solar cells on ZnO}, journal = {Journal of Applied Physics}, year = {2013}, month = {1}, day = {31}, volume = {113}, number = {4}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1-8}, keywords = {polycrystalline, Thin film, Solar Cells, High-temperature}, web_url = {http://scitation.aip.org/content/aip/journal/jap/113/4/10.1063/1.4789599}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {AIP Publishing}, address = {New york}, language = {30}, ISSN = {0021-8979}, DOI = {10.1063/1.4789599}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Becker, CHB and Pagels, MP and Zach{\"a}us, CZ and Pollakowski, BP and Beckhoff, BB and Kanngie{\ss}er, BK and Rech, BR} } @Article { PanchalCYK2013, title = {Epitaxial Graphene Sensors for Detection of Small Magnetic Moments}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2013}, month = {1}, volume = {49}, number = {1}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {Dynal bead, electron beam irradiation, epitaxial graphene, Hall sensor, single particle detection}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6392383}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2012.2218277}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, Vishal and Cox, David and Yakimova, Rositza and Kazakova, Olga} } @Article { , title = {Zero wear (Null Verschlei{\ss})}, journal = {Tribologie und Schmierungstechnik}, year = {2013}, month = {1}, volume = {60}, number = {2/13}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {5-12}, web_url = {https://www.researchgate.net/publication/258055524_Zero_Wear_Null_Verschleiss}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Curt R Vincentz Verlag}, language = {30}, ISSN = {0724-3472}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kovalev, AK and Hartelt, MH and Spaltmann, DS and W{\"a}sche, RW and Woydt, MW} } @Article { MirovskyFHKLPMS2013, title = {Towards quantized current arbitrary waveform synthesis}, journal = {Applied Physics Letters}, year = {2013}, volume = {113}, number = {213704}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {213704-1 - 213704-4}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1063/1.4807929}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Mirovsky, P. and Fricke, L. and Hohls, F. and Kaestner, B. and Leicht, C. and Pierz, K. and Melcher, J. and Schumacher, H.} } @Article { QuagliottiMMSK2013, title = {A finite element analysis of surface-stress effects on measurement of the Si lattice parameter measurement}, journal = {Metrologia}, year = {2013}, volume = {50}, number = {3}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, keywords = {Avogadro constant, Planck constant, kilogram redefinition, Si lattice parameter, surface stress}, web_url = {http://stacks.iop.org/Met/50/243}, web_url2 = {http://arxiv.org/abs/1302.4578}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1088/0026-1394/50/3/243}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Quagliotti, D. and Mana, G. and Massa, E. and Sasso, C. and Kuetgens, U.} } @Article { FrickeWKKTNHMMDWPS2013, title = {Counting statistics for electron capture in a dynamic quantum dot}, journal = {Physical Review Letters}, year = {2013}, volume = {110}, number = {126803}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {126803-1 - 126803-5}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.110.126803}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Fricke, L. and Wulf, M. and Kaestner, B. and Kashcheyevs, V. and Timoshenko, J. and Nazarov, P. and Hohls, F. and Mirovsky, P. and Mackrodt, B. and Dolata, R. and Weimann, T. and Pierz, K. and Schumacher, H.} } @Article { NicolausBBBFBFKKKK, title = {Current State of Avogadro 28Si sphere S8}, journal = {IEEE TRANSACTIONS ON INSTRUMENTATION AND MEASUREMENT}, year = {2013}, volume = {62}, number = {6}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {1499 - 1505}, keywords = {Avogadro’s constant, International System of Units (SI) unit, kilogram, measurement uncertainty, redefinition}, web_url = {http://ieeexplore.ieee.org.}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2013.2242633}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nicolaus, R. and Bartl, G. and Bettin, H. and Borys, M. and Firlus, M. and Busch, I. and Felgner, A. and Kr{\"u}ger-Sehm, R. and Krumrey, M. and Krystek, M. and Kuetgens, U.} } @Article { NabaeiRMKT2013, title = {Optimization of Hall bar response to localized magnetic and electric fields}, journal = {Journal of Applied Physics}, year = {2013}, volume = {113}, number = {6}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {Hall sensors, Scanning probe microscopy, Numerical models}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0021-8979 (print) 1089-7550 (online)}, DOI = {10.1063/1.4790508}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nabaei, V. and Rajkumar, R. K. and Manzin, A. and Kazakova, O. and Tzalenchuk, A.} } @Proceedings { SchulzEK2013, title = {High accuracy flatness metrology within the European Metrology Research Program}, journal = {Nuclear Instruments and Methods in Physics Research A}, year = {2013}, volume = {710}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {37-41}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, event_place = {Barcelona, Spain}, event_name = {4th International Workshop on Metrology for X-ray Optics, Mirror Design and Fabrication}, event_date = {4 - 6 July 2012}, language = {English}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2012.10.112}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Schulz, M. and Ehret, G. and Kren, P.} } @Article { ErmelMKK2013, title = {Adaptive Acquisition of Power IGBT Transients with Discrimination Circuit}, journal = {Instrumentation and Measurement, IEEE Transactions on}, year = {2013}, volume = {62}, number = {9}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {Measurement; IGBT; converters; voltage transients; discriminator}, web_url = {http://www.researchgate.net/publication/260304197_Adaptive_Acquisition_of_Power_IGBT_Transients_With_Discrimination_Circuit}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, DOI = {10.1109/tim.2013.2272395}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ermel, V. and Meisner, J. and Kurrat, M. and Kahmann, M.} } @Proceedings { HoffmannWZNHK2013, title = {Calibration Algorithm for Nearfield Scanning Microwave Microscopes}, journal = {Proceedings of the IEEE Nano 2012}, year = {2013}, number2 = {IND02: EMINDA: Electromagnetic Characterization of Materials for Industrial Applications up to Microwave Frequencies}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Birmingham, UK}, event_name = {IEEE Nano 2012: 12th International Conference on Nanotechnology}, event_date = {20 - 23 August 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hoffmann, J. and Wollensack, M. and Zeier, M. and Niegemann, J. and Huber, H.-P. and Kienberger, F.} } @Proceedings { KoppmannOSRPEFKPHGM2012, title = {An In-flight Blackbody Calibration Source for the GLORIA Interferometer Onboard an Airborne Research Platform}, journal = {AIP Conference Proceedings}, year = {2013}, volume = {1531}, number = {322}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {GLORIA, Remote sensing, Blackbody, Calibration, Infrared, Limb sounder, Thermoelectric cooler, ITS-90}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {AIP}, event_place = {Berlin, Germany}, event_name = {Radiation Processes in the Atmosphere and Ocean (IRS2012)}, event_date = {6 - 10 August 2012}, language = {English}, DOI = {10.1063/1.4804774}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Koppmann, R. and Olschewski, F. and Steffens, P. and Rolf, C. and Preusse, P. and Ebersoldt, A. and Friedl-Vallon, F. and Kleinert, A. and Piesch, C. and Hollandt, J. and Gutschwager, B. and Monte, C.} } @Proceedings { MerloneLABBBdDDEGGHHJKKMMMdSSSSSV2013, title = {A new challenge for meteorological measurements: The ''MeteoMet'' project - Metrology for meteorology}, journal = {AIP Conference Proceedings}, year = {2013}, volume = {8}, number = {1552}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {1030-1035}, keywords = {air humidity, air pressure, air temperature, air speed and direction, historical temperature data series, meteorological instruments calibration, traceable climate measurements}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821419}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Los Angeles (USA)}, event_name = {9th International Temperature Symposium}, event_date = {19-23 March 2012}, DOI = {10.1063/1.4821419}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Merlone, A. and Lopardo, G. and Antonsen, I. and Bell, S. and Benyon, R and Boese, N. and del Campo, D. and Dobre, M. and Drnovsek, J. and Elkatmis, A. and Georgin, E. and Grudniewicz, E. and Heinonen, M. and Holstein-Rathlou, C. and Johansson, J. and Klason, P. and Knorova, R. and Melvad, C. and Merrison, J. and Migaa, K. and de Podesta, M. and Saathoff, H. and Smorgon, D. and Sparasci, F. and Strnad, R. and Szmyrka-Grzebyk, A. and Vuillermoz, E.} } @Article { KumarERPU2013, title = {Phase retrieval between overlapping orders in coherentFourier scatterometry using scanning}, journal = {Journal of the European Optical Society Rapid Publications}, year = {2013}, volume = {8}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Fourier scatterometry}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.2971/jeos.2013.13048}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kumar, N. and El Gawhary, O. and Roy, S. and Pereira, S. and Urbach, H.} } @Article { RoyKPU2013, title = {Interferometric coherent Fourier scatterometry: a method for obtaining high sensitivity in the optical inverse-grating problem}, journal = {Journal of Optics}, year = {2013}, volume = {15}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Fourier scatterometry}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1088/2040-8978/15/7/075707}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Roy, S. and Kumar, N. and Pereira, S. and Urbach, H.} } @Article { LiebingSKRRLOS2013, title = {Tunneling magneto thermocurrent in CoFeB/MgO/CoFeB based magnetic tunnel junctions}, journal = {Applied Physics Letters}, year = {2013}, volume = {102}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1063/1.4811737}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Liebing, N. and Serrano-Guisan, S. and Krzysteczko, P. and Rott, K. and Reiss, G. and Langer, J. and Ocker, B. and Schumacher, H.} } @Proceedings { KovarSSA2013, title = {European project 'Metrology for radioactive waste management'}, journal = {NENE2013}, year = {2013}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {902.1 to 902.8}, keywords = {Free release measurement, activity measurement, gamma-ray spectrometry, low-background shield, reference materials, Monte Carlo simulations.}, web_url = {http://www.nss.si/nene2013/Contents.htm\#3912}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Bled}, event_name = {NENE 2013}, event_date = {9 to12 September 2013}, ISBN = {978-961-6207-36-2}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kovar, Petr and Suran, Jiri and Solc, Jaroslav and Arnold, Dirk} } @Article { PulliKI2013, title = {A method for optimizing the cosine response of solar UV diffusers}, journal = {Journal of Geophysical Research: Atmospheres}, year = {2013}, volume = {118}, number = {14}, number2 = {ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation}, keywords = {Solar UV, cosine response, diffusers, Monte Carlo}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {2169-8996}, DOI = {10.1002/jgrd.50642}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pulli, Tomi and K{\"a}rh{\"a}, Petri and Ikonen, Erkki} } @Article { RichterSSK2013, title = {Known purity - the fundament of element determination by atomic spectrometry}, journal = {JAAS}, year = {2013}, volume = {28}, number = {10}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {1540-1543}, keywords = {EMRP, Primary standards, traceability, challenging elements}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1039/c3ja90045b}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Richter, S. and Sargent, M. and Schiel, D. and Kipphardt, H.} } @Article { ZhouRMK2013, title = {Determination of the total purity of a high-purity silver material to be used as a primary standard for element determination}, journal = {Accred Qual Assur}, year = {2013}, volume = {18}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {341-349}, keywords = {Silver, purity, total purity, primary standard, element determination.}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1007/s00769-013-0988-5}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zhou, T. and Richter, S. and Matschat, R. and Kipphardt, H.} } @Proceedings { KungNMT2013, title = {Calibration and uncertainty evaluation of aspherical lens parameters using a virtual CMM}, year = {2013}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {Micro coordinate metrology, asphere, measurement uncertainty, Monte Carlo simulation, virtual CMM}, web_url = {http://www.aspen-soc.org/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Taipei, Taiwan}, event_name = {5th Internat. Conf. of the Asian Society for Precision Engineering and Nanotechnology ASPEN}, event_date = {12-15 November 2013}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ng, A and Nicolet, A and Meli, F and Thalmann, R.} } @Proceedings { KuehneWHPSSI, title = {Parallel transmission experiments using an extensible RF pulse generator}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2013}, volume = {21}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/13/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Salt Lake City, USA}, event_name = {ISMRM 21st Annual Meeting \& Exhibition 2013}, event_date = {20-26 April 2013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kuehne, Andre and Waxmann, Patrick and Hoffmann, Werner and Pfeiffer, Harald and Seemann, Reiner and Seifert, Frank and Ittermann, Bernd} } @Proceedings { , title = {PTB’s enhanced stitching approach for high-accuracy interferometric characterisations of absolute topographies of spheres}, journal = {ISMTII Proceedings}, year = {2013}, volume = {-}, number = {-}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {4 pp}, keywords = {stitching, interferometry, spherical surface, absolute topography, roundness}, web_url = {-}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {-}, address = {-}, event_place = {Aachen}, event_name = {ISMTII 2013}, event_date = {July 2013}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bartl, Guido and Krystek, Michael and Nicolaus, Arnold} } @Article { , title = {Understanding the relationship between molecular order and charge transport properties in conjugated polymer based organic blend photovoltaic devices}, journal = {The Journal of Chemical Physics}, year = {2013}, volume = {139}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1-10}, web_url = {http://scitation.aip.org/content/aip/journal/jcp/139/6/10.1063/1.4816706}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {American Institute of Physics (AIP)}, address = {New York}, language = {30}, ISSN = {0021-9606}, DOI = {10.1063/1.4816706}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wood, SW and Kim, JSK and James, DTJ and Tsoi, WCT and Murphy, GEM and Kim, JSK} } @Article { , title = {Investigation of Material Effects With Micro-Sized SQUID Sensors}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2012}, month = {12}, day = {20}, volume = {23}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1602004}, keywords = {SQUID sensors, gradiometer, microSQUIDs, susceptometers}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6389719\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fiel5\%2F77\%2F6366258\%2F06389719.pdf\%3Farnumber\%3D6389719}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2012.2235505}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bechstein, S and Kirste, A and Drung, D and Regin, M and Kazakova, O and Gallop, J and Hao, L and Cox, D and Schurig, T} } @Article { , title = {Direct structural characterisation of line gratings with grazing incidence small-angle x-ray scattering}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2012}, month = {10}, day = {17}, volume = {83}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/83/10?ver=pdfcov}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1063/1.4758283}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Wernecke, Jan and Scholze, Frank and Krumrey, Michael} } @Article { , title = {Simultaneous remote transfer of accurate timing and optical frequency over a public fiber network}, journal = {Applied Physics B}, year = {2012}, month = {10}, day = {4}, volume = {Lasers and Optics 110}, number = {1 (2013) 3-6}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, web_url = {http://arxiv.org/abs/1209.4715}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1007/s00340-012-5241-0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopez, O. and Kanj, A. and Pottie, P.-E. and Rovera, D. and Achkar, J. and Chardonnet, C. and Amy-Klein, A. and Santarelli, G.} } @Proceedings { ErmelMKK2012_2, title = {Discriminative Acquisition of Power IGBT Low Rate Transients}, journal = {2012 IEEE International Workshop on Applied Measurements for Power Systems (AMPS 2012)}, year = {2012}, month = {9}, day = {28}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {Measurement; IGBT; converters; voltage transients; discriminator}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Aachen, Germany}, event_name = {2012 IEEE International Workshop on Applied Measurements for Power Systems (AMPS 2012)}, event_date = {Sep. 26-28, 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ermel, V. and Meisner, J. and Kurrat, M. and Kahmann, M.} } @Article { , title = {Analytical modeling and three-dimensional finite element simulation of line edge roughness in scatterometry}, journal = {APPLIED OPTICS}, year = {2012}, month = {9}, day = {11}, volume = {51}, number = {27}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {6457 - 6464}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1364/AO.51.006457}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kato, A. and Burger, S. and Scholze, F.} } @Article { , title = {Profile estimation for Pt submicron wire on rough Si substrate from experimental data}, journal = {OPTICS EXPRESS}, year = {2012}, month = {9}, day = {6}, volume = {20}, number = {19}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {21678 - 21686}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1364/OE.20.021678}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Karamehmedović, M. and Hansen, P.-E. and Dirscherl, K. and Karamehmedović, E. and Wriedt, T.} } @Proceedings { WankeKN2012, title = {Investigations on TDCR measurements with the HIDEX 300 SL using a free parameter model}, journal = {Applied Radiation and Isotopes}, year = {2012}, month = {9}, volume = {70}, number = {9}, number2 = {ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804312001455}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Tsukuba, Japan}, event_name = {18th International Conference on Radionuclide Metrology and its Applications (ICRM)}, event_date = {19 - 23 September 2011}, language = {English}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2012.02.097}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Wanke, C. and Kossert, K. and N{\"a}hle, O.} } @Article { BrewerGKM2012, title = {Accurate measurements of water vapor transmission through high-performance barrier layers}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2012}, month = {7}, day = {31}, volume = {83}, number = {7}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {075118-1 to 075118-6}, keywords = {water vapor transmission rate, barrier layers, organic electronics, traceability}, web_url2 = {http://scitation.aip.org/content/aip/journal/rsi/83/7/10.1063/1.4738775}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1063/1.4738775}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Brewer, P. and Goody, B. and Kumar, Y. and Milton, M.} } @Article { , title = {The Planck constant, watt and vacuum balances, and an evolving Mise en pratique for the kilogram in North America}, journal = {Precision Electromagnetic Measurements (CPEM), 2012 Conference on 1-6 July 2012}, year = {2012}, month = {7}, day = {1}, volume = {6250983}, number = {6250983}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {422 - 423}, keywords = {Planck constant, watt, vacuum balances, evolving Mise en pratique, kilogram}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6250983}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {CPEM}, address = {Ottawa}, language = {30}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2012.6250983}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pratt, J R and Schlamminger, S and Newell, D B and Haddad, D and Liu, R and Williams, W and Kubarych, Z and Inglis, D and Wood, B and Sanchez, C and Green, R} } @Article { BurnettYK2012, title = {Identification of epitaxial graphene domains and adsorbed species in ambient conditions using quantified topography measurements}, journal = {Journal of Applied Physics}, year = {2012}, month = {7}, volume = {112}, number = {5}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {epitaxial graphene}, web_url = {http://jap.aip.org/resource/1/japiau/v112/i5/p054308_s1}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, ISSN = {0021-8979}, DOI = {10.1063/1.4748957}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Burnett, Tim L and Yakimova, Rositza and Kazakova, Olga} } @Proceedings { , title = {Dynamic calibration of bridge amplifiers used for periodical force measurement}, year = {2012}, month = {7}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {2 Seiten}, keywords = {Force, dynamics, calibration, transducers, bridge circuits, frequency response, force measurement}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, address = {Piscataway}, event_place = {Washington, DC}, event_name = {Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {01-07-2012 to 06-07-2012}, language = {30}, ISBN = {ISBN: 978-1-4673-0441-2, ISBN: 978-1-4673-0442-9, ISBN: 978-1-4673-0439-9}, ISSN = {ISSN: 2160-0171, ISSN: 0589-1485, ISSN: 0589-1485}, DOI = {10.1109/CPEM.2012.6251057}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Schlegel, C. and Kiekenap, G. and Kumme, R.} } @Article { ManzinNK2012, title = {Modelling and optimization of submicron Hall sensors for the detection of superparamagnetic beads}, journal = {Journal of Applied Physics}, year = {2012}, month = {3}, volume = {111}, number = {7}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, web_url = {http://jap.aip.org/resource/1/japiau/v111/i7/p07E513_s1}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0021-8979}, DOI = {10.1063/1.3678322}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Manzin, A and Nabaei, V and Kazakova, O} } @Article { PanchalCYTK2012, title = {Small epitaxial graphene devices for magnetosensing applications}, journal = {Journal of Applied Physics}, year = {2012}, month = {3}, volume = {111}, number = {7}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, web_url = {http://jap.aip.org/resource/1/japiau/v111/i7/p07E509_s1}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0021-8979}, DOI = {10.1063/1.3677769}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, V and Cedergren, K and Yakimova, R and Tzalenchuk, A and Kubatkin, S} } @Article { BallingMKD2012, title = {Length and refractive index measurement by Fourier transform interferometry and frequency comb spectroscopy}, journal = {Measurement Science and Technology}, year = {2012}, volume = {22}, number = {094001}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {13pp}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, DOI = {10.1088/0957-0233/23/9/094001}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Balling, P. and Mašika, P. and Kren, P. and Doležal, M.} } @Article { GorenADKMY2012, title = {Fatty acid composition and chemotaxonomic evaluation of species of Stachys}, journal = {Natural Product Research}, year = {2012}, volume = {26}, number2 = {ENG09: Biofuels: Metrology for Biofuels}, pages = {84-90}, tags = {EnG}, misc2 = {EMRP A169: Call 2009 Energy}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}ren, A. C. and Ak\c{c}icek, E. and Dirmenci, T. and Kilic, T. and Mozioglu, E. and Yilmaz, H.} } @Proceedings { ElgKBH2012, title = {Characterization of dielectric properties of insulating materials for use in an HVDC reference divider}, journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2012}, year = {2012}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {HVDC, dielectric, metrology, current measurement, high-voltage techniques}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {IEEE}, event_place = {Washington DC, USA}, event_name = {CPEM 2012}, event_date = {01 - 06 July 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Elg, A. and Kharezy, M. and Bergman, A. and H{\"a}llstr{\"o}m, J.} } @Proceedings { KlepschLHBIS2012, title = {Calibration of fibre-optic RF E/H-field probes using a magnetic resonance (MR) compatible TEM cell and dedicated MR measurement techniques}, journal = {Biomedizinische Technik : Proceedings BMT 2012}, year = {2012}, volume = {57 (Suppl. 1)}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {119-122}, web_url = {http://www.degruyter.com/view/j/bmte.2012.57.issue-s1-B/bmt-2012-4428/bmt-2012-4428.xml}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Jena, Germany}, event_name = {46th DGBMT Annual Conference}, event_date = {16 - 19 September, 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Klepsch, T. and Lindel, T. and Hoffmann, W. and Botterweck, H. and Ittermann, B. and Seifert, F.} } @Article { HallerJSKMSDGG2012, title = {A compar