% % This file was created by the TYPO3 extension % bib % --- Timezone: CEST % Creation date: 2022-06-25 % Creation time: 03-51-48 % --- Number of references % 1558 % @Article { IrwinHSBSBSV2022, subid = {2623}, title = {Characterising the silver particle generator; a pathway towards standardising silver aerosol generation}, journal = {Journal of Aerosol Science}, year = {2022}, month = {6}, volume = {163}, number2 = {19ENV09: MetroPEMS: Improved vehicle exhaust quantification by portable emission measurement systems metrology}, pages = {105978}, keywords = {silver particle generator, calibration, reference aerosol, CPC calibration, DMA calibration}, web_url = {https://www.sciencedirect.com/science/article/pii/S002185022200026X?via\%3Dihub}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2022.105978}, stag_bib_extends_levelofaccess = {NA}, author = {Irwin, M. and Hammer, T. and Swanson, J. and Berger, V. and Sonkamble, U. and Boies, A. and Schulz, H. and Vasilatou, K.} } @Article { WitkowskiBBKSTZ2022, subid = {2771}, journal = {Optics Express}, year = {2022}, month = {5}, day = {31}, volume = {30}, number = {12}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {21423}, keywords = {blue magic wavelength, photoionization, Sr clock}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Optica Publishing Group}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.460554}, stag_bib_extends_levelofaccess = {NA}, author = {Witkowski, M. and Bilicki, S. and Bober, M. and Kovacic, D. and Singh, V. and Tonoyan, A. and Zawada, M.} } @Article { WitkowskiBBKSTZ2022_2, subid = {2771}, title = {Photoionization cross sections of ultracold ⁸⁸Sr in ¹P₁ and ³S₁ states at 390 nm and the resulting blue-detuned magic wavelength optical lattice clock constraints}, journal = {Optics Express}, year = {2022}, month = {5}, day = {31}, volume = {30}, number = {12}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {21423}, keywords = {blue magic wavelength, photoionization, Sr clock}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Optica Publishing Group}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.460554}, stag_bib_extends_levelofaccess = {NA}, author = {Witkowski, M. and Bilicki, S. and Bober, M. and Kovacic, D. and Singh, V. and Tonoyan, A. and Zawada, M.} } @Proceedings { BossePBOFEP2022, subid = {2781}, title = {Progress of the European Metrology Network for Advanced Manufacturing}, journal = {Proceedings 22nd euspen International Conference and Exhibition}, year = {2022}, month = {5}, day = {30}, number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing}, pages = {299}, keywords = {advanced manufacturing, metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0}, misc2 = {EMPIR 2019: Support for Networks}, event_place = {Geneva, Switzerland}, event_name = {22nd euspen International Conference and Exhibition}, event_date = {30-05-2022 to 03-06-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE22299.pdf}, author = {Bosse, H. and Przyklenk, A. and Balsamo, A. and O'Connor, D. and Favre, G. and Evans, A. and Phillips, D.} } @Article { BaselgaGGL2022, subid = {2766}, title = {GBDM+: an improved methodology for a GNSS-based distance meter}, journal = {Measurement Science and Technology}, year = {2022}, month = {5}, day = {25}, volume = {33}, number = {8}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {085020}, keywords = {GNSS, Si, index of refraction, EDM, GeoMetre}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/ac6f45}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac6f45}, stag_bib_extends_levelofaccess = {NA}, author = {Baselga, S. and Garc{\'i}a-Asenjo, L. and Garrigues, P. and Luj{\'a}n, R.} } @Article { RubenVogtRGDKMKKSBBMPFCRVSH2022, subid = {2751}, title = {PV Module Energy Rating Standard IEC 61853-3 Intercomparison and Best Practice Guidelines for Implementation and Validation}, journal = {IEEE Journal of Photovoltaics}, year = {2022}, month = {5}, volume = {12}, number = {3}, number2 = {19ENG01: Metro-PV: Metrology for emerging PV applications}, pages = {844-852}, keywords = {Standards, Meteorology, IEC Standards, Temperature measurement, Power measurement, Photovoltaic systems, Mathematical models}, web_url = {https://www.techrxiv.org/articles/preprint/PV_module_energy_rating_standard_IEC_61853-3_intercomparison_and_best_practice_guidelines_for_implementation_and_validation/19635333/1}, misc2 = {EMPIR 2019: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2021.3135258}, stag_bib_extends_levelofaccess = {NA}, author = {Ruben Vogt, M. and Riechelmann, S. and Gracia-Amillo, A.M. and Driesse, A. and Kokka, A. and Maham, K. and K{\"a}rh{\"a}, P. and Kenny, R. and Schinke, C. and Bothe, K. and Blakesley, J. and Music, E. and Plag, F. and Friesen, G. and Corbellini, G. and Riedel-Lyngskar, N. and Valckenborg, R. and Schweiger, M. and Herrmann, W.} } @Article { BriantKCLBWRMPCESTHPKKDZWMSNB2022, subid = {2714}, title = {Photonic and Optomechanical Thermometry}, journal = {Optics}, year = {2022}, month = {4}, day = {29}, volume = {3}, number = {2}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {159-176}, keywords = {thermometry; photonic; optomechanic; temperature sensors; photonic integrated circuit}, web_url = {https://doi.org/10.3390/opt3020017}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2673-3269}, DOI = {10.3390/opt3020017}, stag_bib_extends_levelofaccess = {NA}, author = {Briant, T. and Krenek, S. and Cupertino, A. and Loubar, F. and Braive, R. and Weituschat, L. and Ramos, D. and Martin, M.J. and Postigo, P.A. and Casas, A. and Eisermann, R. and Schmid, D. and Tabandeh, S. and Hahtela, O. and Pourjamal, S. and Kozlova, O. and Kroker, S. and Dickmann, W. and Zimmermann, L. and Winzer, G. and Martel, T. and Steeneken, P.G. and Norte, R.A. and Briaudeau, S.} } @Article { VolkovaHTBCMARERBPN2022, subid = {2712}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {color centers, optical quantum technology}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { VolkovaHTBCMARERBPN2022_2, subid = {2721}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { HoflingBHRHWTJBGR2022, subid = {2713}, title = {Numerical optimization of single-mode fiber-coupled single-photon sources based on semiconductor quantum dots}, journal = {Optics Express}, year = {2022}, month = {4}, day = {25}, volume = {30}, number = {10}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {15913}, keywords = {single photon source; optical quantum technology}, web_url = {https://arxiv.org/abs/2202.09562}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Optica Publishing Group}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.456777}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}fling, S. and Burger, S. and Herkommer, Al. and Rodt, S. and Huber, T. and Weber, K. and Thiele, S. and Jimenez, C. and Bremer, L. and Giessen, H. and Reitzenstein, S.} } @Article { RubinSZHFABKLZA2022, subid = {2709}, title = {Thermodynamic effects in a gas modulated Invar-based dual Fabry–P{\'e}rot cavity refractometer}, journal = {Metrologia}, year = {2022}, month = {4}, day = {14}, volume = {59}, number = {3}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {035003}, keywords = {quantumpascal, GAMOR, optical pressure standard, gas refractometry, pV-work, Invar-based}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac5ef9}, stag_bib_extends_levelofaccess = {NA}, author = {Rubin, T. and Silander, I. and Zakrisson, J. and Hao, M. and Forss{\'e}n, C. and Asbahr, P. and Bernien, M. and Kussicke, A. and Liu, K. and Zelan, M. and Axner, O.} } @Article { vanHeerenSPB2022, subid = {2698}, title = {Metrology challenges for microfluidics}, journal = {CMM Magazine}, year = {2022}, month = {4}, day = {13}, volume = {15}, number = {2}, number2 = {20NRM02: MFMET: Establishing metrology standards in microfluidic devices}, pages = {20-25}, keywords = {Microfluidics, metrology, fabrication, testing}, web_url = {http://www.cmmmagazine.com/cmm-articles/metrology-challenges-for-microfluidics/}, misc2 = {EMPIR 2020: Pre-Co-Normative}, publisher = {MST Global Ltd}, language = {30}, ISSN = {2634-9167}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISSN 2634-9167}, author = {van Heeren, H. and Silverio, V. and Pecnik, C. and Batista, E.} } @Article { ZanovelloSBWZI2022, subid = {2551}, title = {CoSimPy: An open-source python library for MRI radiofrequency Coil EM/Circuit Cosimulation}, journal = {Computer Methods and Programs in Biomedicine}, year = {2022}, month = {4}, volume = {216}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {106684}, keywords = {Electromagnetic (EM) simulations, EM/Circuit cosimulation, Magnetic Resonance Imaging (MRI), Radio-frequency (RF) coils, Open source Python library}, web_url = {https://www.sciencedirect.com/science/article/pii/S0169260722000694?via\%3Dihub}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0169-2607}, DOI = {10.1016/j.cmpb.2022.106684}, stag_bib_extends_levelofaccess = {NA}, author = {Zanovello, U. and Seifert, F. and Bottauscio, O. and Winter, L. and Zilberti, L. and Ittermann, B.} } @Article { KranzerSBHPLLP2022, subid = {2662}, title = {Response of diamond detectors in ultra-high dose-per-pulse electron beams for dosimetry at FLASH radiotherapy}, journal = {Physics in Medicine \& Biology}, year = {2022}, month = {3}, day = {21}, volume = {67}, number = {7}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {075002}, keywords = {dosimetry, FLASH radiotherapy, ultra-high dose-per-pulse, microDiamond}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac594e}, stag_bib_extends_levelofaccess = {NA}, author = {Kranzer, R. and Sch{\"u}ller, A. and Bourgouin, A. and Hackel, T. and Poppinga, D. and Lapp, M. and Looe, H.K. and Poppe, B.} } @Article { McManusRRBSPS2022, subid = {2661}, title = {Determination of beam quality correction factors for the Roos plane-parallel ionisation chamber exposed to very high energy electron (VHEE) beams using Geant4}, journal = {Physics in Medicine \& Biology}, year = {2022}, month = {3}, day = {17}, volume = {67}, number = {6}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {065011}, keywords = {geant4, Monte Carlo, perturbation factors, beam quality correction, VHEE}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac5a94}, stag_bib_extends_levelofaccess = {NA}, author = {McManus, M. and Romano, F. and Royle, G. and Botnariuc, D. and Shipley, D. and Palmans, H. and Subiel, A.} } @Article { BourgouinKMKSK2022, subid = {2663}, title = {Characterization of the PTB ultra-high pulse dose rate reference electron beam}, journal = {Physics in Medicine \& Biology}, year = {2022}, month = {3}, day = {15}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {Ultra-High Dose Rate, Dosimetry for FLASH, Monte Carlo, Diamond detector,electron beams}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac5de8}, stag_bib_extends_levelofaccess = {NA}, author = {Bourgouin, A. and Knyziak, A. and Marinelli, M. and Kranzer, R. and Sch{\"u}ller, A. and Kapsch, R-P.} } @Article { KronerABBBCPSSUW2022, subid = {2643}, title = {Evaluation of the measurement performance of water meters depending on water quality}, journal = {Water Supply}, year = {2022}, month = {3}, day = {14}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {cold water meters, test regime, water quality, water meter accuracy}, misc2 = {EMPIR 2017: Industry}, publisher = {IWA Publishing}, language = {30}, ISSN = {1606-9749, 1607-0798}, DOI = {10.2166/ws.2022.133}, stag_bib_extends_levelofaccess = {NA}, author = {Kroner, C. and Akselli, B. and Benkova, M. and Borchling, A. and B{\"u}ker, O. and Christoffersen, N. and Pavlas, J. and Schumann, D. and Seypka, V. and Unsal, B. and Warnecke, H.} } @Article { GarciaYipSRBBG2022, subid = {2620}, title = {Characterization of small active detectors for electronic brachytherapy dosimetry}, journal = {Journal of Instrumentation}, year = {2022}, month = {3}, volume = {17}, number = {03}, number2 = {18NRM02: PRISM-eBT: Primary standards and traceable measurement methods for X-ray emitting electronic brachytherapy devices}, pages = {P03001}, keywords = {Detector alignment and calibration methods (lasers, sources, particle-beams), X-ray detectors, Diamond Detectors}, web_url = {https://doi.org/10.1088/1748-0221/17/03/P03001}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/17/03/P03001}, stag_bib_extends_levelofaccess = {NA}, author = {Garcia Yip, F. and Schneider, T. and Reginatto, M. and Behrens, R. and B{\"u}ermann, L. and Grote, F.} } @Article { HuynhDDLBW2022, subid = {2681}, title = {Candidate High-Resolution Mass Spectrometry-Based Reference Method for the Quantification of Procalcitonin in Human Serum Using a Characterized Recombinant Protein as a Primary Calibrator}, journal = {Analytical Chemistry}, year = {2022}, month = {3}, volume = {94}, number = {10}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {4146-4154}, keywords = {High-Resolution Mass Spectrometry, Procalcitonin, Primary Calibrator}, web_url = {https://doi.org/10.1021/acs.analchem.1c03061}, misc2 = {EMPIR 2018: Health}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0003-2700, 1520-6882}, DOI = {10.1021/acs.analchem.1c03061}, stag_bib_extends_levelofaccess = {NA}, author = {Huynh, H-H. and Delatour, V. and Derbez-Morin, M. and Liu, Q. and Boeuf, A. and Webster, W.} } @Article { MuruganORWB2022, subid = {2722}, title = {Vision for a European metrology network for energy gases}, journal = {Environmental Research: Infrastructure and Sustainability}, year = {2022}, month = {3}, volume = {2}, number = {1}, number2 = {18NET01: Energy Gases: Support for a European Metrology Network for energy gases}, pages = {012003}, keywords = {metrology, energy gases, hydrogen, biomethane, natural gas, CCS}, tags = {ENG}, misc2 = {EMPIR 2018: Support for Networks}, publisher = {IOP Publishing}, language = {30}, ISSN = {2634-4505}, DOI = {10.1088/2634-4505/ac57f6}, stag_bib_extends_levelofaccess = {NA}, author = {Murugan, A. and Omoniyi, O. and Richardson, E. and Workamp, M. and Baldan, A.} } @Article { MarlettoVKPBRAGDG2022, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2020: Industry}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { MarlettoVKPBRAGDG20220, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { MarlettoVKPBRAGDG20221, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2020: Fundamental}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { WarneckeKOKCBBHHU2022, subid = {2574}, title = {New metrological capabilities for measurements of dynamic liquid flows}, journal = {Metrologia}, year = {2022}, month = {2}, day = {17}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {dynamic liquid flow rates, test rigs with dynamic measurement capabilities, validation through inter-facility intercomparison}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac566e}, stag_bib_extends_levelofaccess = {NA}, author = {Warnecke, H. and Kroner, C. and Ogheard, F. and Kondrup, J.B. and Christoffersen, N. and Benkova, M. and B{\"u}ker, O. and Haack, S. and Huovinen, M. and Unsal, B.} } @Article { BergCG2022, subid = {2664}, title = {Silicone tube humidity generator}, journal = {Atmospheric Measurement Techniques}, year = {2022}, month = {2}, day = {16}, volume = {15}, number = {3}, number2 = {20IND06: PROMETH2O: Metrology for trace water in ultra-pure process gases}, pages = {819-832}, keywords = {Humidity, trace moisture, permeation tube, metrology}, web_url = {https://amt.copernicus.org/articles/15/819/2022/}, misc2 = {EMPIR 2020: Industry}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-15-819-2022}, stag_bib_extends_levelofaccess = {NA}, author = {Berg, R.F. and Chiodo, N. and Georgin, E.} } @Proceedings { SunCGLJBB2022, subid = {2584}, title = {Evaluation of X-ray computed tomography for surface texture measurements using a prototype additively manufactured reference standard}, journal = {Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022,}, year = {2022}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {calibration, X-ray computed tomography, additive manufacturing, Reference standard, surface texture, areal}, web_url = {https://www.ndt.net/search/docs.php3?id=26568}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {11th Conference on Industrial Computed Tomography (iCT) 2022}, event_date = {08-02-2022 to 11-02-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id260.pdf}, author = {Sun, W. and Chen, X. and Giusca, C. and Lou, S. and Jones, C. and Boulter, H. and Brown, S.} } @Proceedings { BircherMKBEKHHL2022, subid = {2585}, title = {Traceable determination of non-static XCT machine geometry: New developments and case studies}, journal = {Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022,}, year = {2022}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {traceability, Dimensional metrology, XCT machine geometry, calibrated reference standards, radiographic XCT geometry determination, stage error motion, CFD/FE simulations, image quality metric based methods}, web_url = {https://www.ndt.net/search/docs.php3?id=26614}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {11th Conference on Industrial Computed Tomography (iCT) 2022}, event_date = {08-02-2022 to 11-02-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id209.pdf}, author = {Bircher, B. and Meli, F. and K{\"u}ng, A. and Bellon, C. and Evsevleev, S. and Katić, M. and Heikkinen, V. and Hemming, B. and Lassila, A.} } @Article { XuZAPB2022, subid = {2576}, title = {Using a Tip Characterizer to Investigate Microprobe Silicon Tip Geometry Variation in Roughness Measurements}, journal = {Sensors}, year = {2022}, month = {2}, volume = {22}, number = {3}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {1298}, keywords = {roughness measurement, piezoresistive microprobe, silicon fracture, tip characterization}, web_url = {https://www.mdpi.com/1424-8220/22/3/1298}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s22031298}, stag_bib_extends_levelofaccess = {NA}, author = {XU, M. and Zhou, Z. and Ahbe, T. and Peiner, E. and Brand, U.} } @Article { SunGLYCFJWBB2022, subid = {2588}, title = {Establishment of X-ray computed tomography traceability for additively manufactured surface texture evaluation}, journal = {Additive Manufacturing}, year = {2022}, month = {2}, volume = {50}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {102558}, keywords = {Additive manufacturing, Surface texture, Reference standard, X-ray computed tomography}, web_url = {https://www.sciencedirect.com/science/article/pii/S2214860421007053?via\%3Dihub}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {2214-8604}, DOI = {10.1016/j.addma.2021.102558}, stag_bib_extends_levelofaccess = {NA}, author = {Sun, W. and Giusca, C. and Lou, S. and Yang, X. and Chen, X. and Fry, T. and Jiang, X. and Wilson, A. and Brown, S. and Boulter, H.} } @Proceedings { SinghRathoreLBSV2022, subid = {2587}, title = {Benchmarking of different reconstruction algorithms for industrial cone-beam CT}, journal = {Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022,}, year = {2022}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {reconstruction, tomography, iterative, Analytical}, web_url = {https://www.ndt.net/search/docs.php3?id=26640}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {11th Conference on Industrial Computed Tomography (iCT) 2022}, event_date = {08-02-2022 to 11-02-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id244.pdf}, author = {Singh Rathore, J. and Laquai, R. and Biguri, A. and Soleimani, M. and Vienne, C. } } @Article { ZutzBKHR2022, subid = {2630}, title = {DEVELOPMENT OF A EUROPEAN METROLOGY NETWORK FOR RELIABLE RADIATION PROTECTION: PULSED HIGH ENERGY PHOTON REFERENCE FIELD AS A METROLOGICAL GAP IN RADIATION PROTECTION}, journal = {Physica Medica}, year = {2022}, month = {2}, volume = {94}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, pages = {S113}, keywords = {high energy pulsed fields, European Metrology Network for Radiation Protection, photon reference field, metrological gaps, supportBSS}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/S1120-1797(22)01699-4}, stag_bib_extends_levelofaccess = {NA}, author = {Zutz, H. and Busse, J. and Khanbabaee, B. and Hupe, O. and R{\"o}ttger, A.} } @Article { ArrheniusFB2022, subid = {2685}, title = {Sampling methods for renewable gases and related gases: challenges and current limitations}, journal = {Analytical and bioanalytical chemistry}, year = {2022}, month = {2}, number2 = {20IND10: Decarb: Metrology for decarbonising the gas grid}, keywords = {Material compatibility, Renewable gases, Sampling}, misc2 = {EMPIR 2020: Industry}, publisher = {Springer}, language = {30}, DOI = {10.1007/s00216-022-03949-0}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Francini, L. and B{\"u}ker, O.} } @Article { MilanoBVR2022, subid = {2556}, title = {Memristive devices based on single ZnO nanowires—from material synthesis to neuromorphic functionalities}, journal = {Semiconductor Science and Technology}, year = {2022}, month = {1}, day = {28}, volume = {37}, number = {3}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {034002}, keywords = {nanowires, ZnO, chemical vapor deposition (CVD), resistive switching,memristive devices, neuromorphic devices}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6641/ac4b8a}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0268-1242, 1361-6641}, DOI = {10.1088/1361-6641/ac4b8a}, stag_bib_extends_levelofaccess = {NA}, author = {Milano, G. and Boarino, L. and Valov, I. and Ricciardi, C.} } @Article { KuckLHGCRPSGBFLTTCMDTRR2022, subid = {2486}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Single photon sources, quantum radiometry, quantum metrology}, web_url = {https://doi.org/10.1007/s00340-021-07734-2}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { KuckLHGCRPSGBFLTTCMDTRR2022_2, subid = {2752}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, keywords = {Single-photon sources, quantum radiometry, calibration, single photon detectors. defect centres, (nano-)diamonds, molecule semiconductor quantum dots, photon flux, single-photon purity, spectral power distribution}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { TongBKRGGGCHC2022, subid = {2570}, title = {Cathodoluminescence mapping of electron concentration in MBE-grown GaAs:Te nanowires}, journal = {Nanotechnology}, year = {2022}, month = {1}, day = {22}, volume = {33}, number = {18}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {185704}, keywords = {nanowires, GaAs, doping, cathodoluminescence}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/ac4d58}, misc2 = {EMPIR 2019: Energy}, publisher = {IOP}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://hal.archives-ouvertes.fr/hal-03539939}, author = {Tong, C. and Bidaud, T. and Koivusalo, E. and Rizzo Piton, M. and Guina, M. and Galeti, H. and Galvao Gobato, Y. and Cattoni, A. and Hakkarainen, T. and Collin, S.} } @Article { DeVisMHMSB2022, subid = {2536}, title = {Ancillary Data Uncertainties within the SeaDAS Uncertainty Budget for Ocean Colour Retrievals}, journal = {Remote Sensing}, year = {2022}, month = {1}, day = {21}, volume = {14}, number = {3}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {497}, keywords = {Ocean Colour, Atmospheric correction, uncertainty, ancillary parameters}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs14030497}, stag_bib_extends_levelofaccess = {NA}, author = {De Vis, P. and M{\'e}lin, F. and Hunt, S.E. and Morrone, R. and Sinclair, M. and Bell, B.} } @Article { DeVisMHMSB2022_2, subid = {2590}, title = {Ancillary Data Uncertainties within the SeaDAS Uncertainty Budget for Ocean Colour Retrievals}, journal = {Remote Sensing}, year = {2022}, month = {1}, day = {21}, volume = {14}, number = {3}, number2 = {19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system}, pages = {497}, keywords = {ocean colour, atmospheric correction, uncertainty, ancillary parameters}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs14030497}, stag_bib_extends_levelofaccess = {NA}, author = {De Vis, P. and M{\'e}lin, F. and Hunt, S.E. and Morrone, R. and Sinclair, M. and Bell, B.} } @Article { KellerSKFCVCOBHMMNORBCNCDDGLVWZK2022, subid = {2778}, title = {RNA reference materials with defined viral RNA loads of SARS-CoV-2—A useful tool towards a better PCR assay harmonization}, journal = {PLOS ONE}, year = {2022}, month = {1}, day = {20}, volume = {17}, number = {1}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {e0262656}, keywords = {SARS-CoV-2, RNA, PCR}, misc2 = {EMPIR 2018: Health}, publisher = {Public Library of Science (PLoS)}, language = {30}, ISSN = {1932-6203}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6637818}, author = {Keller, T. and Schellenberg, I. and Kummrow, A. and Falak, S. and Cleveland, M.H. and Vallone, P.M. and Cowen, S. and O’Sullivan, D. and Busby, E. and Huggett, J. and Mielke, M. and Michel, J. and Nitsche, A. and Obermeier, M. and Rabenau, H.F. and Berger, A. and Ciesek, S. and Niemeyer, D. and Corman, V. and Duehring, U. and Drosten, C. and Grunert, H-P. and Lindig, V. and Vierbaum, L. and Wojtalewicz, N. and Zeichhardt, H. and Kammel, M.} } @Article { BeckhoffURHTHE2022, subid = {2463}, title = {Investigating Membrane‐Mediated Antimicrobial Peptide Interactions with Synchrotron Radiation Far‐Infrared Spectroscopy}, journal = {ChemPhysChem}, year = {2022}, month = {1}, day = {14}, number2 = {HLT10: BiOrigin: Metrology for biomolecular origin of disease}, pages = {1-11}, keywords = {antimicrobialpeptides, electrostatic interactions, IR spectroscopy, phospholipid membranes, protein folding}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley}, language = {30}, ISSN = {1439-4235, 1439-7641}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1002/cphc.202100815}, author = {Beckhoff, B. and Ulm, G. and Ryadnov, M.G. and Hoehl, A. and Tiersch, B. and Hornemann, A. and Eichert, D.M.} } @Article { ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022, subid = {2567}, title = {2022 roadmap on neuromorphic computing and engineering}, journal = {Neuromorphic Computing and Engineering}, year = {2022}, month = {1}, day = {12}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, keywords = {neuromorphic computing, neuromorphic engineering}, web_url = {https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2634-4386}, DOI = {10.1088/2634-4386/ac4a83}, stag_bib_extends_levelofaccess = {NA}, author = {Christensen, D.V. and Dittmann, R. and Linares-Barranco, B. and Sebastian, A. and Le Gallo, M. and Redaelli, A. and Slesazeck, S. and Mikolajick, T. and Spiga, S. and Menzel, S. and Valov, I. and Milano, G. and Ricciardi, C. and Liang, S-J. and Miao, F. and Lanza, M. and Quill, T.J. and Keene, S.T. and Salleo, A. and Grollier, J. and Markovic, D. and Mizrahi, A. and Yao, P. and Yang, J.J. and Indiveri, G. and Strachan, J.P. and Datta, S. and Vianello, E. and Valentian, A. and Feldmann, J. and Li, X. and Pernice, W.H.P. and Bhaskaran, H. and Furber, S. and Neftci, E. and Scherr, F. and Maass, W. and Ramaswamy, S. and Tapson, J. and Panda, P. and Kim, Y. and Tanaka, G. and Thorpe, S. and Bartolozzi, C. and Cleland, T.A. and Posch, C. and Liu, S-C. and Panuccio, G. and Mahmud, M. and Mazumder, A.N. and Hosseini, M. and Mohsenin, T. and Donati, E. and Tolu, S. and Galeazzi, R. and Christensen, M.E. and Holm, S. and Ielmini, D. and Pryds, N.} } @Article { CelikovicPVNiCGBQR2022, subid = {2428}, title = {Outdoor Radon as a Tool to Estimate Radon Priority Areas—A Literature Overview}, journal = {International Journal of Environmental Research and Public Health}, year = {2022}, month = {1}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {outdoor radon concentrations; literature overview; radiation risk; indoor radonconcentrations; radon priority areas}, misc2 = {EMPIR 2019: Environment}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.3390/ijerph19020662}, author = {Čeliković, I. and Pantelić, G. and Vukanac, I. and Nikolić, J.K. and Živanović, M. and Cinelli, G. and Gruber, V. and Baumann, S. and Quindos Poncela, L.S. and Rabago, D.} } @Article { OanceaBPGJCOC2022, subid = {2657}, title = {Stray radiation produced in FLASH electron beams characterized by the MiniPIX Timepix3 Flex detector}, journal = {Journal of Instrumentation}, year = {2022}, month = {1}, volume = {17}, number = {01}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {C01003}, keywords = {MiniPIX Timepix3, Particle fluxes, Dose rates, FLASH electron beams, UHDpulse, electronradiotherapy}, web_url = {https://doi.org/10.48550/arXiv.2201.13171}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/17/01/C01003}, stag_bib_extends_levelofaccess = {NA}, author = {Oancea, C. and Bălan, C. and Pivec, J. and Granja, C. and Jakubek, J. and Chvatil, D. and Olsansky, V. and Chiș, V.} } @Article { FasoloBBCCCCCDEFFFFGGGGKLLLMMMMMMMNOPPPRRRSUV2022, subid = {2612}, title = {Bimodal Approach for Noise Figures of Merit Evaluation in Quantum-Limited Josephson Traveling Wave Parametric Amplifiers}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2022}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, keywords = {Physics, Gain, Microwave amplifiers, Noise figure, Superconducting microwave devices, Microwave photonics, Bandwidth}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2022.3148692}, stag_bib_extends_levelofaccess = {NA}, author = {Fasolo, L. and Barone, C. and Borghesi, M. and Carapella, G. and Caricato, A.P. and Carusotto, I. and Chung, W. and Cian, A. and Di Gioacchino, D. and Enrico, E. and Falferi, P. and Faverzani, M. and Ferri, E. and Filatrella, G. and Gatti, C. and Giachero, A. and Giubertoni, D. and Greco, A. and Kutlu, C. and Leo, A. and Ligi, C. and Livreri, P. and Maccarone, G. and Margesin, B. and Maruccio, G. and Matlashov, A. and Mauro, C. and Mezzena, R. and Monteduro, A.G. and Nucciotti, A. and Oberto, L. and Pagano, S. and Pierro, V. and Piersanti, L. and Rajteri, M. and Rettaroli, A. and Rizzato, S. and Semertzidis, Y.K. and Uchaikin, S.V. and Vinante, A.} } @Article { MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022, subid = {2764}, title = {Versailles project on advanced materials and standards (VAMAS) interlaboratory study on measuring the number concentration of colloidal gold nanoparticles}, journal = {Nanoscale}, year = {2022}, volume = {14}, number = {12}, number2 = {18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration}, pages = {4690-4704}, keywords = {nanoparticle, concentration, standardization, VAMAS, interlaboratory}, misc2 = {EMPIR 2018: Support for Impact}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/D1NR07775A}, stag_bib_extends_levelofaccess = {NA}, author = {Minelli, C. and Wywijas, M. and Bartczak, D. and Cuello-Nu{\~n}ez, S. and Infante, H.G. and Deumer, J. and Gollwitzer, C. and Krumrey, M. and Murphy, K.E. and Johnson, M.E. and Montoro Bustos, A.R. and Strenge, I.H. and Faure, B. and H{\o}gh{\o}j, P. and Tong, V. and Burr, L. and Norling, K. and H{\"o}{\"o}k, F. and Roesslein, M. and Kocic, J. and Hendriks, L. and Kestens, V. and Ramaye, Y. and Contreras Lopez, M.C. and Auclair, G. and Mehn, D. and Gilliland, D. and Potthoff, A. and Oelschl{\"a}gel, K. and Tentschert, J. and Jungnickel, H. and Krause, B.C. and Hachenberger, Y.U. and Reichardt, P. and Luch, A. and Whittaker, T.E. and Stevens, M.M. and Gupta, S. and Singh, A. and Lin, F-h. and Liu, Y-H. and Costa, A.L. and Baldisserri, C. and Jawad, R. and Andaloussi, S.E.L. and Holme, M.N. and Lee, T.G. and Kwak, M. and Kim, J. and Ziebel, J. and Guignard, C. and Cambier, S. and Contal, S. and Gutleb, A.C. and “Kuba” Tatarkiewicz, J. and Jankiewicz, B.J. and Bartosewicz, B. and Wu, X. and Fagan, J.A. and Elje, E. and Rund{\'e}n-Pran, E. and Dusinska, M. and Kaur, I.P. and Price, D. and Nesbitt, I. and O\(\prime\) Reilly, S. and Peters, R.J.B. and Bucher, G. and Coleman, D. and Harrison, A.J. and Ghanem, A. and Gering, A. and McCarron, E. and Fitzgerald, N. and Cornelis, G. and Tuoriniemi, J. and Sakai, M. and Tsuchida, H. and Maguire, C. and Prina-Mello, A. and Lawlor, A.J. and Adams, J. and Schultz, C.L. and Constantin, D. and Thanh, N.T.K. and Tung, L.D. and Panariello, L. and Damilos, S. and Gavriilidis, A. and Lynch, I. and Fryer, B. and Carrazco Quevedo, A. and Guggenheim, E. and Briffa, S. and Valsami-Jones, E. and Huang, Y. and Keller, A.A. and Kinnunen, V-T. and Per{\"a}m{\"a}ki, S. and Krpetic, Z. and Greenwood, M. and Shard, A.G.} } @Article { ColomBBKB2022, subid = {2774}, title = {Enhanced Purcell factor for nanoantennas supporting interfering resonances}, journal = {Physical Review Research}, year = {2022}, volume = {4}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {023189}, keywords = {Nanoantennas, nanophotonics, near field optics, nanodisks, optical microcavities, electromagnetic wave theory, finite-element method}, misc2 = {EMPIR 2020: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.4.023189}, stag_bib_extends_levelofaccess = {NA}, author = {Colom, R. and Binkowski, F. and Betz, F. and Kivshar, Y. and Burger, S.} } @Article { LeviCTB2022, subid = {2725}, title = {Optically Loaded Strontium Lattice Clock With a Single Multi-Wavelength Reference Cavity}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2022}, volume = {71}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {1-9}, keywords = {Atomic spectroscopy, laser stabilization, opticalfrequency metrology, optical frequency standard, optical latticeclock, strontium.}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2022.3165292}, stag_bib_extends_levelofaccess = {NA}, author = {Levi, F. and Calonico, D. and Tarallo, M.G. and Barbiero, M.} } @Article { ColomBBKB2022_2, subid = {2774}, title = {Enhanced Purcell factor for nanoantennas supporting interfering resonances}, journal = {Physical Review Research}, year = {2022}, volume = {4}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {023189}, keywords = {Nanoantennas, nanophotonics, near field optics, nanodisks, optical microcavities, electromagnetic wave theory, finite-element method}, misc2 = {EMPIR 2020: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.4.023189}, stag_bib_extends_levelofaccess = {NA}, author = {Colom, R. and Binkowski, F. and Betz, F. and Kivshar, Y. and Burger, S.} } @Article { LeviCTB2022_2, subid = {2725}, title = {Optically Loaded Strontium Lattice Clock With a Single Multi-Wavelength Reference Cavity}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2022}, volume = {71}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {1-9}, keywords = {Atomic spectroscopy, laser stabilization, opticalfrequency metrology, optical frequency standard, optical latticeclock, strontium.}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2022.3165292}, stag_bib_extends_levelofaccess = {NA}, author = {Levi, F. and Calonico, D. and Tarallo, M.G. and Barbiero, M.} } @Article { ArrheniusBSCGBB2021, subid = {2487}, title = {Detection of Contaminants in Hydrogen Fuel for Fuel Cell Electrical Vehicles with Sensors—Available Technology, Testing Protocols and Implementation Challenges}, journal = {Processes}, year = {2021}, month = {12}, day = {24}, volume = {10}, number = {1}, number2 = {19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2}, pages = {20}, keywords = {sensors, hydrogen quality, FCEV, testing protocols}, misc2 = {EMPIR 2019: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-9717}, DOI = {10.3390/pr10010020}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Bacquart, T. and Schr{\"o}ter, K. and Carr{\'e}, M. and Gozlan, B. and Beurey, C. and Blondeel, C.} } @Article { MiloroABBZFR2021, subid = {2444}, title = {A standard test phantom for the performance assessment of magnetic resonance guided high intensity focused ultrasound (MRgHIFU) thermal therapy devices}, journal = {International Journal of Hyperthermia}, year = {2021}, month = {12}, day = {22}, volume = {39}, number = {1}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {57-68}, keywords = {HIFU; thermal ablation; quality control; phantom; thermal dosimetry}, web_url = {https://www.tandfonline.com/doi/full/10.1080/02656736.2021.2017023}, misc2 = {EMPIR 2018: Health}, publisher = {Informa UK Limited}, language = {30}, ISSN = {0265-6736, 1464-5157}, DOI = {10.1080/02656736.2021.2017023}, stag_bib_extends_levelofaccess = {NA}, author = {Miloro, P and Ambrogio, S. and Bosio, F. and Ba{\^e}sso, R.M. and Zeqiri, B. and Fedele, F. and Ramnarine, K.V.} } @Article { WooldridgeAZZCCB2021, subid = {2546}, title = {Gradient coil and radiofrequency induced heating of orthopaedic implants in MRI: influencing factors}, journal = {Physics in Medicine \& Biology}, year = {2021}, month = {12}, day = {21}, volume = {66}, number = {24}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {245024}, keywords = {MRI; finite element modelling; implant heating}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/ac3eab}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac3eab}, stag_bib_extends_levelofaccess = {NA}, author = {Wooldridge, J. and Arduino, A. and Zilberti, L. and Zanovello, U. and Chiampi, M. and Clementi, V. and Bottauscio, O.} } @Article { BassottiSC2021, subid = {2437}, title = {From the spin eigenmodes of isolated Nel skyrmions to the magnonic bands of a skyrmionic crystal: a micromagnetic study as a function of the strength of both the interfacial Dzyaloshinskii-Moriya and the exchange constants}, journal = {IEEE Magnetic Letters}, year = {2021}, month = {12}, day = {16}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {Micromagnetic simulations, skyrmiond, magnetic crystals, DMI}, web_url = {https://arxiv.org/ftp/arxiv/papers/2112/2112.04967.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IEEE}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://ieeexplore.ieee.org/document/9653803}, author = {Bassotti, M. and Silvani, R. and Carlotti, G.} } @Article { KayserOHB2021, subid = {2485}, title = {Reliable compositional analysis of airborne particulate matter beyond the quantification limits of total reflection X-ray fluorescence.}, journal = {Analytica Chimica Acta}, year = {2021}, month = {12}, day = {12}, volume = {1192}, number = {1}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {339367}, keywords = {Total reflection X-ray fluorescence, Grazing incidence X-ray fluorescence, Aerosols, Airborne particulate matter, Air pollution, Cascade impactors}, web_url = {https://www.sciencedirect.com/journal/analytica-chimica-acta\&\#10;http://www.aerometprojectii.com/}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier B.V.}, language = {30}, ISSN = {0003-2670}, DOI = {10.1016/j.aca.2021.339367}, stag_bib_extends_levelofaccess = {NA}, author = {Kayser, Y. and Os{\'a}n, J. and Honicke, P. and Beckhoff, B.} } @Article { OlbrichHLvBOS2021, subid = {2175}, title = {Comparing temporal characteristics of slug flow from tomography measurements and video observations}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {100222}, keywords = {slug flow, interface dynamics, tomography, video observation}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001859}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100222}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and Hunt, A. and Leonard, T. and van Putten, D.S. and B{\"a}r, M. and Oberleithner, K. and Schmelter, S.} } @Article { Bruns2021, subid = {2195}, title = {Efficient very low frequency primary calibration method for accelerometers}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {19ENV03: Infra-AUV: Metrology for low-frequency sound and vibration}, pages = {100156}, keywords = {Primary vibration calibrationMulti-sineSine-approximation}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001197}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100156}, stag_bib_extends_levelofaccess = {NA}, author = {Bruns, T.} } @Article { SchmelterOKB2021, subid = {2196}, title = {Analysis of multiphase flow simulations and comparison with high-speed video observations}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {100154}, keywords = {Multiphase flowSlug flowPlug flowComputational fluid dynamics (CFD)High-speed video observationsLiquid level time series}, web_url = {https://doi.org/10.1016/j.measen.2021.100154}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100154}, stag_bib_extends_levelofaccess = {NA}, author = {Schmelter, S. and Olbrich, M. and Knotek, S. and B{\"a}r, M.} } @Article { GrahamTKBBNBOZZ2021, subid = {2275}, title = {Ultra-low flow rate measurement techniques}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {100279}, keywords = {Flow metrologyDrug deliveryCalibrationUncertaintyNanoflow}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100279}, stag_bib_extends_levelofaccess = {NA}, author = {Graham, E. and Thiemann, K. and Kartmann, S. and Batista, E. and Bissig, H. and Niemann, A. and Boudaoud, A.W. and Ogheard, F. and Zhang, Y. and Zagnoni, M.} } @Article { BatistaFFGAAM2021, subid = {2277}, title = {Uncertainty calculations in optical methods used for micro flow measurement}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {100155}, keywords = {MicroflowFront trackingMethodPending drop methodMeasurement uncertainty}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100155}, stag_bib_extends_levelofaccess = {NA}, author = {Batista, E. and Furtado, A. and Ferreira, M. do C. and Godinho, I. and Alvares, M. and Afonso, J. and Martins, R.F.} } @Article { BatistaSAAM2021, subid = {2276}, title = {Development of an experimental setup for micro flow measurement using the front tracking method}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {100152}, keywords = {Microflow measurementFront trackingCalibrationMeasurement uncertainty}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100152}, stag_bib_extends_levelofaccess = {NA}, author = {Batista, E. and Sousa, J.A. and Alvares, M. and Afonso, J. and Martins, R.F.} } @Article { AssoulineJBWTJGKRPR2021, subid = {2371}, title = {Excitonic nature of magnons in a quantum Hall ferromagnet}, journal = {Nature Physics}, year = {2021}, month = {12}, volume = {17}, number = {12}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {1369-1374}, keywords = {Graphene, mangons, interferometry, p-n-junction}, web_url = {https://arxiv.org/abs/2102.02068}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-021-01411-z}, stag_bib_extends_levelofaccess = {NA}, author = {Assouline, A. and Jo, M. and Brasseur, P. and Watanabe, K. and Taniguchi, T. and Jolicoeur, Th. and Glattli, D.C. and Kumada, N. and Roche, P. and Parmentier, F.D. and Roulleau, P.} } @Article { SudTSBSDSSWZZRCKKC2021, subid = {2383}, title = {Tailoring interfacial effect in multilayers with Dzyaloshinskii–Moriya interaction by helium ion irradiation}, journal = {Scientific Reports}, year = {2021}, month = {12}, volume = {11}, number = {23626}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {Spintronics, Nano magnetism, Magnetic skyrmions, Dzyaloshinskii–Moriya interaction}, web_url = {https://www.nature.com/articles/s41598-021-02902-y.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, DOI = {10.1038/s41598-021-02902-y}, stag_bib_extends_levelofaccess = {NA}, author = { Sud, A. and Tacchi, S. and Sagkovits, D. and Barton, C. and Sall, M. and Diez, L.H. and Stylianidis, E. and Smith, N. and Wright, L. and Zhang, S. and Zhang, X. and Ravelosona, D. and Carlotti, G. and Kurebayashi, H. and Kazakova, O. and Cubukcu, M. } } @Proceedings { ThorsethLB2021, subid = {2547}, title = {SENSITIVITY ANALYSIS ON THE EFFECT OF MEASUREMENT NOISE AND SAMPLING FREQUENCY ON THE CALCULATION OF THE TEMPORAL LIGHT ARTEFACTS}, journal = {Proceedings of the Conference CIE 2021}, year = {2021}, month = {12}, volume = {x48}, number2 = {20NRM01: MetTLM: Metrology for temporal light modulation}, pages = {OP28}, keywords = {Photometry, Temporal light modulation, TLM, Temporal light artefacts, TLA, Flicker, Measurement uncertainty, Propagation of uncertainty.}, web_url = {https://orbit.dtu.dk/en/publications/sensitivity-analysis-on-the-effect-of-measurement-noise-and-sampl}, misc2 = {EMPIR 2020: Pre-Co-Normative}, publisher = {International Commission on Illumination, CIE}, event_place = {Kuala Lumpur, Malaysia}, event_name = {CIE 2021 Midterm Meeting \& Conference}, event_date = {27-09-2021 to 29-09-2021}, language = {30}, DOI = {10.25039/x48.2021.OP28}, stag_bib_extends_levelofaccess = {NA}, author = {Thorseth, A. and Lind{\'e}n, J. and Bouroussis, C.A.} } @Article { RosnerWGB2021, subid = {2603}, title = {Uncertainty evaluation for complex GPS characteristics}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number = {-}, number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry}, pages = {100323}, keywords = {Coordinate measuring systems, Measurement uncertainty, Geometrical product specification, Sensitivity analysis, GUM uncertainty Framework}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421002865}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100323}, stag_bib_extends_levelofaccess = {NA}, author = {Rosner, P. and Wojtyła, M. and Gomez-Acedo, E. and Balsamo, A.} } @Article { WojtyaRFSB2021, subid = {2605}, title = {Verification of sensitivity analysis method of measurement uncertainty evaluation}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number = {Part of sp}, number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry}, pages = {100274}, keywords = {Coordinate measuring machines, Measurement uncertainty, Geometrical product specification, Sensitivity analysis, GUM uncertainty Framework, Uncertainty evaluating software}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421002373}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100274}, stag_bib_extends_levelofaccess = {NA}, author = {Wojtyła, M. and Rosner, P. and Forbes, A.B. and Savio, E. and Balsamo, A.} } @Article { PratoBMFG2021, subid = {2668}, title = {Theoretical insights on the influence of the experimental plan in the calibration of multicomponent force and moment transducers}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services}, pages = {100209}, keywords = {Experimental planMulticomponent transducersForce metrologyCalibration}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100209}, stag_bib_extends_levelofaccess = {NA}, author = {Prato, A. and Borgiattino, D. and Mazzoleni, F. and Facello, A. and Germak, A.} } @Article { OgrincRDBMBKOAGQMUOG2021, subid = {2701}, title = {Support for a European metrology network on food safety Food-MetNet}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {20NET02: Food-MetNet: Support for a European Metrology Network on Food Safety}, pages = {100285}, keywords = {Food; Metrology; Network; Safety; Stakeholders}, misc2 = {EMPIR 2020: Support for Networks}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100285}, stag_bib_extends_levelofaccess = {NA}, author = {Ogrinc, N. and Rossi, A.M. and Durbiano, F. and Becker, R. and Milavec, M. and Bogožalec Košir, A. and Kakoulides, E. and Ozer, H. and Ak\c{c}adag, F. and Goenaga-Infante, H. and Quaglia, M. and Mallia, S. and Umbricht, G. and O'Connor, G. and Guettler, B.} } @Article { ZjawinBCLZW2021, subid = {2745}, title = {Engineering the sensitivity of macroscopic physical systems to variations in the fine-structure constant}, journal = {Europhysics Letters}, year = {2021}, month = {12}, volume = {136}, number = {5}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {58001}, keywords = {variation of alpha,}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0295-5075, 1286-4854}, DOI = {10.1209/0295-5075/ac3da3}, stag_bib_extends_levelofaccess = {NA}, author = {Zjawin, B. and Bober, M. and Ciuryło, R. and Lisak, D. and Zawada, M. and Wcisło, P.} } @Article { DegiovanniGBSC2021, subid = {2760}, title = {EURAMET EMN-Q: The European metrology network for quantum technologies}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {19NET02: EMN-Quantum: Support for a European Metrology Network on quantum technologies}, pages = {100348}, keywords = {Quantum Metrology, Metrology for Quantum Technologies, Quantum Technologies, Quantum Clocks, Atomic Sensors, Quantum Electronics, Quantum Photonics, Quantum Computing, Quantum Sensing, Quantum Imaging}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421003111}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100348}, stag_bib_extends_levelofaccess = {NA}, author = {Degiovanni, I.P. and Gramegna, M. and Bize, S. and Scherer, H. and Chunnilall, C.} } @Article { KoybasiNTPRPBMSKGOIG2021, subid = {2601}, title = {High Performance Predictable Quantum Efficient Detector Based on Induced-Junction Photodiodes Passivated with SiO2/SiNx}, journal = {Sensors}, year = {2021}, month = {11}, day = {24}, volume = {21}, number = {23}, number2 = {18SIB10: chipS·CALe: Self-calibrating photodiodes for the radiometric linkage to fundamental constants}, pages = {7807}, keywords = {silicon photodetector; inversion layer photodiode; induced-junction; surface passivation;PECVD silicon nitride; radiometry; optical power; primary standard; predictable quantum efficiency}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21237807}, stag_bib_extends_levelofaccess = {NA}, author = {Koybasi, O. and Nordseth, {\O}. and Tran, T. and Povoli, M. and Rajteri, M. and Pepe, C. and Bardalen, E. and Manoocheri, F. and Summanwar, A. and Korpusenko, M. and Getz, M.N. and Ohlckers, P. and Ikonen, E. and Gran, J.} } @Article { RottgerVSPDISBAGGBWPiN2021, subid = {2317}, title = {Metrology for radiation protection: a new European network in the foundation phase}, journal = {Advances in Geosciences}, year = {2021}, month = {11}, day = {17}, volume = {57}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, pages = {1-7}, keywords = {supportBSS, EMN for Radiation Protection, metrology, regulation, EURAMET, EURATOM}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7359}, DOI = {10.5194/adgeo-57-1-2021}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and Veres, A. and Sochor, V. and Pinto, M. and Derlacinski, M. and Ioan, M-R. and Sabeta, A. and Bernat, R. and Adam-Guillermin, C. and Gracia Alves, J.H. and Glavič-Cindro, D. and Bell, S. and Wens, B. and Persson, L. and Živanović, M. and Nylund, R.} } @Article { RiemannAEBMSSRIF2021, subid = {2569}, title = {Assessment of measurement precision in single‐voxel spectroscopy at 7 T: Toward minimal detectable changes of metabolite concentrations in the human brain in vivo}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {11}, day = {16}, volume = {87}, number = {3}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {1119-1135}, keywords = {CRLBs, measurement precision, minimal detectable change, MR spectroscopy, reproducibility/repeatability, SPECIAL}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/mrm.29034}, misc2 = {EMPIR 2018: Health}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.29034}, stag_bib_extends_levelofaccess = {NA}, author = {Riemann, L.T. and Aigner, C.S. and Ellison, S.L.R. and Br{\"u}hl, R. and Mekle, R. and Schmitter, S. and Speck, O. and Rose, G. and Ittermann, B. and Fillmer, A.} } @Article { HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021, subid = {2336}, title = {Frequency drift in MR spectroscopy at 3T}, journal = {NeuroImage}, year = {2021}, month = {11}, volume = {241}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {118430}, keywords = {Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2021.118430}, stag_bib_extends_levelofaccess = {NA}, author = {Hui, S.C.N. and Mikkelsen, M. and Z{\"o}llner, H.J. and Ahluwalia, V. and Alcauter, S. and Baltusis, L. and Barany, D.A. and Barlow, L.R. and Becker, R. and Berman, J.I. and Berrington, A. and Bhattacharyya, P.K. and Blicher, J.U. and Bogner, W. and Brown, M.S. and Calhoun, V.D. and Castillo, R. and Cecil, K.M. and Choi, Y.B. and Chu, W.C.W. and Clarke, W.T. and Craven, A.R. and Cuypers, K. and Dacko, M. and de la Fuente-Sandoval, C. and Desmond, P. and Domagalik, A. and Dumont, J. and Duncan, N.W. and Dydak, U. and Dyke, K. and Edmondson, D.A. and Ende, G. and Ersland, L. and Evans, C.J. and Fermin, A.S.R. and Ferretti, A. and Fillmer, A. and Gong, T. and Greenhouse, I. and Grist, J.T. and Gu, M. and Harris, A.D. and Hat, K. and Heba, S. and Heckova, E. and Hegarty, J.P. and Heise, K-F. and Honda, S. and Jacobson, A. and Jansen, J.F.A. and Jenkins, C.W. and Johnston, S.J. and Juchem, C. and Kangarlu, A. and Kerr, A.B. and Landheer, K. and Lange, T. and Lee, P. and Levendovszky, S.R. and Limperopoulos, C. and Liu, F. and Lloyd, W. and Lythgoe, D.J. and Machizawa, M.G. and MacMillan, E.L. and Maddock, R.J. and Manzhurtsev, A.V. and Martinez-Gudino, M.L. and Miller, J.J. and Mirzakhanian, H. and Moreno-Ortega, M. and Mullins, P.G. and Nakajima, S. and Near, J. and Noeske, R. and Nordh{\o}y, W. and Oeltzschner, G. and Osorio-Duran, R. and Otaduy, M.C.G. and Pasaye, E.H. and Peeters, R. and Peltier, S.J. and Pilatus, U. and Polomac, N. and Porges, E.C. and Pradhan, S. and Prisciandaro, J.J. and Puts, N.A. and Rae, C.D. and Reyes-Madrigal, F. and Roberts, T.P.L. and Robertson, C.E. and Rosenberg, J.T. and Rotaru, D-G. and O'Gorman Tuura, R.L. and Saleh, M.G. and Sandberg, K. and Sangill, R. and Schembri, K. and Schrantee, A. and Semenova, N.A. and Singel, D. and Sitnikov, R. and Smith, J. and Song, Y. and Stark, C. and Stoffers, D. and Swinnen, S.P. and Tain, R. and Tanase, C. and Tapper, S. and Tegenthoff, M. and Thiel, T. and Thioux, M. and Truong, P. and van Dijk, P. and Vella, N. and Vidyasagar, R. and Vovk, A. and Wang, G. and Westlye, L.T. and Wilbur, T.K. and Willoughby, W.R. and Wilson, M. and Wittsack, H-J. and Woods, A.J. and Wu, Y-C. and Xu, J. and Lopez, M.Y. and Yeung, D.K.W. and Zhao, Q. and Zhou, X. and Zupan, G. and Edden, R.A.E.} } @Article { CervantesDBDB2021, subid = {2315}, title = {Monte Carlo calculation of detector perturbation and quality correction factors in a 1.5 T magnetic resonance guided radiation therapy small photon beams}, journal = {Physics in Medicine \& Biology}, year = {2021}, month = {11}, volume = {66}, number = {22}, number2 = {19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy}, pages = {225004}, keywords = {magnetic fields, small fields, perturbation factors, quality correction factors, MRgRT, ionization chambers, solid-state detectors}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac3344}, stag_bib_extends_levelofaccess = {NA}, author = {Cervantes, Y. and Duchaine, J. and Billas, I. and Duane, S. and Bouchard, H.} } @Article { RazoukBHH2021, subid = {2324}, title = {Towards accurate measurements of specific heat of solids by drop calorimetry up to 3000 \(^{\circ}\)C}, journal = {Thermal Science and Engineering Progress}, year = {2021}, month = {11}, volume = {26}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, pages = {101130}, keywords = {Drop calorimetry, Specific heat, High temperature, Metrology}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {2451-9049}, DOI = {10.1016/j.tsep.2021.101130}, stag_bib_extends_levelofaccess = {NA}, author = {Razouk, R. and Beaumont, O. and Hameury, J. and Hay, B.} } @Article { RipaIGSGFBLDG2021_2, subid = {2694}, title = {Corrigendum: Refractive index gas thermometry between 13.8 K and 161.4 K (2021 Metrologia 58 025008)}, journal = {Metrologia}, year = {2021}, month = {10}, day = {25}, volume = {58}, number = {6}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {069501}, keywords = {refractive index gas thermometry}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac2d9e}, stag_bib_extends_levelofaccess = {NA}, author = {Ripa, D.M. and Imbraguglio, D. and Gaiser, C. and Steur, P.P.M. and Giraudi, D. and Fogliati, M. and Bertinetti, M. and Lopardo, G. and Dematteis, R. and Gavioso, R.M.} } @Article { ZeichhardtFDBHSHIVHVMCGSOEBHK2021, subid = {2777}, title = {The Dangers of Using Cq to Quantify Nucleic Acid in Biological Samples: A Lesson From COVID-19}, journal = {Clinical Chemistry}, year = {2021}, month = {10}, day = {22}, volume = {68}, number = {1}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {153-162}, keywords = {SARS-CoV-2, RT-qPC, EQA}, web_url = {https://academic.oup.com/clinchem/article/68/1/153/6385233\#325300656\&\#10;https://zenodo.org/record/6637873/files/18HLT03\%20Septimet\%20Supplementary\%20Funding\%20Acknowledgement\%20CLIN\%20CHEM.pdf?download=1}, misc2 = {EMPIR 2018: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0009-9147, 1530-8561}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6637873}, author = {Zeichhardt, H. and Foy, C.A. and D{\"u}hring, U. and Bae, Y-K. and Hingley-Wilson, S. and Storey, N. and Hong, K.H. and In, J. and Vandesompele, J. and Harris, K. and Verwilt, J. and Moran-Gilad, J. and Cowen, S. and Grunert, H-P. and Stewart, G. and O’Sullivan, D.M. and Evans, D. and Braybrook, J. and Huggett, Ji.F. and Kammel, M.} } @Article { DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021, subid = {2365}, title = {A Comprehensive Description of Multi-Term LSM for Applying Multiple a Priori Constraints in Problems of Atmospheric Remote Sensing: GRASP Algorithm, Concept, and Applications}, journal = {Frontiers in Remote Sensing}, year = {2021}, month = {10}, day = {19}, volume = {2}, number2 = {19ENV04: MAPP: Metrology for aerosol optical properties}, keywords = {GRASP, Radiative Transfer, Inversion model}, web_url = {https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full}, misc2 = {EMPIR 2019: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-6187}, DOI = {10.3389/frsen.2021.706851}, stag_bib_extends_levelofaccess = {NA}, author = {Dubovik, O. and Fuertes, D. and Litvinov, P. and Lopatin, A. and Lapyonok, T. and Doubovik, I. and Xu, F. and Ducos, F. and Chen, C. and Torres, B. and Derimian, Y. and Li, L. and Herreras-Giralda, M. and Herrera, M. and Karol, Y. and Matar, C. and Schuster, G.L. and Espinosa, R. and Puthukkudy, A. and Li, Z. and Fischer, J. and Preusker, R. and Cuesta, J. and Kreuter, A. and Cede, A. and Aspetsberger, M. and Marth, D. and Bindreiter, L. and Hangler, A. and Lanzinger, V. and Holter, C. and Federspiel, C.} } @Article { HayBFFGRDH2021, subid = {2250}, title = {Uncertainty Assessment for Very High Temperature Thermal Diffusivity Measurements on Molybdenum, Tungsten and Isotropic Graphite}, journal = {International Journal of Thermophysics}, year = {2021}, month = {10}, day = {17}, volume = {43}, number = {1}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {High temperature, Isotropic graphite, Molybdenum, Thermal diffusivity, Tungsten, Uncertainty}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-021-02926-6}, stag_bib_extends_levelofaccess = {NA}, author = {Hay, B. and Beaumont, O. and Failleau, G. and Fleurence, N. and Grelard, M. and Razouk, R. and Dav{\'e}e, G. and Hameury, J.} } @Article { ArrheniusABMBWBGLCSBNR2021, subid = {2482}, title = {Strategies for the sampling of hydrogen at refuelling stations for purity assessment}, journal = {International Journal of Hydrogen Energy}, year = {2021}, month = {10}, day = {11}, volume = {46}, number = {70}, number2 = {19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2}, pages = {34839-34853}, keywords = {Hydrogen,Refuelling stations,Sampling device,Fuel quality assessment}, web_url = {https://www.sciencedirect.com/science/article/pii/S0360319921031694}, misc2 = {EMPIR 2019: Energy}, publisher = {Elsevier}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2021.08.043}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Aarhaug, T.A. and Bacquart, T. and Morris, A. and Bartlett, S. and Wagner, L. and Blondeel, C. and Gozlan, B. and Lescornes, Y. and Chramosta, N. and Spitta, C. and Basset, E. and Nouvelot, Q. and Rizand, M.} } @Article { SteindlSABK2021, subid = {2345}, title = {On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001)}, journal = {New Journal of Physics}, year = {2021}, month = {10}, volume = {23}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {103029}, keywords = {Quantum Dots, carrier dynamics, optical spectroscopy, memory devices}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac2bd6}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { MilanoPMRHBIR2021, subid = {2676}, title = {In materia reservoir computing with a fully memristive architecture based on self-organizing nanowire networks}, journal = {Nature Materials}, year = {2021}, month = {10}, volume = {21}, number = {2}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {195-202}, keywords = {memristive devices, memristive networks, nanowire networks, reservoir computing, physical computing}, web_url = {https://iris.polito.it/retrieve/handle/11583/2936403/537201/05_Manuscript.pdf}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1476-1122, 1476-4660}, DOI = {10.1038/s41563-021-01099-9}, stag_bib_extends_levelofaccess = {NA}, author = {Milano, G. and Pedretti, G. and Montano, K. and Ricci, S. and Hashemkhani, S. and Boarino, L. and Ielmini, D. and Ricciardi, C.} } @Article { SteindlSABK20210, subid = {2345}, title = {On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001)}, journal = {New Journal of Physics}, year = {2021}, month = {10}, volume = {23}, number = {10}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {103029}, keywords = {Quantum Dots, carrier dynamics, optical spectroscopy, memory devices}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac2bd6}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { SteindlSABK20211, subid = {2345}, title = {On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001)}, journal = {New Journal of Physics}, year = {2021}, month = {10}, volume = {23}, number = {10}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {103029}, keywords = {Quantum Dots, carrier dynamics, optical spectroscopy, memory devices}, misc2 = {EMPIR 2020: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac2bd6}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { BukerSKBPS2021, subid = {2207}, title = {Investigations on the Influence of Total Water Hardness and pH Value on the Measurement Accuracy of Domestic Cold Water Meters}, journal = {MDPI Water}, year = {2021}, month = {9}, day = {29}, volume = {13}, number = {19}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {domestic water meters; total hardness; pH value; wear test; flow measurement}, misc2 = {EMPIR 2017: Industry}, language = {30}, DOI = {10.3390/w13192701}, stag_bib_extends_levelofaccess = {NA}, author = {B{\"u}ker, O. and Stolt, K. and Kroner, C. and Benkova, M. and Pavlas, J. and Seypka, V.} } @Proceedings { SeferiCB2021, subid = {2268}, title = {Review of PMU Algorithms Suitable for Real-Time Operation With Digital Sampled Value Data}, journal = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2021}, month = {9}, day = {29}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {6}, keywords = {Algorithms, frequency, phasor measurement unit, real-time operation, ROCOF, sample value data, synchrophasor}, web_url = {https://strathprints.strath.ac.uk/78316/}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Online}, event_name = {IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {29-09-2021 to 01-10-2021}, language = {30}, ISBN = {978-1-7281-6923-1}, ISSN = {2475-2304}, DOI = {10.1109/AMPS50177.2021.9586034}, stag_bib_extends_levelofaccess = {NA}, author = {Seferi, Y. and Cetina, R.G.Q. and Blair, S.M.} } @Proceedings { OlivanMBC2021, subid = {2313}, title = {An IEC 61850 Sampled Values-based Analyzer for Power Quality applications on Smart Substations}, journal = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2021}, month = {9}, day = {29}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, keywords = {Power quality,substation automation, smart grids, measuremen ttechniques, instrument transformers}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Cagliari, Italy}, event_name = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {29-09-2021 to 01-10-2021}, language = {30}, ISBN = {978-1-7281-6923-1}, ISSN = {2475-2304}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5703000}, author = {Oliv{\'a}n, M.A. and Mareca, A. and Bruna, J. and Cervero, D.} } @Proceedings { ChenCDLMLB2021, subid = {2327}, title = {Novel Calibration systems for the dynamic and steady-state testing of digital instrument transformers}, journal = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems}, year = {2021}, month = {9}, day = {29}, volume = {-}, number = {-}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {6}, keywords = {Power quality, substation automation, smart grids, measurement techniques, instrument transformers}, web_url = {https://ieeexplore.ieee.org/document/9586040}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Cagliari, Italy}, event_name = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {29-09-2021 to 01-10-2021}, language = {30}, ISBN = {Electronic ISBN:978-1-7281-692}, ISSN = {Electronic ISSN: 2475-2304 Pri}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.5717933}, author = {Chen, Y. and Crotti, G. and Dubowik, A. and Letizia, P.S. and Mohns, E. and Luiso, M. and Bruna, J.} } @Article { FogliettaGBCBFDSC2021, subid = {2263}, title = {5-Aminolevulinic Acid Triggered by Ultrasound Halts Tumor Proliferation in a Syngeneic Model of Breast Cancer}, journal = {Pharmaceuticals}, year = {2021}, month = {9}, day = {25}, volume = {14}, number = {10}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {972}, keywords = {ultrasound; sonodynamic therapy; breast cancer}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8247}, DOI = {10.3390/ph14100972}, stag_bib_extends_levelofaccess = {NA}, author = {Foglietta, F. and Gola, G. and Biasibetti, E. and Capucchio, M.T. and Bruni, I. and Francovich, A. and Durando, G. and Serpe, L. and Canaparo, R.} } @Article { CzompolyBGPO2021, subid = {2484}, title = {Characterization of unique aerosol pollution episodes in urban areas using TXRF and TXRF-XANES.}, journal = {Atmospheric Pollution Research}, year = {2021}, month = {9}, day = {25}, volume = {12}, number = {11}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {101214}, keywords = {Atmospheric aerosols, TXRF, XANES, Elemental size distribution, Elemental speciation, Cascade impactor}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier B.V.}, language = {30}, ISSN = {1309-1042}, DOI = {10.1016/j.apr.2021.101214}, stag_bib_extends_levelofaccess = {NA}, author = {Cz{\"o}mp{\"o}ly, O. and B{\"o}rcs{\"o}k, E. and Groma, V. and Pollastri, S. and Os{\'a}n, J.} } @Article { RottgerRGVCOHCCBIRKCAYFMM2021, subid = {2224}, title = {New metrology for radon at the environmental level}, journal = {Measurement Science and Technology}, year = {2021}, month = {9}, day = {23}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {radon, metrology, tracer, environmental measurements}, misc2 = {EMPIR 2019: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac298d}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and R{\"o}ttger, S. and Grossi, C. and Vargas, A. and Curcoll, R. and Ot{\'a}hal, P. and Hern{\'a}ndez-Ceballos, M.{\'A}. and Cinelli, G. and Chambers, S. and Barbosa, S.A. and Ioan, M-R. and Radulescu, I. and Kikaj, D. and Chung, E. and Arnold, T. and Yver Kwok, C. and Fuente, M. and Mertes, F. and Morosh, V.} } @Article { GroscheKBK2021, subid = {2176}, title = {Validating frequency transfer via interferometric fiber links for optical clock comparisons}, journal = {New Journal of Physics}, year = {2021}, month = {9}, day = {20}, volume = {23}, number = {9}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {093024}, keywords = {optical frequency dissemination, optical fiber links, optical clocks, optical clock comparisons, ultra-stable lasers}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ac21a0}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac21a0}, stag_bib_extends_levelofaccess = {NA}, author = {Grosche, G. and Kuhl, A. and Benkler, E. and Koke, S.} } @Article { GroscheKBK20210, subid = {2176}, title = {Validating frequency transfer via interferometric fiber links for optical clock comparisons}, journal = {New Journal of Physics}, year = {2021}, month = {9}, day = {20}, volume = {23}, number = {9}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {093024}, keywords = {optical frequency dissemination, optical fiber links, optical clocks, optical clock comparisons, ultra-stable lasers}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ac21a0}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac21a0}, stag_bib_extends_levelofaccess = {NA}, author = {Grosche, G. and Kuhl, A. and Benkler, E. and Koke, S.} } @Article { BuonacorsiSSTKHHRWB2021, subid = {2168}, title = {Non-adiabatic single-electron pumps in a dopant-free GaAs/AlGaAs 2DEG}, journal = {Applied Physics Letters}, year = {2021}, month = {9}, day = {13}, volume = {119}, number = {11}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {114001}, keywords = {Single electron transport, quantum dot, dopant-free GaAs/AlGaAs system, quantum transport, single electron pump}, web_url = {https://arxiv.org/abs/2102.13320}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0062486}, stag_bib_extends_levelofaccess = {NA}, author = {Buonacorsi, B. and Sfigakis, F. and Shetty, A. and Tam, M.C. and Kim, H.S. and Harrigan, S.R. and Hohls, F. and Reimer, M.E. and Wasilewski, Z.R. and Baugh, J.} } @Article { YamakawaATBFBKRD2021, subid = {2038}, title = {Hg isotopic composition of one-year-old spruce shoots: Application to long-term Hg atmospheric monitoring in Germany}, journal = {Chemosphere}, year = {2021}, month = {9}, volume = {279}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {130631}, keywords = {Hg isotopic composition, spruce shoots, Hg atmospheric monitoring}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0045-6535}, DOI = {10.1016/j.chemosphere.2021.130631}, stag_bib_extends_levelofaccess = {NA}, author = {Yamakawa, A. and Amouroux, D. and Tessier, E. and B{\'e}rail, S. and Fettig, I. and Barre, J.P.G. and Koschorreck, J. and R{\"u}del, H. and Donard, O.F.X.} } @Article { EssBKGV2021, subid = {2081}, title = {Coated soot particles with tunable, well-controlled properties generated in the laboratory with a miniCAST BC and a micro smog chamber}, journal = {Journal of Aerosol Science}, year = {2021}, month = {9}, volume = {157}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, pages = {105820}, keywords = {soot, aerosol, secondary organic matter, calibration, black carbon, absorption photometers}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2021.105820}, stag_bib_extends_levelofaccess = {NA}, author = {Ess, M.N. and Bert{\`o}, M. and Keller, A. and Gysel-Beer, M. and Vasilatou, K.} } @Article { TeirLWHBFPL2021, subid = {2254}, title = {In-Line Measurement of the Surface Texture of Rolls Using Long Slender Piezoresistive Microprobes}, journal = {Sensors}, year = {2021}, month = {9}, volume = {21}, number = {17}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {5955}, keywords = {silicon microprobe, high speed, roughness, paper machine roll, metrology}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21175955}, stag_bib_extends_levelofaccess = {NA}, author = {Teir, L. and Lindstedt, T. and Widmaier, T. and Hemming, B. and Brand, U. and Fahrbach, M. and Peiner, E. and Lassila, A.} } @Article { StoreyBPOHWBH2021, subid = {2597}, title = {Single base mutations in the nucleocapsid gene of SARS-CoV-2 affects amplification efficiency of sequence variants and may lead to assay failure}, journal = {Journal of Clinical Virology Plus}, year = {2021}, month = {9}, volume = {1}, number = {3}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {100037}, keywords = {SARS-CoV-2, Nucleocapsid, Mutations, PCR, Failure, Silico}, web_url = {https://www.sciencedirect.com/science/article/pii/S2667038021000296}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2667-0380}, DOI = {10.1016/j.jcvp.2021.100037}, stag_bib_extends_levelofaccess = {NA}, author = {Storey, N. and Brown, J.R. and Pereira, R.P.A. and O'Sullivan, D.M. and Huggett, J.F. and Williams, R. and Breuer, J. and Harris, K.A.} } @Article { FerreroBCVHYACMT2021, subid = {2146}, title = {Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes}, journal = {Nanomaterials}, year = {2021}, month = {8}, day = {25}, volume = {11}, number = {9}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {2179}, keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11092179}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Barrera, G. and Celegato, F. and Vicentini, M. and H{\"u}seyin, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.} } @Article { KneeviMBBIKMNNWi2021, subid = {2111}, title = {Investigations into the basic properties of different passive dosimetry systems used in environmental radiation monitoring in the aftermath of a nuclear or radiological event}, journal = {Radiation Measurements}, year = {2021}, month = {8}, volume = {146}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106615}, keywords = {Passive dosimetry systems, Environmental radiation monitoring, Nuclear or radiological event}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106615}, stag_bib_extends_levelofaccess = {NA}, author = {Knežević, Ž. and Majer, M. and Baranowska, Z. and Bjelac, O.C. and Iurlaro, G. and Kržanović, N. and Mariotti, F. and Nodilo, M. and Neumaier, S. and Wołoszczuk, K. and Živanović, M.} } @Article { EdlerBGJTAASZ2021, subid = {2137}, title = {Pt-40\%Rh Versus Pt-6\%Rh Thermocouples: An emf-Temperature Reference Function for the Temperature Range 0 \(^{\circ}\)C to 1769 \(^{\circ}\)C}, journal = {International Journal of Thermophysics}, year = {2021}, month = {8}, volume = {42}, number = {11}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {1-13}, keywords = {Noble metal thermocouples, Reference function, Thermoelectric stability and homogeneity}, web_url = {https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf.}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-021-02895-w}, stag_bib_extends_levelofaccess = {NA}, author = {Edler, F. and Bojkovski, J. and Garcia Izquerdo, C. and Jose Martin, M. and Tucker, D. and Arifovic, N. and Andersen, S.L. and Šindel{\'a}rov{\'a}, L. and Žužek, V.} } @Article { SousaBDFPRM2021, subid = {2153}, title = {Uncertainty calculation methodologies in microflow measurements: Comparison of GUM, GUM-S1 and Bayesian approach}, journal = {Measurement}, year = {2021}, month = {8}, volume = {181}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, pages = {109589}, keywords = {Uncertainty evaluation; Accuracy; Microflow measurement; Syringe pump; Gravimetric method; Bayesian approach}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2021.109589}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Batista, E. and Demeyer, S. and Fischer, N. and Pellegrino, O. and Ribeiro, A.S. and Martins, L.L.} } @Article { uekB2021, subid = {2280}, title = {Miniature iron-carbon eutectic point crucible for the calibration of thermometers}, journal = {Measurement}, year = {2021}, month = {8}, volume = {181}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {109619}, keywords = {temperature, calibration, melting point, iron-carbon eutectic, crucible}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2021.109619}, stag_bib_extends_levelofaccess = {NA}, author = {Žužek, V. and Bojkovski, J.} } @Article { BatistaG2021, subid = {2278}, title = {Improving infusion dosing accuracy for patient safety}, journal = {European Pharmaceutical Review}, year = {2021}, month = {8}, volume = {26}, number = {4}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {8-10}, keywords = {Drug deliverPatient safetyInfusion errors}, web_url = {https://www.europeanpharmaceuticalreview.com/article/160985/european-pharmaceutical-review-issue-4-2021/}, misc2 = {EMPIR 2018: Health}, publisher = {Russell Publishing}, language = {30}, ISSN = {1360-8606}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISSN 1360-8606}, author = {Batista, E. and Graham, E.} } @Article { BillasBOD2021, subid = {2316}, title = {Traceable reference dosimetry in MRI guided radiotherapy using alanine: calibration and magnetic field correction factors of ionisation chambers}, journal = {Physics in Medicine \& Biology}, year = {2021}, month = {8}, volume = {66}, number = {16}, number2 = {19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy}, pages = {165006}, keywords = {MRI-linac, magnetic field, traceable reference dosimetry, magnetic field correction factors, alanine dosimetry}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac0680}, stag_bib_extends_levelofaccess = {NA}, author = {Billas, I. and Bouchard, H. and Oelfke, U. and Duane, S.} } @Article { FuchsJKMB2021, subid = {2508}, title = {A cavity-based optical antenna for color centers in diamond}, journal = {APL Photonics}, year = {2021}, month = {8}, volume = {6}, number = {8}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {086102}, keywords = {color centres, diamond, optical antenna, single-photon source}, web_url = {https://aip.scitation.org/doi/10.1063/5.0057161}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {2378-0967}, DOI = {10.1063/5.0057161}, stag_bib_extends_levelofaccess = {NA}, author = {Fuchs, P. and Jung, T. and Kieschnick, M. and Meijer, J. and Becher, C.} } @Article { BarrattRCSKE2021, subid = {2167}, title = {Asymmetric arms maximize visibility in hot-electron interferometers}, journal = {Physical Review B}, year = {2021}, month = {7}, day = {30}, volume = {104}, number = {3}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {035436}, keywords = {single electrons, electron interferometry, quantum transport, electron quantum optics}, web_url = {https://arxiv.org/abs/2104.01653}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.104.035436}, stag_bib_extends_levelofaccess = {NA}, author = {Barratt, C.J. and Ryu, S. and Clark, L.A. and Sim, H.-S. and Kataoka, M. and Emary, C.} } @Article { FogliettaPGBPDTSC2021, subid = {2264}, title = {Sonodynamic Treatment Induces Selective Killing of Cancer Cells in an In Vitro Co-Culture Model}, journal = {Cancers}, year = {2021}, month = {7}, day = {30}, volume = {13}, number = {15}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {3852}, keywords = {ultrasound; sonodynamic therapy; cancer cells; membrane fluidity}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-6694}, DOI = {10.3390/cancers13153852}, stag_bib_extends_levelofaccess = {NA}, author = {Foglietta, F. and Pinnelli, V. and Giuntini, F. and Barbero, N. and Panzanelli, P. and Durando, G. and Terreno, E. and Serpe, L. and Canaparo, R.} } @Article { RadtkeCKLSDAHNVRQLDBUL2021, subid = {2285}, title = {A unified pH scale for all solvents: part I – intention and reasoning (IUPAC Technical Report)}, journal = {Pure and Applied Chemistry}, year = {2021}, month = {7}, day = {30}, volume = {93}, number = {9}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1049-1060}, keywords = {Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {0033-4545, 1365-3075}, DOI = {10.1515/pac-2019-0504}, stag_bib_extends_levelofaccess = {NA}, author = {Radtke, V. and Cam{\~o}es, F. and Krossing, I. and Leito, I. and Stoica, D. and Deleebeeck, L. and Anes, B. and Heering, A. and N{\"a}ykki, T. and Veltz{\'e}, S. and Rozikov{\'a}, M. and Quendera, R. and Liv, L. and D{\'a}niel, N. and Bastkowski, F. and Uysal, E. and Lawrence, N.} } @Article { MilanoLLBRV2021, subid = {2236}, title = {Structure‐Dependent Influence of Moisture on Resistive Switching Behavior of ZnO Thin Films}, journal = {Advanced Materials Interfaces}, year = {2021}, month = {7}, day = {28}, volume = {8}, number = {16}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {2100915}, keywords = {effect of moisture on electroforming, electrical conductivity, memristors, nanostructures, resistive switching}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/admi.202100915}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2196-7350, 2196-7350}, DOI = {10.1002/admi.202100915}, stag_bib_extends_levelofaccess = {NA}, author = {Milano, G. and Luebben, M. and Laurenti, M. and Boarino, L. and Ricciardi, C. and Valov, I.} } @Article { RibeiroACSMLBSS2021, subid = {2198}, title = {Role of measurement uncertainty in the comparison of average areal rainfall methods}, journal = {Metrologia}, year = {2021}, month = {7}, day = {23}, volume = {58}, number = {4}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, pages = {044001}, keywords = {measurement uncertainty, rainfall, precipitation, estimating, arithmetic mean method, Thiessen polygon method, isohyetal method}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IOP Publishing}, address = {Bristol, United Kingdom}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac0d49}, stag_bib_extends_levelofaccess = {NA}, author = {Ribeiro, A.S. and Almeida, M.C. and Cox, M.G. and Sousa, J.A. and Martins, L. and Loureiro, D. and Brito, R. and Silva, M. and Soares, A.C.} } @Article { TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021, subid = {2260}, title = {A multicentre and multi-national evaluation of the accuracy of quantitative Lu-177 SPECT/CT imaging performed within the MRTDosimetry project}, journal = {EJNMMI Physics}, year = {2021}, month = {7}, day = {23}, volume = {8}, number = {1}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, keywords = {Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2197-7364}, DOI = {10.1186/s40658-021-00397-0}, stag_bib_extends_levelofaccess = {NA}, author = {Tran-Gia, J. and Denis-Bacelar, A.M. and Ferreira, K.M. and Robinson, A.P. and Calvert, N. and Fenwick, A.J. and Finocchiaro, D. and Fioroni, F. and Grassi, E. and Heetun, W. and Jewitt, S.J. and Kotzassarlidou, M. and Ljungberg, M. and McGowan, D.R. and Scott, N. and Scuffham, J. and Gleisner, K.S. and Tipping, J. and Wevrett, J. and Bardi{\`e}s, M. and Berenato, S. and Bilas, I. and Bobin, C. and Capogni, M. and Chauvin, M. and COLLINS, S. and Cox, M. and Dabin, J. and D’Arienzo, M. and Gustafsson, J. and Hallam, A. and Kalathas, T. and Kayal, G. and Lorusso, G. and Maringer, F-J. and Morgan, D. and Smyth, V. and Solc, J. and Štemberkov{\'a}, L. and Struelens, L. and Vergara-Gil, A. and Wiedner, H. and Lassmann, M.} } @Article { NissilaFKMIJBKKOBMGK2021, subid = {2138}, title = {Driving a low critical current Josephson junction array with a mode-locked laser}, journal = {Applied Physics Letters}, year = {2021}, month = {7}, day = {19}, volume = {119}, number = {3}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {032601}, keywords = {Josephson voltage standard, Josephson effect, Superconducting device, Laser, Photodiode}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0060804}, stag_bib_extends_levelofaccess = {NA}, author = {Nissil{\"a}, J. and Fordell, T. and Kohop{\"a}{\"a}, K. and Mykk{\"a}nen, E. and Immonen, P. and Jabdaraghi, R.N. and Bardalen, E. and Kieler, O. and Karlsen, B. and {\O}hlckers, P.A. and Behr, R. and Manninen, A.J. and Govenius, J. and Kemppinen, A.} } @Article { KruskopfBPCPREPPGS2021, subid = {2113}, title = {Graphene Quantum Hall Effect Devices for AC and DC Electrical Metrology}, journal = {IEEE Transactions on Electron Devices}, year = {2021}, month = {7}, volume = {68}, number = {7}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {3672-3677}, keywords = {Alternating current, dissipation factor,double-shield, epitaxial graphene, magnetocapacitance,magnetotransport, precision measurements, quantized Hallresistance (QHR) standards, quantum Hall effect (QHE),superconducting contacts}, web_url = {https://ieeexplore.ieee.org/document/9446081}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9383, 1557-9646}, DOI = {10.1109/TED.2021.3082809}, stag_bib_extends_levelofaccess = {NA}, author = {Kruskopf, M. and Bauer, S. and Pimsut, Y. and Chatterjee, A. and Patel, D.K. and Rigosi, A.F. and Elmquist, R.E. and Pierz, K. and Pesel, E. and G{\"o}tz, M. and Schurr, J.} } @Techreport { KlingKRBRBS2021, subid = {2126}, title = {Specifications and testing strategies for measurement devices for noise exposure determination in the infrasound frequency range}, journal = {PTB Open Access Repository}, year = {2021}, month = {7}, volume = {n. a.}, number = {n. a.}, number2 = {19ENV03: Infra-AUV: Metrology for low-frequency sound and vibration}, pages = {20210609}, keywords = {Sound level meters, Infrasound, Type approval, Noise exposure}, web_url = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19ENV03.RE.20210609}, misc2 = {EMPIR 2019: Environment}, publisher = {PTB}, language = {30}, ISBN = {n. a.}, ISSN = {n. a.}, DOI = {10.7795/EMPIR.19ENV03.RE.20210609}, stag_bib_extends_levelofaccess = {NA}, author = {Kling, C. and Koch, C. and Rust, M. and Barham, R. and Rodrigues, D. and Barrera Figueroa, S. and Sandermann Olsen, E.} } @Article { PrzyklenkBOEYAFPZCMRB2021, subid = {2104}, title = {New European Metrology Network for Advanced Manufacturing}, journal = {Measurement Science and Technology}, year = {2021}, month = {6}, day = {21}, number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing}, keywords = {Advance Manufacturing, Metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), Stakeholder}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac0d25}, stag_bib_extends_levelofaccess = {NA}, author = {Przyklenk, A. and Balsamo, A. and O'Connor, D. and Evans, A. and Yandayan, T. and Akg{\"o}z, A. and Flys, O. and Phillips, D. and Zelen{\'y}, V. and Czułek, D. and Meli, F. and Ragusa, C. and Bosse, H.} } @Article { GajjelaHDSSKBMBK2021, subid = {2614}, title = {Structural and compositional analysis of (InGa)(AsSb)/GaAs/GaP Stranski–Krastanov quantum dots}, journal = {Light: Science \& Applications}, year = {2021}, month = {6}, day = {15}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {125}, keywords = {Ga)(AsSb)/GaAs/GaP, Stranski–Krastanov, quantum dots}, web_url = {https://www.nature.com/articles/s41377-021-00564-z}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/s41377-021-00564-z}, stag_bib_extends_levelofaccess = {NA}, author = {Gajjela, R.S.R. and Hendriks, A.L. and Douglas, J.O. and Sala, E.M. and Steindl, P. and Klenovsk{\'y}, P. and Bagot, P.A.J. and Moody, M.P. and Bimberg, D. and Koenraad, P.M.} } @Proceedings { PrzyklenkBOEYAFZCPMRB2021, subid = {2123}, title = {AdvManuNet: Support for a European Metrology Network for Advanced Manufacturing}, journal = {Proceedings 21st euspen International Conference and Exhibition}, year = {2021}, month = {6}, volume = {2021}, number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing}, keywords = {advanced manufacturing, metrology, European metrology networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0}, misc2 = {EMPIR 2019: Support for Networks}, event_place = {Online Conference}, event_name = {21st euspen International Conference and Exhibition}, event_date = {07-06-2021 to 10-06-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base//ICE21292.pdf}, author = {Przyklenk, A. and Balsamo, A. and O’Connor, D. and Evans, A. and Yandayan, T. and Akg{\"o}z, S. and Flys, O. and Zelen{\'y}, V. and Czułek, D. and Phillips, D. and Meli, F. and Ragusa, C. and Bosse, H.} } @Article { DeleebeeckSNSRVHBLQCS2021, subid = {2183}, title = {Unified pH Measurements of Ethanol, Methanol, and Acetonitrile, and Their Mixtures with Water}, journal = {Sensors}, year = {2021}, month = {6}, volume = {21}, number = {11}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {3935}, keywords = {pHabs; ionic liquid salt bridge; commercial glass electrodes; water–alcohol mixture;non-aqueous pH}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21113935}, stag_bib_extends_levelofaccess = {NA}, author = {Deleebeeck, L. and Snedden, A. and Nagy, D. and Szil{\'a}gyi Nagyn{\'e}, Z. and Rozikov{\'a}, M. and Vičarov{\'a}, M. and Heering, A. and Bastkowski, F. and Leito, I. and Quendera, R. and Cabral, V. and Stoica, D.} } @Article { FahrbachFBXCBP2021, subid = {2255}, title = {Customized piezoresistive microprobes for combined imaging of topography and mechanical properties}, journal = {Measurement: Sensors}, year = {2021}, month = {6}, volume = {15}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {100042}, keywords = {Cantilever microprobe, Piezoresistive, Atomic force microscopy, Force–distance curves, Contact resonance, Lubricants}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100042}, stag_bib_extends_levelofaccess = {NA}, author = {Fahrbach, M. and Friedrich, S. and Behle, H. and XU, M. and Cappella, B. and Brand, U. and Peiner, E.} } @Article { PicolloBBSORR2021, subid = {2266}, title = {Creation of pure non-crystalline diamond nanostructures via room-temperature ion irradiation and subsequent thermal annealing}, journal = {Nanoscale Advances}, year = {2021}, month = {6}, volume = {3}, number = {14}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {4156-4165}, keywords = {Diamond, Irradiation, Carbon, Imaging}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2021/NA/D1NA00136A}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2516-0230}, DOI = {10.1039/d1na00136a}, stag_bib_extends_levelofaccess = {NA}, author = {Picollo, F. and Battiato, A. and Bosia, F. and Scaffidi Muta, F. and Olivero, P. and Rigato, V. and Rubanov, S.} } @Article { KnotekBCKHUKS2021, subid = {2369}, title = {Measurements of water consumption for the development of new test regimes for domestic water meters}, journal = {Flow Measurement and Instrumentation}, year = {2021}, month = {6}, volume = {79}, number = {-}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, pages = {101963}, keywords = {water consumption, consumption measurement, water meters, dynamic loads, billing}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2021.101963}, stag_bib_extends_levelofaccess = {NA}, author = {Knotek, S. and Benkova, M. and Christophersen, N. and Kondrup, J.B. and Haack, S. and Unsal, B. and Kroner, C. and Schumann, D.} } @Article { BircherNKM2021, subid = {2411}, title = {Measurement of temperature induced X-ray tube transmission target displacements for dimensional computed tomography}, journal = {Precision Engineering}, year = {2021}, month = {6}, volume = {72}, number = {2021}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {409-416}, keywords = {X-ray tube, Transmission target, Thermal stability, Focal spot, Finite element simulation, Dimensional metrology, X-ray computed tomography}, web_url = {https://www.sciencedirect.com/science/article/pii/S0141635921001574?via\%3Dihub}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2021.06.002}, stag_bib_extends_levelofaccess = {NA}, author = {Bircher, B. and Neuhaus, S. and K{\"u}ng, A. and Meli, F.} } @Article { PicolloBBSORR20210, subid = {2266}, title = {Creation of pure non-crystalline diamond nanostructures via room-temperature ion irradiation and subsequent thermal annealing}, journal = {Nanoscale Advances}, year = {2021}, month = {6}, volume = {3}, number = {14}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4156-4165}, keywords = {Diamond, Irradiation, Carbon, Imaging}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2021/NA/D1NA00136A}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2516-0230}, DOI = {10.1039/d1na00136a}, stag_bib_extends_levelofaccess = {NA}, author = {Picollo, F. and Battiato, A. and Bosia, F. and Scaffidi Muta, F. and Olivero, P. and Rigato, V. and Rubanov, S.} } @Article { LanzaMCCSDGNKRCMBP2021, subid = {2392}, title = {Calibration of non-catching precipitation measurement instruments: A review}, journal = {Meteorological Applications}, year = {2021}, month = {5}, day = {25}, volume = {28}, number = {3}, number2 = {18NRM03: INCIPIT: Calibration and accuracy of non-catching instruments to measure liquid/solid atmospheric precipitation}, pages = {e2002}, keywords = {calibration, hydro-meteorology, meteomet, non-catching gauges, precipitation, precipitation measurement and analysis, uncertainty analysis, verification}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/met.2002}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {RMets}, language = {30}, ISSN = {14698080}, DOI = {10.1002/met.2002}, stag_bib_extends_levelofaccess = {NA}, author = {Lanza, L.G. and Merlone, A. and Cauteruccio, A. and Chinchella, E. and Stagnaro, M. and Dobre, M. and Garcia Izquierdo, M.C. and Nielsen, J. and Kjeldsen, H. and Roulet, Y.A. and Coppa, G. and Musacchio, C. and Bordianu, C. and Parrondo, M.} } @Proceedings { FahrbachPXB2021, subid = {2256}, title = {Self-excited Contact Resonance Operation of a Tactile Piezoresistive Cantilever Microprobe with Diamond Tip}, journal = {SMSI 2021 - Sensors and Instrumentation}, year = {2021}, month = {5}, volume = {A5 MEMS Se}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {73-74}, keywords = {MEMS, microprobe, thermal actuator, piezoresistive cantilever, contact resonance}, web_url = {https://www.ama-science.org/proceedings/details/3948}, misc2 = {EMPIR 2017: Industry}, publisher = {AMA Service GmbH, Von-M{\"u}nchhausen-Str. 49, 31515 Wunstorf, Germany}, event_place = {Digital}, event_name = {SMSI 2021 Conference – Sensor and Measurement Science International}, event_date = {03-05-2021 to 06-05-2021}, language = {30}, ISBN = {978-3-9819376-4-0}, DOI = {10.5162/SMSI2021/A5.4}, stag_bib_extends_levelofaccess = {NA}, author = {Fahrbach, M. and Peiner, E. and XU, M. and Brand, U.} } @Article { RebufelloPALVTGBCVDG2021, subid = {2447}, title = {Protective Measurement—A New Quantum Measurement Paradigm: Detailed Description of the First Realization}, journal = {Applied Sciences}, year = {2021}, month = {5}, volume = {11}, number = {9}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4260}, keywords = {Quantum Measurement, Weak Measurement, Quantum Metrology, Single Photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11094260}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and Avella, A. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { PeruzziRPEBu2021, subid = {2057}, title = {Survey of subrange inconsistency of long-stem standard platinum resistance thermometers}, journal = {Metrologia}, year = {2021}, month = {4}, day = {14}, volume = {58}, number = {3}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {035009}, keywords = {platinum resistance thermometers (SPRTs), statistical test, fixed-point uncertainty propagation (PoU)}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/abe8c1/pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol, United Kingdom}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abe8c1}, stag_bib_extends_levelofaccess = {NA}, author = {Peruzzi, A and Rusby, R L and Pearce, J V and Eusebio, L and Bojkovski, J and Žužek, V} } @Article { MoroshRNKiKPIMSBIKS2021, subid = {2017}, title = {Investigation into the performance of dose rate measurement instruments used in non-governmental networks}, journal = {Radiation Measurements}, year = {2021}, month = {4}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106580}, keywords = {Dosimetry networks.Dose rate meters.Environmental Radiation.Geiger counter.Metrological evaluation}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106580}, stag_bib_extends_levelofaccess = {NA}, author = {Morosh, V. and R{\"o}ttger, A. and Neumaier, S. and Krasniqi, F. and Živanović, M. and Kržanović, N. and Pantelić, G. and Iurlaro, G. and Mariotti, F. and Sperandio, L. and Bell, S. and Ioannidis, S. and Kelly, M. and Sangiorgi, M.} } @Article { JoBAFSWTDRGKPR2021, subid = {2125}, title = {Quantum Hall Valley Splitters and a Tunable Mach-Zehnder Interferometer in Graphene}, journal = {Physical Review Letters}, year = {2021}, month = {4}, volume = {126}, number = {14}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {146803}, keywords = {Graphene, electron interferometer, Mach-Zehnder, Quantum Hall Valley Beam Splitter}, web_url = {https://arxiv.org/abs/2011.04958}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.146803}, stag_bib_extends_levelofaccess = {NA}, author = {Jo, M. and Brasseur, P. and Assouline, A. and Fleury, G. and Sim, H-S. and Watanabe, K. and Taniguchi, T. and Dumnernpanich, W. and Roche, P. and Glattli, D.C. and Kumada, N. and Parmentier, F.D. and Roulleau, P.} } @Article { SzulcMCBG2021, subid = {2394}, title = {Nonreciprocal spin-wave dynamics in Pt/Co/W/Co/Pt multilayers}, journal = {Phys. Rev. B}, year = {2021}, month = {4}, volume = {103}, number = {13}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {134404}, keywords = {Spin Waves, Brillouin light scattering, interfacial Dzyaloshinskii-Moriya interaction}, web_url = {https://arxiv.org/abs/2112.11206}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.103.134404}, stag_bib_extends_levelofaccess = {NA}, author = { Szulc, K. and Mendisch, S. and Casoli, F. and Becherer, M. and Gubbiotti, G.} } @Article { ChaudharyMAOMPB2021, subid = {2656}, title = {Radiobiology Experiments With Ultra-high Dose Rate Laser-Driven Protons: Methodology and State-of-the-Art}, journal = {Frontiers in Physics}, year = {2021}, month = {4}, volume = {9}, number = {1}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {protontherapy, cancer, radiobiology, laser-driven ions, particle accelerator, ultra-high dose rate}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2021.624963}, stag_bib_extends_levelofaccess = {NA}, author = {Chaudhary, P. and Milluzzo, G. and Ahmed, H. and Odlozilik, B. and McMurray, A. and Prise, K.M. and Borghesi, M.} } @Article { GruberBALBPCPDTCFSQ2021, subid = {2028}, title = {Comparison of radon mapping methods for the delineation of radon priority areas – an exercise}, journal = {Journal of the European Radon Association}, year = {2021}, month = {3}, day = {31}, volume = {2}, number = {2021}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {1-14}, keywords = {radon, mapping, prediction, interpolation, radon priority areas, risk, hazard}, web_url = {https://radonjournal.net/index.php/radon/article/view/5755}, misc2 = {EMPIR 2016: Environment}, publisher = {European Radon Association}, language = {30}, ISSN = {2736-2272}, DOI = {10.35815/radon.v2.5755}, stag_bib_extends_levelofaccess = {NA}, author = {Gruber, V. and Baumann, S. and Alber, O. and Laubichler, C. and Bossew, P. and Petermann, E. and Ciotoli, G. and Pereira , A. and Domingos, F. and Tondeur, F. and Cinelli, G. and Fernandez , A. and Sainz, C. and Quindos-Poncela, L.} } @Article { BukerSLWPM2021, subid = {2188}, title = {A unique test facility for calibration of domestic flow meters under dynamic flow conditions}, journal = {Flow Measurement and Instrumentation}, year = {2021}, month = {3}, day = {29}, volume = {79}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {Test facility, Dynamic flow measurement, Domestic water meters, Calibration, Flow meter accuracy}, misc2 = {EMPIR 2017: Industry}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2021.101934}, stag_bib_extends_levelofaccess = {NA}, author = {B{\"u}ker, O. and Stolt, K. and Lindstr{\"o}m, K. and Wennergren, P. and Penttinen, O. and Mattiasson, K.} } @Article { deKromBZMBiGFKHE2021, subid = {2071}, title = {Comparability of calibration strategies for measuring mercury concentrations in gas emission sources and the atmosphere}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {3}, day = {25}, volume = {14}, number = {3}, number2 = {19NRM03: SI-Hg: Metrology for traceable protocols for elemental and oxidised mercury concentrations}, pages = {2317-2326}, keywords = {Mercury, Metrology, Calibration, SI-traceability, Environmental}, web_url = {https://amt.copernicus.org/articles/14/2317/2021/amt-14-2317-2021.html}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-2317-2021}, stag_bib_extends_levelofaccess = {NA}, author = {de Krom, I. and Bavius, W. and Ziel, R. and McGhee, E.A. and Brown, R.J.C. and Živković, I. and Gačnik, J. and Fajon, V. and Kotnik, J. and Horvat, M. and Ent, H.} } @Article { SchmidtGNBvZMBSHWR2021, subid = {2616}, title = {Bimodal behavior of microlasers investigated with a two-channel photon-number-resolving transition-edge sensor system}, journal = {Physical Review Research}, year = {2021}, month = {3}, day = {19}, volume = {3}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {013263}, keywords = {microlaser, transition-edge sensor, photon statistics, photon counting, nanophotonics}, web_url = {https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.3.013263}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.3.013263}, stag_bib_extends_levelofaccess = {NA}, author = {Schmidt, M. and Grothe, I.H. and Neumeier, S. and Bremer, L. and von Helversen, M. and Zent, W. and Melcher, B. and Beyer, J. and Schneider, C. and H{\"o}fling, S. and Wiersig, J. and Reitzenstein, S.} } @Article { EssBIMGV2021, subid = {2011}, title = {Optical and morphological properties of soot particles generated by the miniCAST 5201 BC generator}, journal = {Aerosol Science and Technology}, year = {2021}, month = {3}, day = {15}, number2 = {16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols}, pages = {1-25}, keywords = {soot, miniCAST, morphology, optical properties, calibration aerosol, combustion generator}, web_url = {https://www.tandfonline.com/doi/full/10.1080/02786826.2021.1901847}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, address = {London, United Kingdom}, language = {30}, ISSN = {0278-6826, 1521-7388}, DOI = {10.1080/02786826.2021.1901847}, stag_bib_extends_levelofaccess = {NA}, author = {Ess, M.N. and Bert{\`o}, M. and Irwin, M. and Modini, R.L. and Gysel-Beer, M. and Vasilatou, K.} } @Article { EichstadtGVSBK2021, subid = {2301}, title = {Toward Smart Traceability for Digital Sensors and the Industrial Internet of Things}, journal = {Sensors}, year = {2021}, month = {3}, day = {12}, volume = {21}, number = {6}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, pages = {2019}, keywords = {Internet of Things, calibration, measurement uncertainty, traceability, semantics, ontology, sensor network, digital sensors, redundancy}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21062019}, stag_bib_extends_levelofaccess = {NA}, author = {Eichst{\"a}dt, S. and Gruber, M. and Vedurmudi, A.P. and Seeger, B. and Bruns, T. and Kok, G.} } @Article { IurlaroBCBFKMMMNNSVWi2021, subid = {2018}, title = {Study on the uncertainty of passive area dosimetry systems for environmental radiation monitoring in the framework of the EMPIR “Preparedness” project}, journal = {Radiation Measurements}, year = {2021}, month = {3}, volume = {142}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106543}, keywords = {Passive dosimetry systems, Uncertainty budget, Decision threshold, Detection limitEnvironmental radiation monitoring, Emergency preparedness}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106543}, stag_bib_extends_levelofaccess = {NA}, author = {Iurlaro, G. and Baranowska, Z. and Campani, L. and Bjelac, O.C. and Ferrari, P. and Knežević, Ž. and Majer, M. and Mariotti, F. and Morelli, B. and Neumaier, S. and Nodilo, M. and Sperandio, L. and Vittoria, F.A. and Wołoszczuk, K. and Živanović, M.} } @Article { FailleauFBRHH2021, subid = {1993}, title = {Metal-carbon eutectic high temperature fixed points for in-situ calibration of radiation thermometers}, journal = {High Temperatures-High Pressures}, year = {2021}, month = {3}, volume = {50}, number = {2}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, pages = {149-165}, keywords = {Thermal Diffusivity, High Temperature, Radiation Thermometry, Fixed-Point}, web_url = {https://www.oldcitypublishing.com/journals/hthp-home/hthp-issue-contents/hthp-volume-50-number-2-2021/19302-2/}, misc2 = {EMPIR 2017: Industry}, publisher = {Old City Publishing}, language = {30}, ISSN = {1472-3441}, DOI = {10.32908/hthp.v50.1013}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Fleurence, N. and Beaumont, O. and Razouk, R. and Hameury, J. and Hay, B.} } @Article { RipaIGSGFBLDG2021, subid = {2645}, title = {Refractive index gas thermometry between 13.8 K and 161.4 K}, journal = {Metrologia}, year = {2021}, month = {3}, volume = {58}, number = {2}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {025008}, keywords = {refractive index gas thermometry, thermodynamic temperature, ITS-90,microwave resonator}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abe249}, stag_bib_extends_levelofaccess = {NA}, author = {Ripa, D.M. and Imbraguglio, D. and Gaiser, C. and Steur, P.P.M. and Giraudi, D. and Fogliati, M. and Bertinetti, M. and Lopardo, G. and Dematteis, R. and Gavioso, R.M.} } @Article { OkhapkinTSSBP2021, subid = {2227}, title = {The thorium-229 low-energy isomer and the nuclear clock}, journal = {Nature Reviews Physics}, year = {2021}, month = {2}, day = {25}, volume = {3}, number = {4}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {238-248}, keywords = {Atomic and molecular interactions with photonsExperimental nuclear physics}, web_url = {https://oar.ptb.de/resources/show/10.7795/120.20211006}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2522-5820}, DOI = {10.1038/s42254-021-00286-6}, stag_bib_extends_levelofaccess = {NA}, author = {Okhapkin, M.V. and Thielking, J. and Schumm, T. and Sikorsky, T. and Beeks, K. and Peik, E.} } @Article { XuLFPB2021, subid = {1914}, title = {Investigating the Trackability of Silicon Microprobes in High-Speed Surface Measurements}, journal = {Sensors}, year = {2021}, month = {2}, day = {24}, volume = {21}, number = {5}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {1557}, keywords = {roughness measurement, piezoresistive microprobe, high-speed surface measurement}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21051557}, stag_bib_extends_levelofaccess = {NA}, author = {XU, M. and Li, Z. and Fahrbach, M. and Peiner, E. and Brand, U.} } @Article { ZuccaCBSLCTFP2021, subid = {1918}, title = {Assessment of the Overall Efficiency in WPT Stations for Electric Vehicles}, journal = {Sustainability}, year = {2021}, month = {2}, day = {24}, volume = {13}, number = {5}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {2436}, keywords = {electric vehicles; inductive charging; measurement uncertainty; power system measurements}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2071-1050}, DOI = {10.3390/su13052436}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Cirimele, V. and Bruna, J. and Signorino, D. and Laporta, E. and Colussi, J. and Tejedor, M.A.A. and Fissore, F. and Pogliano, U.} } @Article { SeegerOCGSSOALGFGKB2021, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SeegerOCGSSOALGFGKB20210, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SeegerOCGSSOALGFGKB20211, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { WundrackMDSPMSSSSB2021, subid = {2491}, title = {Liquid metal intercalation of epitaxial graphene: Large-area gallenene layer fabrication through gallium self-propagation at ambient conditions}, journal = {Physical Review Materials}, year = {2021}, month = {2}, day = {19}, volume = {5}, number = {2}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {graphene, epitaxy, intercalation, 2-dimensional systems, condensed matter}, web_url = {https://arxiv.org/abs/1905.12438}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2475-9953}, DOI = {10.1103/PhysRevMaterials.5.024006}, stag_bib_extends_levelofaccess = {NA}, author = {Wundrack, S. and Momeni, D. and Dempwolf, W. and Schmidt, N. and Pierz, K. and Michaliszyn, L. and Spende, H. and Schmidt, A. and Schumacher, H.W. and Stosch, R. and Bakin, A.} } @Manual { BrunaRomeroPLHFCBAZZG2021, subid = {1907}, title = {Best practice guide for the assessment of EMF exposure from vehicle Wireless Power Transfer systems}, year = {2021}, month = {2}, day = {17}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, keywords = {Dosimetry, Guidelines, Magnetic field measurements, Magnetic field calculation, Numerical models, Uncertainty, Wireless Power Transfer, Electric Vehicle}, web_url = {https://www.micev.eu/theme/inrim/assets/doc/BPG_Micev_2021.pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {INRIM}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISBN: 978-88-945324-1-8}, author = {Bruna Romero, J. and Pichon, L. and Laporta, E. and Harmon, S. and Freschi, F. and Clarke, B. and Bottauscio, O. and Ankarson, P. and Zilberti, L. and Zucca, M. and Guilizzoni, R.} } @Article { FernandezScarioniBCSHALRCKS2021, subid = {2055}, title = {Thermoelectric Signature of Individual Skyrmions}, journal = {Physical Review Letters}, year = {2021}, month = {2}, day = {16}, volume = {126}, number = {7}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {1-6/077202}, keywords = {Magnetism, Nernst effect, Skyrmions, Thermomagnetic effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.077202}, stag_bib_extends_levelofaccess = {NA}, author = {Fern{\'a}ndez Scarioni, A. and Barton, C. and Corte-Le{\'o}n, H. and Sievers, S. and Hu, X. and Ajejas, F. and Legrand, W. and Reyren, N. and Cros, V. and Kazakova, O. and Schumacher, H.W.} } @Article { BenedictoOrenesMMW2021, subid = {2743}, title = {Criticality-enhanced quantum sensing in ferromagnetic Bose-Einstein condensates: Role of readout measurement and detection noise}, journal = {Physical Review A}, year = {2021}, month = {2}, day = {16}, volume = {103}, number = {2}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {BEC, Detection noise, quantum sensing}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2010.13133}, author = {Benedicto Orenes, D. and Mirkhalaf, S.S. and Mitchell, M.W. and Witkowska, E.} } @Article { BuonincontriKKMGCDCCMFMGSRZ2021, subid = {1697}, title = {Three dimensional MRF obtains highly repeatable and reproducible multi-parametric estimations in the healthy human brain at 1.5T and 3T}, journal = {NeuroImage}, year = {2021}, month = {2}, volume = {226}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, pages = {117573}, keywords = {MRI, Quantitation, Relaxometry, Brain, MR fingerprinting, Three dimensional, 3D}, web_url = {https://www.sciencedirect.com/science/article/pii/S1053811920310582?via\%3Dihub}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2020.117573}, stag_bib_extends_levelofaccess = {NA}, author = {Buonincontri, G. and Kurzawski, J.W. and Kaggie, J.D. and Matys, T. and Gallagher, F.A. and Cencini, M. and Donatelli, G. and Cecchi, P. and Cosottini, M. and Martini, N. and Frijia, F. and Montanaro, D. and G{\'o}mez, P.A. and Schulte, R.F. and Retico, A. and Zilberti, L.} } @Article { GarciaAsenjoBAG2021, subid = {1924}, title = {Development of a Submillimetric GNSS-Based Distance Meter for Length Metrology}, journal = {Sensors}, year = {2021}, month = {2}, volume = {21}, number = {4}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {1145}, keywords = {Global Navigation Satellite Systems (GNSS), length; metrology, multipath}, web_url = {https://www.mdpi.com/1424-8220/21/4/1145}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21041145}, stag_bib_extends_levelofaccess = {NA}, author = {Garc{\'i}a-Asenjo, L. and Baselga, S. and Atkins, C. and Garrigues, P.} } @Article { ModiniCBIBPFEHMLMG2021, subid = {2010}, title = {Detailed characterization of the CAPS single-scattering albedo monitor (CAPS PMssa) as a field-deployable instrument for measuring aerosol light absorption with the extinction-minus-scattering method}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {2}, volume = {14}, number = {2}, number2 = {16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols}, pages = {819-851}, keywords = {miniCAST 5201 black carbon (BC) generator; particle morphology; nanostructure; optical properties; photoacoustic absorption coefficient}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-819-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Modini, R.L. and Corbin, J.C. and Brem, B.T. and Irwin, M. and Bert{\`o}, M. and Pileci, R.E. and Fetfatzis, P. and Eleftheriadis, K. and Henzing, B. and Moerman, M.M. and Liu, F. and M{\"u}ller, T. and Gysel-Beer, M.} } @Article { LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021, subid = {2093}, title = {Roadmap on quantum nanotechnologies}, journal = {Nanotechnology}, year = {2021}, month = {2}, volume = {32}, number = {16}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {162003}, keywords = {Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/abb333}, stag_bib_extends_levelofaccess = {NA}, author = {Laucht, A. and Hohls, F. and Ubbelohde, N. and Fernando Gonzalez-Zalba, M. and Reilly, D.J. and Stobbe, S. and Schr{\"o}der, T. and Scarlino, P. and Koski, J.V. and Dzurak, A. and Yang, C-H. and Yoneda, J. and Kuemmeth, F. and Bluhm, H. and Pla, J. and Hill, C. and Salfi, J. and Oiwa, A. and Muhonen, J.T. and Verhagen, E. and LaHaye, M.D. and Kim, H.H. and Tsen, A.W. and Culcer, D. and Geresdi, A. and Mol, J.A. and Mohan, V. and Jain, P.K. and Baugh, J.} } @Article { KoutsourakisEKB2021, subid = {1948}, title = {High resolution linearity measurements of photovoltaic devices using digital light processing projection}, journal = {Measurement Science and Technology}, year = {2021}, month = {1}, day = {29}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {digital light processing projection}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abe162}, stag_bib_extends_levelofaccess = {NA}, author = {Koutsourakis, G. and Eales, T.D. and Kroeger, I. and Blakesley, J.} } @Article { ShalmZBSSMAAMAFOMNK2021, subid = {2736}, title = {Device-independent randomness expansion with entangled photons}, journal = {Nature Physics}, year = {2021}, month = {1}, day = {28}, volume = {17}, number = {4}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {452-456}, keywords = {Bell inequality test, Entangled photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1912.11158}, author = {Shalm, L.K. and Zhang, Y. and Bienfang, J.C. and Schlager, C. and Stevens, M.J. and Mazurek, M.D. and Abell{\'a}n, C. and Amaya, W. and Mitchell, M.W. and Alhejji, M.A. and Fu, H. and Ornstein, J. and Mirin, R.P. and Nam, S.W. and Knill, E.} } @Article { ArduinoZHZBCB2021, subid = {1867}, title = {Heating of hip joint implants in MRI: The combined effect of RF and switched‐gradient fields}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {1}, day = {22}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {gradient coil heating, hip prosthesis, MRI safety, numerical simulation, radiofrequency heating}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28666}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Zanovello, U. and Hand, J. and Zilberti, L. and Br{\"u}hl, R. and Chiampi, M. and Bottauscio, O.} } @Article { SeferiBMS2021, subid = {1934}, title = {A Novel Arc Detection Method for DC Railway Systems}, journal = {Energies}, year = {2021}, month = {1}, day = {15}, volume = {14}, number = {2}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {444}, keywords = {pantograph-catenary system; current collection quality; arc detection; predictive maintenance; railway electrical networks; Hilbert transform; rail transportation; power quality disturbance}, tags = {SEG}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1996-1073}, DOI = {10.3390/en14020444}, stag_bib_extends_levelofaccess = {NA}, author = {Seferi, Y. and Blair, S.M. and Mester, C. and Stewart, B.G.} } @Article { SteierDBTOCC2021, subid = {1871}, title = {Insights from Transient Absorption Spectroscopy into Electron Dynamics Along the Ga‐Gradient in Cu(In,Ga)Se2 Solar Cells}, journal = {Advanced Energy Materials}, year = {2021}, month = {1}, day = {14}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {2003446}, keywords = {CIGS, transient absorption spectroscopy}, misc2 = {EMPIR 2016: Energy}, publisher = {Wiley}, language = {30}, ISSN = {1614-6832, 1614-6840}, DOI = {10.1002/aenm.202003446}, stag_bib_extends_levelofaccess = {NA}, author = {Steier, L. and Durrant, J.R. and Bozal‐Ginesta, C. and Tiwari, A.N. and Ochoa, M. and Carron, R. and Chang, Y‐H.} } @Article { JenningerABBDGISJKRSSSTTW2021, subid = {1775}, title = {Development of a design for an ionisation vacuum gauge suitable as a reference standard}, journal = {Vacuum}, year = {2021}, month = {1}, volume = {183}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {109884}, keywords = {Ionisation gauge, Hot cathode, Sensitivity, Simulation, Reference standard}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109884}, stag_bib_extends_levelofaccess = {NA}, author = {Jenninger, B. and Anderson, J. and Bernien, M. and Bundaleski, N. and Dimitrova, H. and Granovskij, M. and Illgen, C. and Šetina, J. and Jousten, K. and Kucharski, P. and Reinhardt, C. and Scuderi, F. and Silva, R.A.S. and St{\"o}ltzel, A. and Teodoro, O.M.N.D. and Trzpil-Jurgielewicz, B. and W{\"u}est, M.} } @Article { BagherRENWMZDHBL2021, subid = {1796}, title = {Crosstalk between Mast Cells and Lung Fibroblasts Is Modified by Alveolar Extracellular Matrix and Influences Epithelial Migration}, journal = {International Journal of Molecular Sciences}, year = {2021}, month = {1}, volume = {22}, number = {2}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, pages = {506}, keywords = {lung fibroblasts, mast cells, epithelial cells, extracellular matrix, IL-6; tryptase, vascular endothelial growth factor, hepatocyte growth factor, idiopathic pulmonary fibrosis}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {1422-0067}, DOI = {10.3390/ijms22020506}, stag_bib_extends_levelofaccess = {NA}, author = {Bagher, M. and Rosmark, O. and Elowsson Rendin, L. and Nybom, A. and Wasserstrom, S. and M{\"u}ller, C. and Zhou, X-H. and Dellgren, G. and Hallgren, O. and Bjermer, L. and Larsson-Callerfelt, A-K.} } @Article { DorscherHSLBLSPL2021, subid = {1846}, title = {Optical frequency ratio of a 171Yb+ single-ion clock and a 87Sr lattice clock}, journal = {Metrologia}, year = {2021}, month = {1}, volume = {58}, number = {1}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {015005}, keywords = {optical clock, ion clock, ytterbium, optical lattice clock, strontium, optical clock comparison, frequency ratio}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abc86f}, stag_bib_extends_levelofaccess = {NA}, author = {D{\"o}rscher, S. and Huntemann, N. and Schwarz, R. and Lange, R. and Benkler, E. and Lipphardt, B. and Sterr, U. and Peik, E. and Lisdat, C.} } @Article { PiliaNLBDL2021, subid = {1965}, title = {ECGdeli - An open source ECG delineation toolbox for MATLAB}, journal = {SoftwareX}, year = {2021}, month = {1}, volume = {13}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {100639}, keywords = {ECG waveform boundary detectionECG delineation12 lead ECG processing}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2352-7110}, DOI = {10.1016/j.softx.2020.100639}, stag_bib_extends_levelofaccess = {NA}, author = {Pilia, N. and Nagel, C. and Lenis, G. and Becker, S. and D{\"o}ssel, O. and Loewe, A.} } @Article { BescondOFGQTLO2021, subid = {2140}, title = {Method for Preparation of a Candidate Reference Material of PM10 and PM2.5 Airborne Particulate Filters Loaded with Incineration Ash-Inter Comparison Results for Metal Concentrations}, journal = {Atmosphere}, year = {2021}, month = {1}, volume = {12}, number = {1}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {67}, keywords = {aerosol; ambient air; EU air quality directives; ICP-MS intercomparison; incineration ash; particulate matter (PM); PM10; PM2.5; heavy metal analysis}, web_url = {https://www.mdpi.com/2073-4433/12/1/67}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4433}, DOI = {10.3390/atmos12010067}, stag_bib_extends_levelofaccess = {NA}, author = {Bescond, A. and Oster, C. and Fisicaro, P. and Goddard, S. and Quincey, P. and Tsakanika, L-A. and Lymperopoulou, T. and Ochsenkuehn-Petropoulou, M.} } @Inbook { BELLGAABSIDPSVRIWPNKSD2021, subid = {2552}, title = {A NEW EUROPEAN RADIATION PROTECTION NETWORK DEVELOPED BY THE SUPPORT BSS JOINT NETWORK PROJECT}, year = {2021}, month = {1}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {radiation protection, metrology, national regulation, European regulation, supportBSS, ENM for Radiation Protection}, web_url = {https://vinar.vin.bg.ac.rs/bitstream/handle/123456789/10125/309-314.pdf}, misc2 = {EMPIR 2019: Support for Networks}, booktitle = {RADIATION PROTECTION SOCIETY OF SERBIA AND MONTENEGRO, PROCEEDINGS, XXXI SYMPOSIUM RPSSM, 2021}, language = {30}, ISBN = {78-86-7306-161-0}, stag_bib_extends_levelofaccess = {NA}, author = {Bell, S. and Glavič-Cindro, D. and ALVES, J. and Adam-Guillermin, C. and Bernat, R. and Sabeta, A. and Ioan, M-R. and DERLACINSKI, M. and Pinto, M. and Sochor, V. and Veres, A. and R{\"O}TTGER, .A. and Živanović, M. and Wens, B. and Persson, L. and Nylund, R. and Kržanović, N. and STANKOVIĆ, S. and DIMOVIĆ, S.} } @Article { KrehlikSBSK2021, subid = {1850}, title = {Optical multiplexing of metrological time and frequency signals in a single 100 GHz-grid optical channel}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2021}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, keywords = {Time and frequency transfer, fiber optics, optical interleavers, wavelength multiplexing, Optical fibers, Optical filters, Optical variables control, Optical fiber networks, Ultrafast optics, Optical reflection, Time-frequency analysis}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010, 1525-8955}, DOI = {10.1109/TUFFC.2021.3053430}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Buczek, L. and Schnatz, H. and Kronj{\"a}ger, J.} } @Article { BehrEBGHKKLPPS2020, subid = {1857}, title = {A four-terminal-pair Josephson impedance bridge combined with a graphene quantized Hall resistance}, journal = {Measurement Science and Technology}, year = {2021}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, keywords = {impedance measurement,quantized Hall resistor,coaxial impedance bridge,graphene,Josephson arbitrary waveform synthesizer}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/abcff3/pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abcff3}, stag_bib_extends_levelofaccess = {NA}, author = {Bauer, S. and Elmquist, R. and Behr, R. and Goetz, M. and Herick, J. and Kieler, O.F. and Kruskopf, M. and Lee, J. and Palafox, L. and Pimsut, Y. and Schurr, J.} } @Article { LovenDBKTRWI2021, subid = {1897}, title = {Toxicological effects of zinc oxide nanoparticle exposure: an in vitro comparison between dry aerosol air-liquid interface and submerged exposure systems}, journal = {Nanotoxicology}, year = {2021}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, keywords = {Air-liquid interface; NACIVT, aerosol, cell response, toxicity}, web_url = {https://www.tandfonline.com/doi/full/10.1080/17435390.2021.1884301}, misc2 = {EMPIR 2018: Health}, language = {30}, DOI = {10.1080/17435390.2021.1884301}, stag_bib_extends_levelofaccess = {NA}, author = {Lov{\'e}n , K. and Dobric, J. and B{\"o}l{\"u}kbas, D.A. and K{\aa}redal, M. and Tas, S. and Rissler, J. and Wagner, D.E. and Isaxon, C. } } @Article { LagouanelleBPZ2021, subid = {1923}, title = {Impact of parameters variability on the level of human exposure due to inductive power transfer}, journal = {IEEE Transactions on Magnetics}, year = {2021}, volume = {Early Acce}, number = {ea}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-4}, keywords = {Inductive power transfer, stochastic methods, human exposure}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=9364997}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9464, 1941-0069}, DOI = {10.1109/TMAG.2021.3062702}, stag_bib_extends_levelofaccess = {NA}, author = {Lagouanelle, P. and Bottauscio, O. and Pichon, L. and Zucca, M.} } @Article { MagniBSSMKSLGKLO2021, subid = {2136}, title = {Spin Hall magnetoresistance and spin orbit torque efficiency in Pt/FeCoB bilayers}, journal = {IEEE Transactions on Magnetics}, year = {2021}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {1-1}, keywords = {spin Hall magnetoresistance, spin Hall effect, spin orbit torque, FeCoB, Pt}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9464, 1941-0069}, DOI = {10.1109/TMAG.2021.3084866}, stag_bib_extends_levelofaccess = {NA}, author = {Magni, A. and Basso, V. and Sola, A. and Soares, G. and Meggiato, N. and Kuepferling, M. and Skowronski, W. and Lazarski, S. and Grochot, K. and Khanjani, M.V. and Langer, J. and Ocker, B.} } @Article { FergusonFLBHPR2021, subid = {2378}, title = {Metrology and Standardization of High Speed Pluggable Optical Interconnects}, journal = {Proceedings of the 9th International Conference on Photonics, Optics and Laser Technology}, year = {2021}, volume = {PHOTOPTICS}, number = {PHOTOPTICS}, number2 = {19SIP05: TTPWC: Technology Transfer of Photonic Waveguide Characterisation}, pages = {63-67}, keywords = {Electro Optical Circuit Board (EOCB), Polymer Waveguides, Attenuation, Encircled Flux, BER.}, web_url = {https://zenodo.org/record/5777190}, misc2 = {EMPIR 2019: Support for Impact}, publisher = {SCITEPRESS - Science and Technology Publications}, language = {30}, ISSN = {2184-4364}, DOI = {10.5220/0010171900630067}, stag_bib_extends_levelofaccess = {NA}, author = {Ferguson, R. and Fatadin, I. and Liu, K-M. and Barbeito, I. and Hart, C. and Pitwon, R. and Robinson, D.} } @Proceedings { KhanbabaeeRBRFHZTLdBGGCA2021, subid = {2377}, title = {SUPPORT FOR A EUROPEAN METROLOGY NETWORK ON RELIABLE RADIATION PROTECTION: GAPS IN RADIATION PROTECTION AND RELATED METROLOGY}, journal = {RAD Conference Proceedings}, year = {2021}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {Activity standards, new operational quantities in radiation protection, type testing, calibration, radon,reference field, pulsed radiation, dosimetry, standards, radiological emergency response}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {RAD Centre}, event_place = {Herceg Novi, Montenegro}, event_name = {9th international conference on Radiation in various fields of research}, event_date = {14-06-2021 to 18-06-2021}, language = {30}, DOI = {10.21175/RadProc.2021.04}, stag_bib_extends_levelofaccess = {NA}, author = {Khanbabaee, B. and R{\"o}ttger, A. and Behrens, R. and R{\"o}ttger, S. and Feige, S. and Hupe, O. and Zutz, H. and Toroi, P. and Leonard, P. and de la Fuente Rosales, L. and Burgess, P. and Gressier, V. and Guti{\'e}rrez Villanueva, J–L. and Cruz Su{\'a}rez, R. and Arnold, D.} } @Article { RehbehnRBBSKMGMSC2021, subid = {2408}, title = {Sensitivity to new physics of isotope-shift studies using the coronal lines of highly charged calcium ions}, journal = {Physical Review A}, year = {2021}, volume = {103}, number = {4}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {L040801}, keywords = {research areas, dark matter, electronic transitions, particle interactions, techniques, spectroscopy, nuclear physics, atomic, molecular and optical}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {ISSN 2469-9934 (online), 2469-}, DOI = {10.1103/PhysRevA.103.L040801}, stag_bib_extends_levelofaccess = {NA}, author = {Rehbehn, N-H. and Rosner, M.K. and Bekker, H. and Berengut, J.C. and Schmidt, P.O. and King, S.A. and Micke, P. and Gu, M.F. and M{\"u}ller, R. and Surzhykov, A. and Crespo L{\'o}pez-Urrutia, J.R.} } @Article { StarkWBCDKRGNOSSLSKLMSPC2021, subid = {2407}, title = {An ultralow-noise superconducting radio-frequency ion trap for frequency metrology with highly charged ions}, journal = {AIP Review of Scientific Instruments}, year = {2021}, volume = {92}, number = {8}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {083203}, keywords = {Radio frequency cavities, radio-frequency quadrupole}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1063/5.0046569}, stag_bib_extends_levelofaccess = {NA}, author = {Stark, J. and Warnecke, C. and Bogen, S. and Chen, S. and Dijck, E.A. and K{\"u}hn, S. and Rosner, M. K. and Graf, A. and Nauta, J. and Oelmann, J-H. and Schm{\"o}ger, L. and Schwarz, M. and Liebert, D. and Spie{\ss}, L.J. and King, S.A. and Leopold, T. and Micke, P. and Schmidt, P.O. and Pfeifer, T. and Crespo L{\'o}pez-Urrutia, J.R.} } @Article { BernienGIDKBJ2021, subid = {2648}, title = {Traceable low-current measurements for a novel ionization gauge suitable as reference standard}, journal = {Measurement: Sensors}, year = {2021}, volume = {18}, number = {December 2}, number2 = {20SIP01: ISO Gauge: Developing an ISO Technical Specification ''Characteristics for a stable ionisation vacuum gauge''}, pages = {100202}, keywords = {Ionization vacuum gaugeSensitivityLow currentTraceable measurementsMetrology}, misc2 = {EMPIR 2020: Support for Impact}, publisher = {Elsevier Ltd}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100202}, stag_bib_extends_levelofaccess = {NA}, author = {Bernien, M. and G{\"o}tz, M. and Illgen, C. and Drung, D. and Krause, C. and Bock, T. and Jousten, K.} } @Article { VicarJJIBJBBST2021, subid = {2647}, title = {Electrons on a straight path: A novel ionisation vacuum gauge suitable as reference standard}, journal = {VACUUM}, year = {2021}, volume = {189}, number = {2021}, number2 = {20SIP01: ISO Gauge: Developing an ISO Technical Specification ''Characteristics for a stable ionisation vacuum gauge''}, pages = {110239}, keywords = {Ionisation vacuum gaugeHot cathodeSensitivitySecondary electronsIon induced secondary electron yield}, web_url = {https://arxiv.org/abs/2103.03566}, misc2 = {EMPIR 2020: Support for Impact}, publisher = {Elsevier Ltd}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2021.110239}, stag_bib_extends_levelofaccess = {NA}, author = {Vicar, M. and J{\"o}nnson, G. and Jenninger, B. and Illgen, C. and Bundaleski, N. and Jousten, K. and Boineau, F. and Bernien, M. and Šetina, J. and Teodoro, O.} } @Proceedings { GogyanKBZ2021, subid = {2747}, title = {Theoretical Investigation of Superradiant Lasing in 2-or 3-Level Atoms in an Optical Lattice}, journal = {2021 JOINT CONFERENCE OF THE EUROPEAN FREQUENCY AND TIME FORUM AND IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM}, year = {2021}, volume = {1}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {superradiance 2-3 level atoms}, misc2 = {EMPIR 2017: Fundamental}, event_place = {on line}, event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {09-07-2022 to 14-07-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip}, author = {Gogyan, A. and Kazakov, G. and Bober, M. and Zawada, M.} } @Proceedings { SinghTNMKGBBWZ2021, subid = {2732}, title = {Towards a Continuous Active Optical Atomic Clock With Cold Strontium Atoms}, journal = {2021 JOINT CONFERENCE OF THE EUROPEAN FREQUENCY AND TIME FORUM AND IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM (IEEE EFTF-IFCS 2021)}, year = {2021}, volume = {1}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Contiunous clock,}, web_url = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip}, misc2 = {EMPIR 2017: Fundamental}, event_place = {on line}, event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {09-07-2021 to 14-07-2021}, language = {30}, ISBN = {978-1-6654-3935-0}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {2327-1914}, author = {Singh, V. and Tonoyan, A. and Naroznik, M. and Morzyński, P. and Kovacic, D. and Gogyan, A. and Bilicki, S. and Bober, M. and Witkowski, M. and Zawada, M.} } @Proceedings { ClivatiRRTBCL2021, subid = {2740}, title = {INRIM Sr Optical Clock: An Optically Loaded Apparatus for High-Stability Metrology}, journal = {Proceedings EFTF 2021}, year = {2021}, volume = {1}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {OLC, Sr, 2D-MOT}, misc2 = {EMPIR 2017: Fundamental}, event_place = {on line}, event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {07-07-2022 to 16-07-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip}, author = {Clivati, C. and Risaro, M. and Rullo, F. and Tarallo, M.G. and Barbiero, M. and Calonico, D. and Levi, F.} } @Proceedings { ClivatiRRTBCL2021_2, subid = {2740}, title = {INRIM Sr Optical Clock: An Optically Loaded Apparatus for High-Stability Metrology}, journal = {Proceedings EFTF 2021}, year = {2021}, volume = {1}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {OLC, Sr, 2D-MOT}, misc2 = {EMPIR 2017: Fundamental}, event_place = {on line}, event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {07-07-2022 to 16-07-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip}, author = {Clivati, C. and Risaro, M. and Rullo, F. and Tarallo, M.G. and Barbiero, M. and Calonico, D. and Levi, F.} } @Article { ForssenSSJBHAZ2020, subid = {1786}, title = {A transportable refractometer for assessment of pressure in the kPa range with ppm level precision}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {287-292}, keywords = {Refractometry; Pressure; Gas Modulation, GAMOR; Transportable}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-59}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.986}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Szabo, D. and J{\"o}nsson, G. and Bjerling, M. and Hausmaninger, T. and Axner, O. and Zelan, M.} } @Article { SilvestriBOW2020, subid = {1831}, title = {Towards an improved helium-based refractometer for pressure measurements}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {305}, keywords = {refractometry, Fabry-Perot, pressure measurement, quantum pascal}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-62}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.989}, stag_bib_extends_levelofaccess = {NA}, author = {Silvestri, Z. and Bentouati, D. and Otal, P. and Wallerand, J-P.} } @Proceedings { FurtadoPQSLMAARLBCLA2020, subid = {1898}, title = {First density comparison on viscoelastic samples by oscillation-type densimetry}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements}, pages = {79}, keywords = {EMPIR rhoLiq Project; oscillation-type density meter; viscoelasticity; comparison}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IMEKO International Measurement Confederation}, event_place = {-}, event_name = {IMEKO TC3, TC5, TC16 and TC2}, event_date = {16-11-2020 to 18-11-2020}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.943}, stag_bib_extends_levelofaccess = {NA}, author = {Furtado, A. and Pereira, J. and Quendera, R. and Schiebl, M. and Lenard, E. and Malejczyk, E. and Alic, A. and Alisic, S. and Rauch, J. and Lorenz, F. and Bescupschii, A. and Ciubara, A. and Laky, B. and Ams{\"u}ss, R.} } @Article { ChouhanJHBGSBH2020, subid = {2033}, title = {Emerging tri‐s‐triazine‐based graphitic carbon nitride: A potential signal‐transducing nanostructured material for sensor applications}, journal = {Nano Select}, year = {2020}, month = {12}, day = {30}, volume = {2}, number = {4}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {712-743}, keywords = {sorbent traps, tri‐s‐triazine‐based graphitic carbon nitride, nanostructured material, sonsors, mercury}, misc2 = {EMPIR 2016: Environment}, publisher = {Wiley}, language = {30}, ISSN = {2688-4011, 2688-4011}, DOI = {10.1002/nano.202000228}, stag_bib_extends_levelofaccess = {NA}, author = {Chouhan, R.S. and Jerman, I. and Heath, D. and Bohm, S. and Gandhi, S. and Sadhu, V. and Baker, S. and Horvat, M.} } @Article { NaccaratoTMMMZPAPNMWSMMSBPSW2020, subid = {2035}, title = {A field intercomparison of three passive air samplers for gaseous mercury in ambient air}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {12}, day = {29}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {atmnospheric gaseous mercury, passive samplers, intercomparison}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, DOI = {10.5194/amt-2020-455}, stag_bib_extends_levelofaccess = {NA}, author = {Naccarato, A. and Tassone, A. and Martino, M. and Moretti, S. and Macagnano, A. and Zampetti, E. and Papa, P. and Avossa, J. and Pirrone, N. and Nerentorp, M. and Munthe, J. and W{\"a}ngberg, I. and Stupple, G.W. and Mitchell, C.P.J. and Martin, A.R. and Steffen, A. and Babi, D. and Prestbo, E.M. and Sprovieri, F. and Wania, F.} } @Article { YrjanaSIKLB2020, subid = {2182}, title = {Potentiometric Carboxylate Sensors Based on Carbazole-Derived Acyclic and Macrocyclic Ionophores}, journal = {Chemosensors}, year = {2020}, month = {12}, day = {24}, volume = {9}, number = {1}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {4}, keywords = {ion-selective electrodesanion receptorsionophorescarboxylateelectrode shell material}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-9040}, DOI = {10.3390/chemosensors9010004}, stag_bib_extends_levelofaccess = {NA}, author = {Yrj{\"a}n{\"a}, V. and Saar, I. and Ilisson, M. and Kadam, S.A. and Leito, I. and Bobacka, J.} } @Article { DrAmatoVMBMBM2020, subid = {1874}, title = {Spectroscopic Techniques versus Pitot Tube for the Measurement of Flow Velocity in Narrow Ducts}, journal = {Sensors}, year = {2020}, month = {12}, day = {21}, volume = {20}, number = {24}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, pages = {7349}, keywords = {laser flow meter; Pitot tube; flow speed; time of flight; dilution method; flow simulation; flow turbulence; gas sensing applications}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20247349}, stag_bib_extends_levelofaccess = {NA}, author = {D’Amato, F. and Viciani, S. and Montori, A. and Barucci, M. and Morreale, C. and Bertagna, S. and Migliavacca , G.} } @Article { BowdenVHSH2020, subid = {2729}, title = {Improving the Q Factor of an Optical Atomic Clock Using Quantum Nondemolition Measurement}, journal = {Physical Review X}, year = {2020}, month = {12}, day = {15}, volume = {10}, number = {4}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Atomic and Molecular Physics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2160-3308}, DOI = {10.1103/PhysRevX.10.041052}, stag_bib_extends_levelofaccess = {NA}, author = {Bowden, W. and Vianello, A. and Hill, I.R. and Schioppo, M. and Hobson, R.} } @Article { OlbrichSBSOS2020, subid = {1677}, title = {Identification of coherent structures in horizontal slug flow}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {12}, volume = {76}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {101814}, keywords = {Slug flow, Coherent structures, Snapshot POD}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101814}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and Schmeyer, E. and B{\"a}r, M. and Sieber, M. and Oberleithner, K. and Schmetler, S.} } @Article { DitaliaTchernijLCSPTBCPPDMAOSMGF2020, subid = {1730}, title = {Fluorine-based color centers in diamond}, journal = {Scientific Reports}, year = {2020}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {21537}, keywords = {Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-78436-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Corte, E. and Sardi, F. and Picollo, F. and Traina, P. and Brajković, M. and Crnjac, A. and Pezzagna, S. and Pastuović, Ž. and Degiovanni, I.P. and Moreva, E. and Apr{\`a}, P. and Olivero, P. and Siketić, Z. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { SchmelterKOFB2020, subid = {1764}, title = {On the influence of inlet perturbations on slug dynamics in horizontal multiphase flow – a computational study}, journal = {Metrologia}, year = {2020}, month = {12}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, keywords = {multiphase flow, two-phase flow, gas-liquid flow, slug flow, computational fluid dynamics (CFD), inlet perturbation, random perturbation}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abd1c9}, stag_bib_extends_levelofaccess = {NA}, author = {Schmelter, S. and Knotek, S. and Olbrich, M. and Fiebach, A. and Baer, M.} } @Article { DitaliaTchernijLCSPTBCPPDMAOSMGF2020_2, subid = {1806}, title = {Fluorine-based color centers in diamond}, journal = {Scientific Reports}, year = {2020}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-78436-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Corte, E. and Sardi, F. and Picollo, F. and Traina, P. and Brajković, M. and Crnjac, A. and Pezzagna, S. and Pastuović, Ž. and Degiovanni, I.P. and Moreva, E. and Apr{\`a}, P. and Olivero, P. and Siketić, Z. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { BukerSdMM2020, subid = {1822}, title = {Investigations on pressure dependence of Coriolis Mass Flow Meters used at Hydrogen Refueling Stations}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {12}, volume = {76}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {101815}, keywords = {Hydrogen, Coriolis Mass Flow Meter, Flow metering, High pressure, Hydrogen Refueling Station}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101815}, stag_bib_extends_levelofaccess = {NA}, author = {B{\"u}ker, O. and Stolt, K. and de Huu, M. and MacDonald, M. and Maury, R.} } @Article { SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020, subid = {1841}, title = {The European Joint Research Project UHDpulse – Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, journal = {Physica Medica}, year = {2020}, month = {12}, volume = {80}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {134-150}, keywords = {Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2020.09.020}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}ller, A. and Heinrich, S. and Fouillade, C. and Subiel, A. and De Marzi, L. and Romano, F. and Peier, P. and Trachsel, M. and Fleta, C. and Kranzer, R. and Caresana, M. and Salvador, S. and Busold, S. and Sch{\"o}nfeld, A. and McEwen, M. and Gomez, F. and Solc, J. and Bailat, C. and Linhart, V. and Jakubek, J. and Pawelke, J. and Borghesi, M. and Kapsch, R-P. and Knyziak, A. and Boso, A. and Olsovcova, V. and Kottler, C. and Poppinga, D. and Ambrozova, I. and Schmitzer, C-S. and Rossomme, S. and Vozenin, M-C.} } @Article { HancockDBLBTDBHBM2020, subid = {1894}, title = {Arbitrarily large tomography with iterative algorithms on multiple GPUs using the TIGRE toolbox}, journal = {Journal of Parallel and Distributed Computing}, year = {2020}, month = {12}, volume = {146}, number = {1}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {52-63}, keywords = {Computed TomographyIterative reconstructionSoftwaremulti-GPU}, web_url = {https://arxiv.org/abs/1905.03748}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0743-7315}, DOI = {10.1016/j.jpdc.2020.07.004}, stag_bib_extends_levelofaccess = {NA}, author = {Hancock, S. and Dosanjh, M. and Biguri, A. and Lindroos, R. and Bryll, R. and Towsyfyan, H. and Deyhle, H. and Blumensath, T. and Harrane, I.E.K. and Boardman, R. and Mavrogordato, M.} } @Inbook { IoanRZTB2020, subid = {2624}, title = {Proiecte nationale si europene de metrologia radiatiilor, suport pentru implementarea Directivei 2013/59, in sanatate si protectia mediului}, year = {2020}, month = {12}, number2 = {19ENV02: RemoteALPHA: Remote and real-time optical detection of alpha-emitting radionuclides in the environment}, keywords = {Remote detection, optical detection, alpha particles}, web_url = {https://srrp.ro/wp-content/uploads/2020/12/Conf.Nat_._SRRp_-2020-A4-ver.12.pdf}, misc2 = {EMPIR 2019: Environment}, booktitle = {Conferinta Nationala Aniversara a Societatii Romane de Radioprotectie –„SRRp-30”}, language = {30}, ISBN = {978-973-1985-64-0}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {978-973-1985-64-0}, author = {Ioan, M-R. and Radulescu, I. and Zadehrafi, M. and Tugulan, L. and Barna, C.} } @Article { KrauseBNLS2020, subid = {2733}, title = {Simple and compact diode laser system stabilized to Doppler-broadened iodine lines at 633  nm}, journal = {Applied Optics}, year = {2020}, month = {11}, day = {30}, volume = {59}, number = {34}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {10808}, keywords = {Iodine cell, laser system}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1559-128X, 2155-3165}, DOI = {10.1364/AO.409308}, stag_bib_extends_levelofaccess = {NA}, author = {Krause, F. and Benkler, E. and N{\"o}lleke, C. and Leisching, P. and Sterr, U.} } @Article { LopezMPSGBSCDK2020, subid = {1731}, title = {A study to develop a robust method for measuring the detection efficiency of free-running InGaAs/InP single-photon detectors}, journal = {EPJ Quantum Technology}, year = {2020}, month = {11}, day = {25}, volume = {7}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {14}, keywords = {Quantum technologyQuantum radiometryDetection efficiencySingle-photon detectorsSingle-photon sourcesMetrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2662-4400, 2196-0763}, DOI = {10.1140/epjqt/s40507-020-00089-1}, stag_bib_extends_levelofaccess = {NA}, author = {L{\'o}pez, M. and Meda, A. and Porrovecchio, G. and Starkwood, R.A. and Genovese, M. and Brida, G. and Smid, M. and Chunnilall, C.J. and Degiovanni, I.P. and K{\"u}ck, S.} } @Article { BuarMSPSi2020, subid = {1830}, title = {Statistics of a Sharp GP2Y Low-Cost Aerosol PM Sensor Output Signals}, journal = {Sensors}, year = {2020}, month = {11}, day = {24}, volume = {20}, number = {23}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {6707}, keywords = {low-cost sensors; aerosol sensors; air quality sensors}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20236707}, stag_bib_extends_levelofaccess = {NA}, author = {Bučar, K. and Malet, J. and Stabile, L. and Pražnikar, J. and Seeger, S. and Žitnik, M.} } @Article { BuarMSPSi20200, subid = {1830}, title = {Statistics of a Sharp GP2Y Low-Cost Aerosol PM Sensor Output Signals}, journal = {Sensors}, year = {2020}, month = {11}, day = {24}, volume = {20}, number = {23}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {6707}, keywords = {low-cost sensors; aerosol sensors; air quality sensors}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20236707}, stag_bib_extends_levelofaccess = {NA}, author = {Bučar, K. and Malet, J. and Stabile, L. and Pražnikar, J. and Seeger, S. and Žitnik, M.} } @Article { BarreQSDBTESdA2020, subid = {2036}, title = {Comparison of the Isotopic Composition of Hg and Pb in Two Atmospheric Bioaccumulators in a Pyrenean Beech Forest (Iraty Forest, Western Pyrenees, France/Spain)}, journal = {Frontiers in Environmental Chemistry}, year = {2020}, month = {11}, day = {23}, volume = {1}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {isotopic composition, mercury, biomonitoring}, misc2 = {EMPIR 2016: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-4486}, DOI = {10.3389/fenvc.2020.582001}, stag_bib_extends_levelofaccess = {NA}, author = {Barre, J.P.G. and Queipo-Abad, S. and Sola-Larra{\~n}aga, C. and Deletraz, G. and B{\'e}rail, S. and Tessier, E. and Elustondo Valencia, D. and Santamar{\'i}a, J.M. and de Diego, A. and Amouroux, D.} } @Article { FinizioWMHLBBMR2020, subid = {2380}, title = {Time-resolved visualization of the magnetization canting induced by field-like spin–orbit torques}, journal = {Applied Physics Letters}, year = {2020}, month = {11}, day = {23}, volume = {117}, number = {21}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {212404}, keywords = {X-ray microscopy, Ferromagnetic materials, Time resolved imaging, Spin-orbit interactions, Spin Hall effect}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0029816}, stag_bib_extends_levelofaccess = {NA}, author = {Finizio, S. and Wintz, S. and Mayr, S. and Huxtable, A.J. and Langer, M. and Bailey, J. and Burnell, G. and Marrows, C.H. and Raabe, J.} } @Article { SachsePVSRBBHKSKH2020, subid = {1704}, title = {Assessing Optical and Electrical Properties of Highly Active IrOx Catalysts for the Electrochemical Oxygen Evolution Reaction via Spectroscopic Ellipsometry}, journal = {ACS Catalysis}, year = {2020}, month = {11}, day = {20}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {14210-14223}, keywords = {spectroscopic ellipsometry, electrocatalysis, oxygen evolution reaction, mesoporous iridium oxidefilms, non-destructive ambient analysis, intrinsic OER activity, complementary methodology and metrology}, misc2 = {EMPIR 2016: Energy}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2155-5435, 2155-5435}, DOI = {10.1021/acscatal.0c03800}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Pfl{\"u}ger, M. and Velasco-V{\'e}lez, J-J. and Sahre, M. and Radnik, J. and Bernicke, M. and Bernsmeier, D. and Hodoroaba, V-D. and Krumrey, M. and Strasser, P. and Kraehnert, R. and Hertwig, A.} } @Article { LodewyckLPBKK2020, subid = {1834}, title = {Universal formalism for data sharing and processing in clock comparison networks}, journal = {Physical Review Research}, year = {2020}, month = {11}, day = {20}, volume = {2}, number = {4}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {043269}, keywords = {atomic clocks, frequency comparison, frequency combs}, web_url = {https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.2.043269}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.2.043269}, stag_bib_extends_levelofaccess = {NA}, author = {Lodewyck, J. and Le Targat, R. and Pottie, P-E. and Benkler, E. and Koke, S. and Kronj{\"a}ger, J.} } @Article { AqeelSTMMBBGPB2020, subid = {2388}, title = {Microwave Spectroscopy of the Low-Temperature Skyrmion State in Cu2OSeO3}, journal = {Physical Review Letters}, year = {2020}, month = {11}, day = {17}, volume = {126}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {017202-1 - 017202-7}, keywords = {Lattice dynamics, Magnetic order, Magnetism, Magnetization dynamics, Skyrmions, Spin waves}, web_url = {https://arxiv.org/abs/2011.07826}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.126.017202}, stag_bib_extends_levelofaccess = {NA}, author = {Aqeel, A. and Sahliger, J. and Taniguchi, T. and M{\"a}ndl, S. and Mettus, D. and Berger, H. and Bauer, A. and Garst, M. and Pfleiderer, C. and Back, C.H.} } @Article { KokurewiczSBSKHMKJ2020, subid = {1842}, title = {Dosimetry for New Radiation Therapy Approaches Using High Energy Electron Accelerators}, journal = {Frontiers in Physics}, year = {2020}, month = {11}, day = {13}, volume = {8}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {Dosimetry, FLASH beams, Absorbed dose, ultra-high pulse dose rates, High Energy Electron Accelerators}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2020.568302}, stag_bib_extends_levelofaccess = {NA}, author = {Kokurewicz, K. and Sch{\"u}ller, A. and Brunetti, E. and Subiel, A. and Kranzer, R. and Hackel, T. and Meier, M. and Kapsch, R-P. and Jaroszynsk, D.A.} } @Article { HeeringBS2020, subid = {1699}, title = {Glass electrode half-cells for measuring unified pH in ethanol–water mixtures}, journal = {Journal of Sensors and Sensor Systems}, year = {2020}, month = {11}, day = {11}, volume = {9}, number = {2}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {383-389}, keywords = {unified pH, pHabs, water-ethanol mixtures, glass electrode half-cells, ionic liquid, [N2225][NTf2]}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-9-383-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, A. and Bastkowski, F. and Seitz, S.} } @Article { FerreroBCPPPSSVM2020, subid = {1740}, title = {An insight into the present capabilities of national metrology institutes for measuring sparkle}, journal = {Metrologia}, year = {2020}, month = {11}, day = {11}, volume = {57}, number = {6}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {065029}, keywords = {sparkle, texture, reflectance, contrast threshold, gonio-spectrophotometry}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abb0a3}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Basic, N. and Campos, J. and Pastuschek, M. and Perales, E. and Porrovecchio, G. and Smid, M. and Schirmacher, A. and Vel{\'a}zquez, J.L. and Mart{\'i}nez-Verd{\'u}, F.} } @Proceedings { MeisnerGSHSEGRMLBOGS2020, subid = {1922}, title = {Support for standardisation of high voltage testing with composite and combined wave shapes}, journal = {VDE High Voltage Technology 2020, ETG-Symposium}, year = {2020}, month = {11}, day = {11}, number2 = {19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes}, keywords = {Electricity grids, high voltage testing, traceability, combined wave shapes, composite wave shapes, universal dividers, calibration}, tags = {SEG}, web_url = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {VDE}, event_place = {online}, event_name = {VDE High Voltage Technology 2020}, event_date = {09-11-2020 to 11-11-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215}, author = {Meisner, J. and Gockenbach, E. and Saadeddine, H. and Havunen, J. and Schichler, U. and Elg, A-P. and Garnacho, F. and Roccato, P.E. and Merev, A. and Lahti, K. and Backhaus, K. and Orrea, A. and Gamlin, M. and Steiner, T.} } @Article { HeeringBS2020_2, subid = {2181}, title = {Glass electrode half-cells for measuring unified pH in ethanol–water mixtures}, journal = {Journal of Sensors and Sensor Systems}, year = {2020}, month = {11}, day = {11}, volume = {9}, number = {2}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {383-389}, keywords = {Glass electrode half-cells unified pHethanol–water mixtures}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-9-383-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, A. and Bastkowski, F. and Seitz, S.} } @Article { HonickeWWKB2020, subid = {1688}, title = {Towards a calibration of laboratory setups for grazing incidence and total-reflection X-ray fluorescence analysis}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {11}, volume = {174}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {106009}, keywords = {Gracing incidence X-ray fluorescenceLaboratory setupSolid angle characterization}, web_url = {https://arxiv.org/abs/2003.05192}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.106009}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Waldschl{\"a}ger, U. and Wiesner, T. and Kr{\"a}mer, M. and Beckhoff, B.} } @Article { IllgenJTBF2020, subid = {1695}, title = {Influence of ion induced secondary electron emission on the stability of ionisation vacuum gauges}, journal = {Vacuum}, year = {2020}, month = {11}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {109907}, keywords = {Ion induced secondary electron emissionIonisation vacuum gaugesXPS}, web_url = {https://arxiv.org/abs/2011.08568}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109907}, stag_bib_extends_levelofaccess = {NA}, author = {Illgen, C. and Jousten, K. and Teodoro, O.M.N.D. and Bundaleski, N. and Figueiredo, I.} } @Article { BlakesleyKDHTMSA2020, subid = {1949}, title = {Effective Spectral Albedo from Satellite Data for Bifacial Gain Calculations of PV Systems}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {1292 - 1297}, keywords = {Albedo, Bificial PV Module}, web_url = {https://zenodo.org/record/4055920}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {3-936338-73-6}, author = {Blakesley, J.C. and Koutsourakis, G. and Douglas, S. and Holder, J.K.L. and Torry, J. and Mukadam, F. and Schmid, A. and Abrams, R.S.J.} } @Article { BourgouinSHKPKM2020, subid = {1840}, title = {Calorimeter for Real-Time Dosimetry of Pulsed Ultra-High Dose Rate Electron Beams}, journal = {Frontiers in Physics}, year = {2020}, month = {10}, day = {30}, volume = {8}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, FLASH radiation therapy, calorimetry}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2020.567340}, stag_bib_extends_levelofaccess = {NA}, author = {Bourgouin, A. and Sch{\"u}ller, A. and Hackel, T. and Kranzer, R. and Poppinga, D. and Kapsch, R-P. and McEwen, M. } } @Article { HuggettBBGHKKMMNPSSVVWZ2020, subid = {1862}, title = {Cautionary Note on Contamination of Reagents Used for Molecular Detection of SARS-CoV-2}, journal = {Clinical Chemistry}, year = {2020}, month = {10}, day = {30}, volume = {66}, number = {11}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {1369-1372}, keywords = {SARS-CoV-2, RT-qPCR, contamination, false positive, molecular diagnosis}, web_url = {https://academic.oup.com/clinchem/article/66/11/1369/5902447}, misc2 = {EMPIR 2018: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0009-9147, 1530-8561}, DOI = {10.1093/clinchem/hvaa214}, stag_bib_extends_levelofaccess = {NA}, author = {Huggett, J.F. and Benes, V. and Bustin, S.A. and Garson, J.A. and Harris, K. and Kammel, M. and Kubista, M. and McHugh, T.D. and Moran-Gilad, J. and Nolan, T. and Pfaffl, M.W. and Salit, M. and Shipley, G. and Vallone, P.M. and Vandesompele, J. and Wittwer, C. and Zeichhardt, H.} } @Article { SeferiBMS2020, subid = {1933}, title = {Power Quality Measurement and Active Harmonic Power in 25 kV 50 Hz AC Railway Systems}, journal = {Energies}, year = {2020}, month = {10}, day = {30}, volume = {13}, number = {21}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {5698}, keywords = {railway electrical networks; traction converter; power quality analysis; active power; harmonic power; electric energy meters}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1996-1073}, DOI = {10.3390/en13215698}, stag_bib_extends_levelofaccess = {NA}, author = {Seferi, Y. and Blair, S.M. and Mester, C. and Stewart, B.G.} } @Article { AlveseSousaGFFMMBA2020, subid = {1674}, title = {Calibration of Syringe Pumps Using Interferometry and Optical Methods}, journal = {International Journal of Biomedical and Biological Engineering}, year = {2020}, month = {10}, day = {23}, volume = {14}, number = {10}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {10011517}, keywords = {Calibration, interferometry, syringe pump, optical method, uncertainty}, web_url = {https://publications.waset.org/10011517/pdf}, misc2 = {EMPIR 2018: Health}, publisher = {WASET}, language = {30}, ISSN = {ISNI:0000000091950263}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISNI:0000000091950263}, author = {Alves e Sousa, J. and Godinho, I. and Ferreira, M. do C. and Furtado, A. and Mendes, R. and Martins, R. and Batista, E. and Alvares, M.} } @Article { DorscherABSHSL2020, subid = {1719}, title = {Dynamical decoupling of laser phase noise in compound atomic clocks}, journal = {Communications Physics}, year = {2020}, month = {10}, day = {20}, volume = {3}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {1-8}, keywords = {optical atomic clocks,dynamic decoupling,coherence time,decoherence}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-020-00452-9}, stag_bib_extends_levelofaccess = {NA}, author = {D{\"o}rscher, S. and Al-Masoudi, A. and Bober, M. and Schwarz, R. and Hobson, R. and Sterr, U. and Lisdat, C.} } @Article { FurstYKKDLBHPM2020, subid = {1650}, title = {Coherent Excitation of the Highly Forbidden Electric Octupole Transition in Yb+172}, journal = {Physical Review Letters}, year = {2020}, month = {10}, day = {16}, volume = {125}, number = {16}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {163001}, keywords = {Atomic spectra, Optical clocks, Coherent control, Cooling \& trapping, Laser spectroscopy, Trapped Ions}, web_url = {https://link.aps.org/doi/10.1103/PhysRevLett.125.163001}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.163001}, stag_bib_extends_levelofaccess = {NA}, author = {F{\"u}rst, H.A. and Yeh, C.H. and Kalincev, D. and Kulosa, A.P. and Dreissen, L.S. and Lange, R. and Benkler, E. and Huntemann, N. and Peik, E. and Mehlst{\"a}ubler, T.E.} } @Article { MantouvalouJSMKWHWGBGD2020, subid = {1689}, title = {Laboratory grazing-incidence X-ray fluorescence spectroscopy as an analytical tool for the investigation of sub-nanometer CrSc multilayer water window optics}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {10}, day = {10}, volume = {174}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {105995}, keywords = {GIXRFMultilayer characterization}, web_url = {https://arxiv.org/abs/2006.12198}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.105995}, stag_bib_extends_levelofaccess = {NA}, author = {Mantouvalou, I. and Jonnard, P. and Szwedowski-Rammert, V. and Meltchakov, E. and Kanngie{\ss}er, B. and Wu, M. and Honicke, P. and Waldschl{\"a}ger, U. and Gross, A. and Baumann, J. and Goetzke, G. and Delmotte, F.} } @Article { BergstrandJH2020, subid = {1643}, title = {Quantifying errors in GNSS antenna calibrations}, journal = {Journal of Geodesy}, year = {2020}, month = {10}, volume = {94}, number = {10}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {105}, keywords = {Antenna, Calibration, GNSS, Local tie, Phase center offset, Phase center variation, Terrestrial reference frame, PCC, PCO, PCV, TRF}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0949-7714, 1432-1394}, DOI = {10.1007/s00190-020-01433-0}, stag_bib_extends_levelofaccess = {NA}, author = {Bergstrand, S. and Jarlemark, P. and Herbertsson, M.} } @Article { BremerWFTSKRHSPMGR2020, subid = {1803}, title = {Quantum dot single-photon emission coupled into single-mode fibers with 3D printed micro-objectives}, journal = {APL Photonics}, year = {2020}, month = {10}, volume = {5}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {106101}, keywords = {Quantum dot single-photon emission}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {2378-0967}, DOI = {10.1063/5.0014921}, stag_bib_extends_levelofaccess = {NA}, author = {Bremer, L. and Weber, K. and Fischbach, S. and Thiele, S. and Schmidt, M. and Kaganskiy, A. and Rodt, S. and Herkommer, A. and Sartison, M. and Portalupi, S.L. and Michler, P. and Giessen, H. and Reitzenstein, S.} } @Article { RomanoSMLPTMMBMAFGS2020, subid = {1839}, title = {Challenges in dosimetry of particle beams with ultra-high pulse dose rates}, journal = {Journal of Physics: Conference Series}, year = {2020}, month = {10}, volume = {1662}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {012028}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, electrons}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1662/1/012028}, stag_bib_extends_levelofaccess = {NA}, author = {Romano, F. and Subiel, A. and McManus, M. and Lee, N. D. and Palmans, H. and Thomas, R. and McCallum, S. and Milluzzo, G. and Borghesi, M. and McIlvenny, A. and Ahmed, H. and Farabolini, W. and Gilardi, A. and Sch{\"u}ller, A.} } @Article { SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI2020, subid = {1664}, title = {Intercontinental comparison of optical atomic clocks through very long baseline interferometry}, journal = {Nature Physics}, year = {2020}, month = {10}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology}, web_url = {http://hdl.handle.net/11696/64130}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-020-01038-6}, stag_bib_extends_levelofaccess = {NA}, author = {Sekido, M. and Takefuji, K. and Ujihara, H. and Hachisu, H. and Nemitz, N. and Tsutsumi, M. and Kondo, T. and Kawai, E. and Ichikawa, R. and Namba, K. and Okamoto, Y. and Takahashi, R. and Komuro, J. and Clivati, C. and Bregolin, F. and Barbieri, P. and Mura, A. and Cantoni, E. and Cerretto, G. and Levi, F. and Maccaferri, G. and Roma, M. and Bortolotti, C. and Negusini, M. and Ricci, R. and Zacchiroli, G. and Roda, J. and Leute, J. and Petit, G. and Perini, F. and Calonico, D. and Pizzocaro, M. and Ido, T.} } @Article { SikorskyGHKGEMRDWBRSKSF2020, subid = {1642}, title = {Measurement of the Th229 Isomer Energy with a Magnetic Microcalorimeter}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {Th229 Isomer Energy, Magnetic Microcalorimeter}, web_url = {https://arxiv.org/abs/2005.13340}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.142503}, stag_bib_extends_levelofaccess = {NA}, author = {Sikorsky, T. and Geist, J. and Hengstler, D. and Kempf, S. and Gastaldo, L. and Enss, C. and Mokry, C. and Runke, J. and D{\"u}llmann, C.E. and Wobrauschek, P. and Beeks, K. and Rosecker, V. and Sterba, J.H. and Kazakov, G. and Schumm, T. and Fleischmann, A.} } @Article { WelshvBCHLLLvNTWWJ2020, subid = {1707}, title = {Towards defining reference materials for measuring extracellular vesicle refractive index, epitope abundance, size and concentration}, journal = {Journal of Extracellular Vesicles}, year = {2020}, month = {9}, day = {24}, volume = {9}, number = {1}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {1816641}, keywords = {Calibration; exosomes; extracellular vesicles; microvesicles; optical analysis; reference materials; standardization; quality control; validation}, misc2 = {EMPIR 2018: Health}, language = {30}, ISSN = {2001-3078}, DOI = {10.1080/20013078.2020.1816641}, stag_bib_extends_levelofaccess = {NA}, author = {Welsh, J.A. and van der Pol, E. and Bettin, B.A. and Carter, D.R.F. and Hendrix, A. and Lenassi, M. and Langlois, M-A. and Llorente, A. and van de Nes, A.S. and Nieuwland, R. and Tang, V. and Wang, L. and Witwer, K.W. and Jones, J.C. } } @Article { deKromBZMBiGFKHE2020, subid = {2032}, title = {Comparability of calibration strategies for measuring mercury concentrations in gas emission sources and the atmosphere}, journal = {Atmospheric Measuremnt Techniques Discussion}, year = {2020}, month = {9}, day = {21}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {Mercury, emissions, calibration, traceability}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, DOI = {10.5194/amt-2020-314}, stag_bib_extends_levelofaccess = {NA}, author = {de Krom, I. and Bavius, W. and Ziel, R. and McGhee, E.A. and Brown, R.J.C. and Živković, I. and Gačnik, J. and Fajon, V. and Kotnik, J. and Horvat, M. and Ent, H.} } @Article { ZilbertiZABZ2020, subid = {1668}, title = {RF‐induced heating of metallic implants simulated as PEC: Is there something missing?}, journal = {Magnetic Resonance in Medicine}, year = {2020}, month = {9}, day = {16}, volume = {85}, number = {2}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {583-586}, keywords = {MR safetyMedical implantsRF-induced heatingMagnetic Resonance ImagingSpecific Absorption Rate}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/mrm.28512}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28512}, stag_bib_extends_levelofaccess = {NA}, author = {Zilberti, L. and Zanovello, U. and Arduino, A. and Bottauscio, O. and Zilberti, L.} } @Article { IliBL2020, subid = {2152}, title = {Stability of AC current measurements using AC-DC shunts and the AC Quantum Voltmeter}, journal = {Proceedings 24rd IMEKO TC 4 International Symposium}, year = {2020}, month = {9}, day = {16}, number2 = {17RPT03: DIG-AC: A digital traceability chain for AC voltage and current}, keywords = {AC-DC shunt, AC Quantum Voltmeter, low-frequency AC current, traceability}, misc2 = {EMPIR 2017: Research Potential}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc4-2020/IMEKO-TC4-2020-69.pdf}, author = {Ilić, D. and Behr, R. and Lee, J.} } @Article { WinterSVMRPKHLHDBBBBBBKSR2020, subid = {1950}, title = {Results of the Bifacial PV Cells and PV Modules Power Measurement Round Robin Activity of the PV-Enerate Project}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {9}, day = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {877 - 882}, keywords = {Testing, PV Module, Bifacial PV}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4055707}, author = {Winter, S. and Str{\"a}ter, H. and Vegas, A. and Molinero, R.R. and Riechelmann, S. and Pavanello, D. and Kenny, R. and Herrmann, W. and Lopez-Garcia, J. and Hinken, D. and Dittmann, S. and Bonilla, J. and Bliss, M. and Bothe, K. and Blakesley, J.C. and Betts, T.R. and Bellenda, G. and Koutsourakis, G. and Schmid, A. and Rauer, M.} } @Article { OlbrichBOS2020, subid = {1628}, title = {Statistical Characterization of Horizontal Slug Flow Using Snapshot Proper Orthogonal Decomposition}, journal = {International Journal of Multiphase Flow}, year = {2020}, month = {9}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {103453}, keywords = {slug flowcharacterizationproper orthogonal decomposition}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0301-9322}, DOI = {10.1016/j.ijmultiphaseflow.2020.103453}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and B{\"a}r, M. and Oberleithner, K. and Schmelter, S.} } @Article { GunkelDHLKRUBT2020, subid = {1684}, title = {Phonon‐Enhanced Near‐Field Spectroscopy to Extract the Local Electronic Properties of Buried 2D Electron Systems in Oxide Heterostructures}, journal = {Advanced Functional Materials}, year = {2020}, month = {9}, volume = {30}, number = {46}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {2004767}, keywords = {2D electron systems, electronic properties, LaAlO/SrTiO, near-field spectroscopy, oxide heterostructure}, misc2 = {EMPIR 2016: Energy}, publisher = {Wiley}, language = {30}, ISSN = {1616-301X, 1616-3028}, DOI = {10.1002/adfm.202004767}, stag_bib_extends_levelofaccess = {NA}, author = {Gunkel, F. and Dittmann, R. and Hoehl, A. and Lewin, M. and K{\"a}stner, B. and Rose, M‐A. and Ulrich, G. and Barnett, J. and Taubner, T.} } @Article { BrabH2020, subid = {1763}, title = {Ab initio calculation of the electron capture spectrum of 163Ho: Auger–Meitner decay into continuum states}, journal = {New Journal of Physics}, year = {2020}, month = {9}, volume = {22}, number = {9}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {093018}, keywords = {electron capture spectrum,line width,continuum,Auger Meitner,163Ho}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Maurits W. Haverkort}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/abac72}, stag_bib_extends_levelofaccess = {NA}, author = {Bra\(\beta\), M. and Haverkort, M.W.} } @Proceedings { ChenMBR2020, subid = {1765}, title = {Development of a Wideband Current-to-Voltage Transformer Set for Currents up to 2 kA}, journal = {2020 Conference on Precision Electromagnetic Measurements}, year = {2020}, month = {8}, day = {24}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, keywords = {Wideband, current transformers, calibration, measurement uncertainty, instrument transformer}, tags = {SEG}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, event_place = {Denver (Aurora), CO, USA, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4348461}, author = {Chen, Y. and Mohns, E. and Badura, H. and Raether, P.} } @Article { CainSTLWKBLF2020, subid = {1615}, title = {In Situ Electric-Field Study of Surface Effects in Domain Engineered Pb(In1/2Nb1/2)O3-Pb(Mg1/3Nb2/3)O3-PbTiO3 Relaxor Crystals by Grazing Incidence Diffraction}, journal = {Crystals}, year = {2020}, month = {8}, day = {20}, volume = {10}, number = {9}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {728}, keywords = {-}, web_url = {https://electrosciences.co.uk/2020/08/27/grazing_incidence/}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4352}, DOI = {10.3390/cryst10090728}, stag_bib_extends_levelofaccess = {NA}, author = {Cain, M.G. and Staruch, M. and Thompson, P. and Lucas, C. and Wermeille, D. and Kayser, Y. and Beckhoff, B. and Lofland, S.E. and Finkel, P.} } @Article { ClivatiABBDDMMMNLPRRSSSTC2020, subid = {1773}, title = {Common-clock very long baseline interferometry using a coherent optical fiber link}, journal = {Optica}, year = {2020}, month = {8}, day = {20}, volume = {7}, number = {8}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {1031}, keywords = {fiber links, coherent phase transfer, frequency dissemination with fibers, VLBI}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.393356}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Aiello, R. and Bianco, G. and Bortolotti, C. and De Natale, P. and Di Sarno, V. and Maddaloni, P. and Maccaferri, G. and Mura, A. and Negusini, M. and Levi, F. and Perini, F. and Ricci, R. and Roma, M. and Santamaria Amato, L. and Siciliani de Cumis, M. and Stagni, M. and Tuozzi, A. and Clivati, C.} } @Article { SchinkePHWBKNW2020_2, subid = {1604}, title = {Calibrating spectrometers for measurements of the spectral irradiance caused by solar radiation}, journal = {Metrologia}, year = {2020}, month = {8}, day = {17}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {spectral irradiance, solar radiation, measurement uncertainty analysis, spectrometer, spectroradiometer, calibration, solar simulator}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abafc5}, stag_bib_extends_levelofaccess = {NA}, author = {Schinke, C. and Pollex, H. and Hinken, D. and Wolf, M. and Bothe, K. and Kroeger, I. and Nevas, S. and Winter, S.} } @Article { deKromBZEvvvvHvDCE2020, subid = {1994}, title = {Primary mercury gas standard for the calibration of mercury measurements}, journal = {Measurement}, year = {2020}, month = {8}, day = {16}, volume = {169}, number = {2021}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {108351}, keywords = {Mercury, Metrology, Primary gas standard, Calibration, SI-traceability, Environmental}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2020.108351}, stag_bib_extends_levelofaccess = {NA}, author = {de Krom, I. and Bavius, W. and Ziel, R. and Efremov, E. and van Meer, D. and van Otterloo, P. and van Andel, I. and van Osselen, D. and Heemskerk, M. and van der Veen, A.M.H. and Dexter, M.A. and Corns, W.T. and Ent, H.} } @Article { GomezCGSPHFPTMB2020, subid = {1698}, title = {Rapid three-dimensional multiparametric MRI with quantitative transient-state imaging}, journal = {Scientific Reports}, year = {2020}, month = {8}, day = {13}, volume = {10}, number = {1}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, keywords = {Magnetic Resonance Imaging (MRI)Quantitative MRIMagnetic Resonance Fingerprinting}, web_url = {https://www.nature.com/articles/s41598-020-70789-2}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-70789-2}, stag_bib_extends_levelofaccess = {NA}, author = {G{\'o}mez, P.A. and Cencini, M. and Golbabaee, M. and Schulte, R.F. and Pirkl, C. and Horvath, I. and Fallo, G. and Peretti, L. and Tosetti, M. and Menze, B.H. and Buonincontri, G.} } @Article { KrehlikSB2020, subid = {1738}, title = {Electrical regeneration for long-haul fiber-optic time and frequency distribution systems}, journal = {Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2020}, month = {8}, day = {13}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, keywords = {Time and frequency transfer, fiber optics, optical-electrical-optical regeneration}, web_url = {https://ieeexplore.ieee.org/document/9166557}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TUFFC.2020.3016610}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, Ł. and Buczek, Ł.} } @Article { SchwarzDABLSWRLL2020, subid = {1570}, title = {Long term measurement of the 87Sr clock frequency at the limit of primary Cs clocks}, journal = {Physical Review Research}, year = {2020}, month = {8}, day = {11}, volume = {2}, number = {3}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {033242}, keywords = {Atomic spectra, optical clocks, gravitation}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {Ricklinger Stadtweg 4c}, language = {30}, DOI = {10.1103/PhysRevResearch.2.033242}, stag_bib_extends_levelofaccess = {NA}, author = {Schwarz, R and D{\"o}rscher, S and Al-Masoud, A and Benkler, E and Legero, T and Sterr, U and Weyers, S and Rahm, J and Lipphardt, B and Lisdat, C} } @Article { MauryADdBM2020, subid = {1818}, title = {Hydrogen refuelling station calibration with a traceable gravimetric standard}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {8}, volume = {74}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {101743}, keywords = {Refuelling station; Hydrogen; Primary standard; Uncertainties; High pressure}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101743}, stag_bib_extends_levelofaccess = {NA}, author = {Maury, R. and Auclercq, C. and Devilliers, C. and de Huu, M. and B{\"u}ker, O. and MacDonald, M.} } @Article { SignorinoGMGFBQDB2020, subid = {1935}, title = {Dataset of measured and commented pantograph electric arcs in DC railways}, journal = {Data in Brief}, year = {2020}, month = {8}, volume = {31}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {105978}, keywords = {Electric arcMeasurement of electrical quantitiesPantographPower qualityRailwaysRolling stock}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2352-3409}, DOI = {10.1016/j.dib.2020.105978}, stag_bib_extends_levelofaccess = {NA}, author = {Signorino, D. and Giordano, D. and Mariscotti, A. and Gallo, D. and Femine, A.D. and Balic, F. and Quintana, J. and Donadio, L. and Biancucci, A.} } @Article { RuutelYKSIDHHTBL2020, subid = {2185}, title = {Design, synthesis and application of carbazole macrocycles in anion sensors}, journal = {Beilstein Journal of Organic Chemistry}, year = {2020}, month = {8}, volume = {16}, number = {2020}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1901-1914}, keywords = {anion sensors; carboxylates;ionophores; acrocycles; sensor prototype}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Beilstein Institut}, language = {30}, ISSN = {1860-5397}, DOI = {10.3762/bjoc.16.157}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"u}{\"u}tel, A. and Yrj{\"a}n{\"a}, V. and Kadam, S.A. and Saar, I. and Ilisson, M. and Darnell, A. and Haav, K. and Haljasorg, T. and Toom, L. and Bobacka, J. and Leito, I.} } @Article { PeiPBL2020, subid = {1892}, title = {Uncertainty quantification in the design of wireless power transfer systems}, journal = {Open Physics}, year = {2020}, month = {7}, day = {30}, volume = {18}, number = {1}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {391-396}, keywords = {EMC, wireless transfer, uncertainty quantification, shielding, efficiency}, web_url = {https://www.degruyter.com/document/doi/10.1515/phys-2020-0174/html}, misc2 = {EMPIR 2016: Energy}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2391-5471}, DOI = {10.1515/phys-2020-0174}, stag_bib_extends_levelofaccess = {NA}, author = {Pei, Y. and Pichon, L. and Bensetti, M. and Le-Bihan, Y.} } @Article { BatistaGMMR2020, subid = {1571}, title = {Development of an experimental setup for microflow measurement using interferometry}, journal = {Flow measurement instrumentation}, year = {2020}, month = {7}, day = {29}, volume = {75}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {101789}, keywords = {Microflow measurement, Interferometry, Calibration, Measurement uncertainty}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.flowmeasinst.2020.101789}, stag_bib_extends_levelofaccess = {NA}, author = {Batista, Elsa and Godinho, Isabel and Martins, Rui and Mendes, Ricardo and Robarts, Jo{\~a}o} } @Article { BiguriLBTDBMDHB2020, subid = {1885}, title = {Arbitrarily large iterative tomographic reconstruction on multiple GPUs using the TIGRE toolbox}, journal = {Journal of Parallel and Distributed Computing}, year = {2020}, month = {7}, day = {29}, volume = {146}, number = {2020}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {52-63}, keywords = {Computed Tomography, multi GPU computing, iterative reconstruction}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1905.03748}, author = {Biguri, A. and Lindroos, R. and Bryll, R. and Towsyfyan, H. and Deyhle, H. and Boardman, R. and Mavrogordato, M. and Dosanjh, M. and Hancock, S. and Blumensath, T.} } @Article { ivkoviBKJH2020, subid = {2030}, title = {Traceable Determination of Atmospheric Mercury Using Iodinated Activated Carbon Traps}, journal = {Atmosphere}, year = {2020}, month = {7}, day = {24}, volume = {11}, number = {8}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {780}, keywords = {Mercury, sorbent traps, atmosphere, traceability}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4433}, DOI = {10.3390/atmos11080780}, stag_bib_extends_levelofaccess = {NA}, author = {Živković, I. and Berisha, S. and Kotnik, J. and Jagodic, M. and Horvat, Milena} } @Article { FerreroBCRFM2020, subid = {1858}, title = {Goniochromatic assessment of gray scales for color change}, journal = {Journal of the Optical Society of America A}, year = {2020}, month = {7}, day = {22}, volume = {37}, number = {8}, number2 = {IND52: xDReflect: Multidimensional reflectometry for industry}, pages = {1266}, keywords = {Color, gray scale, goniochromatism}, web_url = {https://digital.csic.es/bitstream/10261/227636/1/Goniochromatic\%20assessment.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Optical Society}, language = {30}, ISSN = {1084-7529, 1520-8532}, DOI = {10.1364/JOSAA.394170}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Bernad, B. and Campos, J. and Richard, N. and Fern{\'a}ndez-Maloigne, C. and Melgosa, M.} } @Article { MayerBTOPAGMIMSK2020, subid = {1600}, title = {Flexible numerical simulation framework for dynamic PET-MR data}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {7}, day = {21}, volume = {65}, number = {14}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, pages = {145003}, keywords = {PET-MR,motion correction,simulation,image registration,open source}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab7eee}, stag_bib_extends_levelofaccess = {NA}, author = {Mayer, J. and Brown, R. and Thielemans, K. and Ovtchinnikov, E. and Pasca, E. and Atkinson, D. and Gillman, A. and Marsden, P. and Ippoliti, M. and Makowski, M. and Schaeffter, T. and Kolbitsch, C.} } @Article { BodermannBZMKSDHDK2020, subid = {1559}, title = {Quasi-bound states in the continuum for deep subwavelength structural information retrieval for DUV nano-optical polarizers}, journal = {Optics Express}, year = {2020}, month = {7}, day = {20}, volume = {28}, number = {16}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {23122}, keywords = {quasi-bound states}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.396044}, stag_bib_extends_levelofaccess = {NA}, author = {Bodermann, B. and Burger, S. and Zeitner, U. and Meyer, J. and K{\"a}seberg, T. and Siefke, T. and Dickmann, W. and Hurtado, C.B.R. and Dickmann, J. and Kroker, S.} } @Article { FretwellLBKDLMPRSF2020, subid = {1539}, title = {Direct Measurement of the 7Be L/K Capture Ratio in Ta-Based Superconducting Tunnel Junctions}, journal = {Physical Review Letters}, year = {2020}, month = {7}, day = {14}, volume = {125}, number = {3}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {032701}, keywords = {7Be, Electron captures, Cryogenic detectors, Theoretical calculations}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2003.04921}, author = {Fretwell, S. and Leach, K.G. and Bray, C. and Kim, G.B. and Dilling, J. and Lennarz, A. and Mougeot, X. and Ponce, F. and Ruiz, C. and Stackhouse, J. and Friedrich, S.} } @Article { AlKhafajiGWBV2020, subid = {1714}, title = {Particle Size Distribution of Bimodal Silica Nanoparticles: A Comparison of Different Measurement Techniques}, journal = {Materials}, year = {2020}, month = {7}, day = {11}, volume = {13}, number = {14}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {3101}, keywords = {silica nanoparticle; size distribution; light scattering; small-angle X-ray scattering; microfluidic resistive pulse sensing}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {1996-1944}, DOI = {10.3390/ma13143101}, stag_bib_extends_levelofaccess = {NA}, author = {Al-Khafaji, M.A. and Ga{\'a}l, A. and Wacha, A. and B{\'o}ta, A. and Varga, Z.} } @Article { HeeringSCANNQRBBNSLLURVSDRKL2020, subid = {1554}, title = {Symmetric Potentiometric Cells for the Measurement of Unified pH Values}, journal = {Symmetry}, year = {2020}, month = {7}, volume = {12}, number = {7}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1150}, keywords = {unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-8994}, DOI = {10.3390/sym12071150}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, Agnes and Stoica, Daniela and Cam{\~o}es, Filomena and Anes, B{\'a}rbara and Nagy, D{\'a}niel and Nagyn{\'e} Szil{\'a}gyi, Zs{\'o}fia and Quendera, Raquel and Ribeiro, Luis and Bastkowski, Frank and Born, Rasmus and Nerut, Jaak and Saame, Jaan and Lainela, Silvie and Liv, Lokman and Uysal, Emrah and Rozikov{\'a}, Matilda and Vičarov{\'a}, Martina and Snedden, Alan and Deleebeeck, Lisa and Radtke, Valentin and Krossing, Ingo and Leito, Ivo} } @Article { LindgrenBRLGBIM2020, subid = {1856}, title = {Review of road surface photometry methods and devices – Proposal for new measurement geometries}, journal = {Lighting REsearch and technology}, year = {2020}, month = {7}, number = {1}, number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting}, pages = {1-17}, keywords = {SURFACE, road surface, asphalt, luminance coefficient, measurement geometries}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {SAGE}, language = {30}, ISSN = {1477-0938}, DOI = {10.1177/1477153520958454}, stag_bib_extends_levelofaccess = {NA}, author = {Lindgren, M. and Blattner, P. and Reber, J. and Liandrat, S. and GREFFIER, F. and Bernasconi, J. and Iacomussi, P. and Muzet, V.} } @Article { BogoalecKosirCKGZM2020, subid = {2145}, title = {Digital PCR method for detection and quantification of specific antimicrobial drug-resistance mutations in human cytomegalovirus}, journal = {Journal of Virological Methods}, year = {2020}, month = {7}, volume = {281}, number = {/}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, pages = {113864}, keywords = {Digital PCR, Antimicrobial-Drug resistance, HCMV, Polymerase chain reaction, Viruses}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0166-0934}, DOI = {10.1016/j.jviromet.2020.113864}, stag_bib_extends_levelofaccess = {NA}, author = {Bogožalec Košir, A. and Cvelbar, T. and Kammel, M. and Grunert, H-P. and Zeichhardt, H. and Milavec, M.} } @Article { SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020, subid = {1522}, title = {Determination of consensus kQ values for megavoltage photon beams for the update of IAEA TRS-398}, journal = {Physics in Medicine and Biology}, year = {2020}, month = {6}, day = {22}, volume = {65}, number = {9}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {095011}, keywords = {TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Institute of Physics}, address = {London}, language = {30}, DOI = {10.5281/zenodo.3903294}, stag_bib_extends_levelofaccess = {NA}, author = {Seuntjens, J. and de Prez, L.A. and Pinto, M. and Pimpinella, M. and Oliver, C.P. and Ojala, J. and Muir, B. and Mirzakhanian, L. and Hanlon, M.D. and Francescon, P. and Delaunay, F. and Borbinha, J. and Ballester, F. and Andersen, C.E. and Vatnitsky, S. and McEwen, M. and Kapsch, R.P. and Burns, D.T. and Andreo, P. and Sommier, L. and Teles, P. and Tikkanen, J. and Vijande, J. and Zink, K.} } @Article { dePooterBdDKKvW2020, subid = {1629}, title = {Reference dosimetry in MRI-linacs: evaluation of available protocols and data to establish a code of practice}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {6}, day = {22}, volume = {1}, number = {1}, number2 = {19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy}, pages = {1}, keywords = {Reference dosimetry, MRI linac, Monte Carlo simulation, MR guided radiotherapy}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ab9efe}, stag_bib_extends_levelofaccess = {NA}, author = {de Pooter, J.A. and Billas, I. and de Prez, L.A. and Duane, S. and Kapsch, R-P. and Karger, C.P. and van Asselen, B. and Wolthaus, J.W.H.} } @Article { SixOMLLJHBBLHYTYM2020, subid = {1577}, title = {What can we learn from N2O isotope data? - Analytics, processes and modelling}, journal = {Rapid Communications in Mass Spectrometry}, year = {2020}, month = {6}, day = {16}, volume = {34}, number = {20}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {14/e8858}, keywords = {nitrous oxide, isotopic composition, isotope ratio mass spectrometry, laser spectroscopy}, web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa:22957}, misc2 = {EMPIR 2016: Environment}, publisher = {John Wiley \& Sons}, language = {30}, DOI = {10.1002/rcm.8858}, stag_bib_extends_levelofaccess = {NA}, author = {Yu, Longfei and Harris, Eliza and Lewicka‐Szczebak, Dominika and Barthel, Matti and Blomberg, Margareta and Harris, Stephen J. and Johnson, Matthew S. and Lehmann, Moritz F. and Liisberg, Jesper and M{\"u}ller, Christoph and Ostrom, Nathaniel E. and Six, Johan and Toyoda, Sakae and Yoshida, Naohiro and Mohn, Joachim} } @Article { BloklandSRB2020, subid = {1517}, title = {Capacitive and Infrared Gas Sensors for the Assessment of the Methane Number of LNG Fuels}, journal = {Sensors}, year = {2020}, month = {6}, day = {12}, volume = {20}, number = {12}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {3345}, keywords = {energy transition; Methane Number; gas composition sensor; capacitive sensor array; interdigitated electrodes; responsive coatings; tunable filter infrared spectrometer; LNG; biogas}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20123345}, stag_bib_extends_levelofaccess = {NA}, author = {Sweelssen, J. and Blokland, H. and Rajamaki, T. and Boersma, A.} } @Article { SetinaTIBBJVW2020, subid = {1519}, title = {A review on hot cathode ionisation gauges with focus on a suitable design for measurement accuracy and stability}, journal = {Vacuum}, year = {2020}, month = {6}, day = {10}, volume = {179}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, keywords = {Ionisation gauge, Hot cathode, Sensitivity, Secondary electrons, Electron stimulated desorption}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier}, address = {Munich}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109545}, stag_bib_extends_levelofaccess = {NA}, author = {Jousten, K. and Boineau, F. and Bundaleski, N. and Illgen, C. and Šetina, J. and Teodoro, O.M.N.D. and Vicar, M. and W{\"u}est, M.} } @Article { BossewCCCDEGPT2020, subid = {1837}, title = {Development of a Geogenic Radon HazardIndex—Concept, History, Experiences}, journal = {International Journal of Environmental Research and Public Health}, year = {2020}, month = {6}, day = {10}, volume = {17}, number = {11}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {4134}, keywords = {geogenic radon hazard index, geogenic radon potential, European map of geogenic radon}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 1660-4601}, DOI = {10.3390/ijerph17114134}, stag_bib_extends_levelofaccess = {NA}, author = {Bossew, P. and Cinelli, G. and Ciotoli, G. and Crowley, Q.G. and De Cort, M. and El{\'i}o Medina, J. and Gruber, V. and Petermann, E. and Tollefsen, T.} } @Article { BatistaTB2020, subid = {1478}, title = {Traceability of pulsed flow rates consisting of constant delivered volumes at given time interval}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {6}, volume = {73}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {101729}, keywords = {Traceability, pulsed flow rate, volume}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101729}, stag_bib_extends_levelofaccess = {NA}, author = {Bissig, H. and Tschannen, M. and de Huu, M} } @Article { BoudaoudCO2020, subid = {1493}, title = {Development of an optical measurement method for “sampled” micro-volumes and nano-flow rates}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {6}, volume = {73}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {101746}, keywords = {Optical Method, volume, microflow}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101746}, stag_bib_extends_levelofaccess = {NA}, author = {Ogheard, F. and Cassette, P. and Boudaoud, A.} } @Article { HarmonFBAGBLZ2020, subid = {1514}, title = {Assessment of Exposure to Electric Vehicle Inductive Power Transfer Systems: Experimental Measurements and Numerical Dosimetry}, journal = {Sustainability}, year = {2020}, month = {6}, volume = {12}, number = {11}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {4573}, keywords = {basic restrictions; electric vehicle; exposure; guidelines; inductive power transfer (IPT); magnetic field measurements; numerical dosimetry}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2071-1050}, DOI = {10.3390/su12114573}, stag_bib_extends_levelofaccess = {NA}, author = {Liorni, I. and Bottauscio, O. and Guilizzoni, R. and Ankarson, P. and Bruna, J. and Fallahi, A. and Harmon, S. and Zucca, M.} } @Article { KolovouGCBL2020, subid = {1524}, title = {Procedures to Measure Mean Ambient Dose Equivalent Rates Using Electret Ion Chambers}, journal = {Radiation Protection Dosimetry}, year = {2020}, month = {6}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, keywords = {electret ion chambers,ambient dose equivalent rates}, misc2 = {EMPIR 2016: Environment}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncaa061}, stag_bib_extends_levelofaccess = {NA}, author = {Leontaris, F. and Boziari, A. and Clouvas, A. and Kolovou, M. and Guilhot, J.} } @Article { SamantarayRB2020, subid = {1596}, title = {Single-phase and correlated-phase estimation with multiphoton annihilated squeezed vacuum states: An energy-balancing scenario}, journal = {Physical Review A}, year = {2020}, month = {6}, volume = {101}, number = {6}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {063810}, keywords = {quantum optics, quantum metrology, non-gaussian states}, web_url = {https://arxiv.org/abs/1809.10706}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.101.063810}, stag_bib_extends_levelofaccess = {NA}, author = {Samantaray, N. and Ruo-Berchera, I. and Berchera, I.} } @Article { SchmelterOSB2020, subid = {1627}, title = {Numerical simulation, validation, and analysis of two-phase slug flow in large horizontal pipes}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {6}, volume = {73}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {101722}, keywords = {Multiphase flow, slug flow, CFD, frequency analysis}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101722}, stag_bib_extends_levelofaccess = {NA}, author = {Schmelter, S. and Olbrich, M. and Schmeyer, E. and B{\"a}r, M.} } @Proceedings { BosseEZCBOYBMRF2020, subid = {1665}, title = {AdvManuNet: a networking project on metrology for advanced manufacturing}, journal = {Proceedings 20th euspen International Conference and Exhibition}, year = {2020}, month = {6}, volume = {2020}, number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing}, keywords = {Advanced Manufacturing, Key Enabling Technology (KET), Strategic Research Agenda (SRA), European Metrology Network (EMN)}, misc2 = {EMPIR 2019: Support for Networks}, event_place = {Online Conference}, event_name = {20th euspen International Conference and Exhibition}, event_date = {08-06-2020 to 12-06-2020}, language = {30}, ISBN = {978-0-9957751-7-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE20374.pdf}, author = {Bosse, H. and Evans, A. and Zelen{\'y}, V. and Czulek, D. and Balsamo, A. and O'Connor, D. and Yandayan, T. and Billington, D. and Meli, F. and Ragusa, C. and Flys, O.} } @Proceedings { BehleB2020, subid = {1654}, title = {Mode analysis for long, undamped cantilevers with added diamond tips of varying length for fast roughness measurements}, journal = {SMSI 2020 - Sensors and Instrumentation}, year = {2020}, month = {6}, volume = {Chapter P2}, number = {2020}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {238-239}, keywords = {FEM, Mode analysis, diamond tips, piezoresistive Si-cantilever, roughness measurements}, misc2 = {EMPIR 2017: Industry}, publisher = {AMA Association for Sensors and Measurement}, event_place = {Nuremberg, Germany}, event_name = {SMSI 2020}, event_date = {22-06-2020 to 25-06-2020}, language = {30}, ISBN = {978-3-9819376-2-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ama-science.org/proceedings/details/3729}, author = {Behle, H. and Brand, U.} } @Proceedings { ReuterRFPBHR2020, subid = {1653}, title = {Applications of Tactile Microprobes for Surface Metrology}, journal = {SMSI 2020 - Sensors and Instrumentation}, year = {2020}, month = {6}, volume = {Chapter A6}, number = {2020}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {87-88}, keywords = {piezoresistive cantilever, MEMS, atomic force microscopy, contact resonance, surfaceroughness}, misc2 = {EMPIR 2017: Industry}, publisher = {AMA Association for Sensors and Measurement}, event_place = {Nuremberg, Germany}, event_name = {SMSI 2020}, event_date = {22-06-2020 to 25-06-2020}, language = {30}, ISBN = {978-3-9819376-2-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ama-science.org/proceedings/details/3655}, author = {Reuter, C. and Reum, A. and Fahrbach, M. and Peiner, E. and Brand, U. and Hofmann, M. and Rangelow, I.} } @Article { LucasCTDABLYSMPF2020, subid = {1611}, title = {Dynamic piezoelectric response of relaxor single crystal under electrically driven inter-ferroelectric phase transformations}, journal = {Applied Physics Letters}, year = {2020}, month = {6}, volume = {116}, number = {22}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {222903}, keywords = {-}, web_url = {https://livrepository.liverpool.ac.uk/3091334/}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0007820}, stag_bib_extends_levelofaccess = {NA}, author = {Lucas, C.A. and Cain, M.G. and Thompson, P.B.J. and Damjanovic, D. and Antonelli, L. and Blackmon, F. and Lofland, S.E. and Young, S. and Staruch, M. and Matis, B.R. and Patterson, E.A. and Finkel, P.} } @Article { BlakesleyHMGFBH2020, subid = {1733}, title = {Accuracy, cost and sensitivity analysis of PV energy rating}, journal = {Solar Energy}, year = {2020}, month = {6}, volume = {203}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {91-100}, keywords = {Photovoltaics, Energy rating, Uncertainty}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2020.03.088}, stag_bib_extends_levelofaccess = {NA}, author = {Blakesley, J.C. and Huld, T. and M{\"u}llejans, H. and Gracia-Amillo, A. and Friesen, G. and Betts, T.R. and Hermann, W.} } @Proceedings { BircherMKT2020, subid = {1758}, title = {METAS-CT: Metrological X-ray computed tomography at sub-micrometre precision}, journal = {Proceedings 20th euspen International Conference and Exhibition}, year = {2020}, month = {6}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {Industrial X-ray computed tomography, dimensional metrology, high-resolution, microtechnology, micro-parts, additive manufacturing}, web_url = {https://www.euspen.eu/knowledge-base/ICE20131.pdf}, misc2 = {EMPIR 2017: Industry}, event_place = {Online Conference}, event_name = {20th euspen International Conference and Exhibition}, event_date = {08-06-2020 to 12-06-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE20131.pdf}, author = {Bircher, B. and Meli, F. and K{\"u}ng, A. and Thalmann, R.} } @Article { deHuuTBSBMMNPR2020, subid = {1819}, title = {Design of gravimetric primary standards for field-testing of hydrogen refuelling stations}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {6}, volume = {73}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {101747}, keywords = {Hydrogen calibration, Hydrogen dispenser, Gravimetric method}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101747}, stag_bib_extends_levelofaccess = {NA}, author = {de Huu, M. and Tschannen, M. and Bissig, H. and Stadelmann, P. and B{\"u}ker, O. and MacDonald, M. and Maury, R. and Neuvonen, P.T. and Petter, H.T. and RASMUSSEN, K.} } @Article { HarrisLXWZYBWKCBSM2020, subid = {1578}, title = {N2O isotopocule measurements using laser spectroscopy: analyzer characterization and intercomparison}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {5}, day = {28}, volume = {13}, number = {-}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {2797–2831}, keywords = {nitrous oxide, isotopic composition, laser spectroscopy, spectral interference, matrix effect}, web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa\%3A22186}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus Gesellschaft mbH}, address = {G{\"o}ttingen}, language = {30}, DOI = {10.5194/amt-13-2797-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Harris, Stephen J. and Liisberg, Jesper and Xia, Longlong and Wei, Jing and Zeyer, Kerstin and Yu, Longfei and Barthel, Matti and Wolf, Benjamin and Kelly, Bryce F. J. and Cend{\'o}n, Dioni I. and Blunier, Thomas and Six, Johan and Mohn, Joachim} } @Article { WagnerSBKLSS2020, subid = {1968}, title = {PTB-XL, a large publicly available electrocardiography dataset}, journal = {Scientific Data}, year = {2020}, month = {5}, day = {25}, volume = {7}, number = {1}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, keywords = {electrocardiography, cardiovascular system, 12 lead electrocardiography, presence of co-occurring diseases}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2052-4463}, DOI = {10.1038/s41597-020-0495-6}, stag_bib_extends_levelofaccess = {NA}, author = {Wagner, P. and Strodthoff, N. and Bousseljot, R-D. and Kreiseler, D. and Lunze, F.I. and Samek, W. and Schaeffter, T.} } @Article { MorevaBTSTFPBPDOG2020, subid = {1710}, title = {Practical Applications of Quantum Sensing: A Simple Method to Enhance the Sensitivity of Nitrogen-Vacancy-Based Temperature Sensors}, journal = {Physical Review Applied}, year = {2020}, month = {5}, day = {22}, volume = {13}, number = {5}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {054057}, keywords = {color centers, diamond, quantum sensing}, web_url = {https://arxiv.org/abs/1912.10887}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.13.054057}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Bernardi, E. and Traina, P. and Sosso, A. and Tchernij, S.D. and Forneris, J. and Picollo, F. and Brida, G. and Pastuović, Ž. and Degiovanni, I. P. and Olivero, P. and Genovese, M.} } @Article { MorevaBTSTFPBPDOG20200, subid = {1710}, title = {Practical Applications of Quantum Sensing: A Simple Method to Enhance the Sensitivity of Nitrogen-Vacancy-Based Temperature Sensors}, journal = {Physical Review Applied}, year = {2020}, month = {5}, day = {22}, volume = {13}, number = {5}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {054057}, keywords = {color centers, diamond, quantum sensing}, web_url = {https://arxiv.org/abs/1912.10887}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.13.054057}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Bernardi, E. and Traina, P. and Sosso, A. and Tchernij, S.D. and Forneris, J. and Picollo, F. and Brida, G. and Pastuović, Ž. and Degiovanni, I. P. and Olivero, P. and Genovese, M.} } @Article { YamakawaBATBSNKYD2020, subid = {2039}, title = {Hg isotopic composition and total Hg mass fraction in NIES Certified Reference Material No. 28 Urban Aerosols}, journal = {Analytical and Bioanalytical Chemistry}, year = {2020}, month = {5}, day = {18}, volume = {412}, number = {19}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {4483-4493}, keywords = {Hg isotopic composition, Certified Reference Material, Urban Aerosols}, misc2 = {EMPIR 2016: Environment}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-020-02691-9}, stag_bib_extends_levelofaccess = {NA}, author = {Yamakawa, A. and B{\'e}rail, S. and Amouroux, D. and Tessier, E. and Barre, J. and Sano, T. and Nagano, K. and Kanwal, S. and Yoshinaga, J. and Donard, O.F.X.} } @Article { BilousBBSvTPLP2020, subid = {1541}, title = {Electronic Bridge Excitation in Highly Charged Th229 Ions}, journal = {Physical Review Letters}, year = {2020}, month = {5}, day = {12}, volume = {124}, number = {19}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {highly charged Ionshigh-intensity optical laserHighly Charged 229Th Ions}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.124.192502}, stag_bib_extends_levelofaccess = {NA}, author = {Bilous, P.V. and Bekker, H. and Berengut, J.C. and Seiferle, B. and von der Wense, L. and Thirolf, P.G. and Pfeifer, T. and L{\'o}pez-Urrutia, J.R.C. and P{\'a}lffy, A.} } @Article { CouplandPBDLTSL2020, subid = {1523}, title = {Lens aberration compensation in interference microscopy}, journal = {Optics and Lasers in Engineering}, year = {2020}, month = {5}, volume = {128}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {106015}, keywords = {Lens aberration interference microscopy}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, address = {Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands}, language = {30}, ISSN = {0143-8166}, DOI = {10.1016/j.optlaseng.2020.106015}, stag_bib_extends_levelofaccess = {NA}, author = {Su, R. and Thomas, M. and Liu, M. and Drs, J. and Bellouard, Y. and Pruss, C. and Coupland, J. and Leach, R.} } @Article { OsanBCDGSH2020, subid = {1569}, title = {Experimental evaluation of the in-the-field capabilities of total-reflection X-ray fluorescence analysis to trace fine and ultrafine aerosol particles in populated areas}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {5}, volume = {167}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {105852}, keywords = {Atmospheric aerosols, Ultrafine particles, Cascade impactor, TXRF, Elemental size distribution}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, address = {Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.105852}, stag_bib_extends_levelofaccess = {NA}, author = {Os{\'a}n, J{\'a}nos and B{\"o}rcs{\"o}k, Endre and Cz{\"o}mp{\"o}ly, Ott{\'o} and Dian, Csenge and Groma, Veronika and Stabile, Luca and Hensey, Garry} } @Article { KasebergSKB2020, subid = {1595}, title = {Inverted plasmonic lens design for nanometrology applications}, journal = {Measurement Science and Technology}, year = {2020}, month = {5}, volume = {31}, number = {7}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {074013}, keywords = {Plasmonics, Metrology, Plasmonic lens, Microscopy, Nanostructures, Finite Element Method}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab7e6b}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}seberg, T. and Siefke, T. and Kroker, S. and Bodermann, B.} } @Proceedings { CrottiGDFGLLLBMP2020, subid = {1727}, title = {Measurement of Dynamic Voltage Variation Effect on Instrument Transformers for Power Grid Applications}, journal = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2020}, month = {5}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, keywords = {Instrument transformers, power grid, power quality, phasor measurement unit, uncertainty}, tags = {SEG}, web_url = {https://zenodo.org/record/4154617\#.X9DyOthKguU}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Dubrovnik, Croatia, Croatia}, event_name = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {25-05-2020 to 28-05-2020}, language = {30}, DOI = {10.5281/zenodo.4154617}, stag_bib_extends_levelofaccess = {NA}, author = {Crotti, G. and Giordano, D. and D'Avanzo, G. and Femine, A.D. and Gallo, D. and Landi, C. and Luiso, M. and Letizia, P.S. and Barbieri, L. and Mazza, P. and Palladini, D.} } @Article { PollathLLZZB2020, subid = {1761}, title = {Spin structure relation to phase contrast imaging of isolated magnetic Bloch and N{\'e}el skyrmions}, journal = {Ultramicroscopy}, year = {2020}, month = {5}, volume = {212}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {112973}, keywords = {SkyrmionLorentz TEMPhase contrastMagnetic imaging}, web_url = {https://arxiv.org/pdf/2002.12469.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2020.112973}, stag_bib_extends_levelofaccess = {NA}, author = {P{\"o}llath, S. and Lin, T. and Lei, N. and Zhao, W. and Zweck, J. and Back, C.H.} } @Article { ArrheniusBFPM2020, subid = {1821}, title = {Development and evaluation of a novel analyser for ISO14687 hydrogen purity analysis}, journal = {Measurement Science and Technology}, year = {2020}, month = {5}, volume = {31}, number = {7}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {075010}, keywords = {hydrogen, hydrogen purity, analyser, OFCEAS, gas chromatography}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab7cf3}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and B{\"u}ker, O. and Fischer, A. and Persijn, S. and Murugan, A.} } @Proceedings { CipollettaFGLLGPBFGG2020, subid = {1939}, title = {Monitoring a DC Train Supplied by a Reversible Substation}, journal = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2020}, month = {5}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Railway system, DC Reversible Substations, Inverting Substations, DC Power Quality, Energy measurement, Energy Savings, Power System Measurement}, web_url = {https://zenodo.org/record/4570008\#.YESU4WhKiCo}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Dubrovnik, Croatia}, event_name = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {25-05-2020 to 28-05-2020}, language = {30}, ISBN = {978-1-7281-4461-0}, ISSN = {2642-2077}, DOI = {10.1109/I2MTC43012.2020.9128644}, stag_bib_extends_levelofaccess = {NA}, author = {Cipolletta, G. and Femine, A.D. and Gallo, D. and Landi, C. and Luiso, M. and Gallo, A. and Pastena, L. and Balic, F. and Fernandez, J.Q. and Giordano, D. and Giordano, Domenico} } @Article { FinizioWMHLBBMR2020_2, subid = {2379}, title = {Current-induced dynamical tilting of chiral domain walls in curved microwires}, journal = {Applied Physics Letters}, year = {2020}, month = {5}, volume = {116}, number = {18}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {182404}, keywords = {domain wall, spin-orbit torque, x-ray microscopy}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0005186}, stag_bib_extends_levelofaccess = {NA}, author = {Finizio, S. and Wintz, S. and Mayr, S. and Huxtable, A.J. and Langer, M. and Bailey, J. and Burnell, G. and Marrows, C.H. and Raabe, J.} } @Article { GomezMMBPM2020, subid = {2738}, title = {Bose-Einstein Condensate Comagnetometer}, journal = {Physical Review Letters}, year = {2020}, month = {4}, day = {29}, volume = {124}, number = {17}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Comagnetometer, BEC}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1910.06642}, author = {Gomez, P. and Martin, F. and Mazzinghi, C. and Benedicto Orenes, D. and Palacios, S. and Mitchell, M.W.} } @Article { MartinezABNVJHKVKL2020, subid = {1488}, title = {Step height standards based on self-assembly for 3D metrology of biological samples}, journal = {Measurement Science and Technology}, year = {2020}, month = {4}, day = {23}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {nanometrology, transfer standard, calibration, CSI, SWLI, AFM, traceability}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab8c6a}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, V. and Kassamakov, I. and Viitala, T. and J{\"a}rvinen, M. and Vainikka, T. and Nolvi, A. and Bermudez, C. and Artigas, R. and Martinez, P. and Korpelainen, V. and Lassila, A.} } @Miscellaneous { SilvaALSCRMBS_2, subid = {1486}, title = {EMUE-D6-4-Mobile Optical Measurement}, year = {2020}, month = {4}, day = {18}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Calibration; Mobile optical measurement system}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3756658}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, M.A. and Almeida, M.C. and Loureiro, D. and Sousa, J.A. and Cox, M.G. and Ribeiro, A.S. and Martins, L.L. and Brito, R. and Soares, A.C.} } @Article { RonnbergBGMK2020, subid = {1492}, title = {Comparison of Measurement Methods for the Frequency Range 2–150 kHz (Supraharmonics) Based on the Present Standards Framework}, journal = {IEEE Access}, year = {2020}, month = {4}, day = {15}, volume = {8}, number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods}, pages = {77618-77630}, keywords = {Distortion measurement, electromagnetic compatibility, measurement standards, powerquality, supraharmonics, frequency domain analysis}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=9067844}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2169-3536}, DOI = {10.1109/ACCESS.2020.2987996}, stag_bib_extends_levelofaccess = {NA}, author = {Khokhlov, V. and Meyer, J. and Grevener, A. and Busatto, T. and Ronnberg, S.} } @Miscellaneous { SilvaALSCRMBS, subid = {1484}, title = {EMUE-D1-3-Single Burning Item}, year = {2020}, month = {4}, day = {1}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Measurement model; SBI – Single Burning Item; Reaction to fire test}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3736602}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, M.A. and Almeida, M.C. and Loureiro, D. and Sousa, J.A. and Cox, M.G. and Ribeiro, A.S. and Martins, L.L. and Brito, R. and Soares, A.C.} } @Article { AlveseSousaTNGBFPFBO2020, subid = {1468}, title = {New EMPIR project – Metrology for Drug Delivery}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {4}, volume = {72}, number = {Special Is}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {101716}, keywords = {Microflow, drug delivery, calibration, health}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101716}, stag_bib_extends_levelofaccess = {NA}, author = {Batista, E. and Furtado, A. and Pereira, J. and Ferreira, M. and Bissig, H. and Graham, E. and Niemann, A. and Timmerman, A. and Sousa, J.A. and Ogheard, F.} } @Article { SliwczynskiKIESPB2020, subid = {1851}, title = {Fiber-Based UTC Dissemination Supporting 5G Telecommunications Networks}, journal = {IEEE Communications Magazine}, year = {2020}, month = {4}, volume = {58}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {67-73}, keywords = {time transfer, frequency transfer, fiber optic, 5G, network synchronization, synchronization supervision}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.5281/zenodo.3903158}, stag_bib_extends_levelofaccess = {NA}, author = {Śliwczyński, L. and Krehlik, P. and Imlau, H. and Ender, H. and Schnatz, H. and Piester, D. and Bauch, A.} } @Article { OjalaBTPZTSGP2020, subid = {1496}, title = {Calculated beam quality correction factors for ionization chambers in MV photon beams}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {3}, day = {26}, volume = {65}, number = {7}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {075003}, keywords = {kQ factors, radiotherapy dosimetry, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab7107}, stag_bib_extends_levelofaccess = {NA}, author = {Tikkanen, J. and Zink, K. and Pimpinella, M. and Teles, P. and Borbinha, J. and Ojala, J. and Siiskonen, T. and Gom{\`a}, C. and Pinto, M.} } @Miscellaneous { SousaPvCFDBKE, subid = {1467}, title = {EMUE-D1-2-Bayesian Mass Calibration}, year = {2020}, month = {3}, day = {25}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Bayesian statistics, measurement uncertainty, prior knowledge, calibration}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3726908}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Pellegrino, O. and van der Veen, A.M.H. and Cox, M.G. and Fischer, N. and Demeyer, S. and Bošnjakovic, A. and Karahodžić, V. and Elster, C.} } @Article { KueraKPBV2020, subid = {1607}, title = {Characterization of a precision modular sinewave generator}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, day = {17}, volume = {31}, number = {6}, number2 = {17RPT04: VersICaL: A versatile electrical impedance calibration laboratory based on digital impedance bridges}, pages = {064002}, keywords = {signal generator, synthesizer, voltage, calibration, metrology, impedance,AC Josephson effect}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab6f2e}, stag_bib_extends_levelofaccess = {NA}, author = {Kucera, J. and Kov{\'a}č, J. and Palafox, L. and Behr, R. and Voj{\'a}čkov{\'a}, L.} } @Article { BaumannBKEZ2020, subid = {1497}, title = {Monte Carlo calculation of beam quality correction factors in proton beams using TOPAS/GEANT4}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {3}, volume = {65}, number = {5}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {055015}, keywords = {radiotherapy dosimetry, protons}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab6e53}, stag_bib_extends_levelofaccess = {NA}, author = {Baumann, K-S. and Kaupa, S. and Bach, C. and Engenhart-Cabillic, R. and Zink, K.} } @Article { TangSLKNBMSCKMKBNMKKSSDPvM2020, subid = {1473}, title = {Clinical quantitative cardiac imaging for the assessment of myocardial ischaemia}, journal = {Nature Reviews Cardiology}, year = {2020}, month = {2}, day = {24}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, keywords = {cardiac imaging, myocardial ischaemia}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1759-5002, 1759-5010}, DOI = {10.1038/s41569-020-0341-8}, stag_bib_extends_levelofaccess = {NA}, author = {Dewey, M. and Siebes, M. and Kachelrie{\ss}, M. and Kofoed, K.F. and Maurovich-Horvat, P. and Nikolaou, K. and Bai, W. and Kofler, A. and Manka, R. and Kozerke, S. and Chiribiri, A. and Schaeffter, T. and Michallek, F. and Bengel, F. and Nekolla, S. and Knaapen, P. and Lubberink, M. and Senior, R. and Tang, M-X. and Piek, J.J. and van de Hoef, T. and Martens, J. and Schreiber, L.} } @Article { GogyanKBZ2020, subid = {1481}, title = {Characterisation and feasibility study for superradiant lasing in 40Ca atoms}, journal = {Optics Express}, year = {2020}, month = {2}, day = {24}, volume = {28}, number = {5}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {6881}, keywords = {optical clock, superradiance}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.381991}, stag_bib_extends_levelofaccess = {NA}, author = {Gogyan, A. and Kazakov, G. and Bober, M. and Zawada, M.} } @Article { BehlerU2020, subid = {2542}, title = {Activation in human auditory cortex in relation to the loudness and unpleasantness of low-frequency and infrasound stimuli}, journal = {PLOS ONE}, year = {2020}, month = {2}, day = {21}, volume = {15}, number = {2}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {e0229088}, keywords = {loudness, infrasound, functional resonance imaging, annoyance}, misc2 = {EMPIR 2015: Health}, publisher = {Public Library of Science (PLoS)}, language = {30}, ISSN = {1932-6203}, DOI = {10.1371/journal.pone.0229088}, stag_bib_extends_levelofaccess = {NA}, author = {Behler, O. and Uppenkamp, S.} } @Techreport { WeberHSRDBMHKMENHSW2020, subid = {1431}, title = {Document specifying rules for the secure use of DCC covering legal aspects of metrology}, journal = {Zenodo}, year = {2020}, month = {2}, day = {12}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {digital calibration certificate (DCC) cryptography minimum requirements data communication IoT-communication IoT-networking SmartCom}, web_url = {https://zenodo.org/record/3664211\#.XlO2QTFKhaR}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.3664211}, stag_bib_extends_levelofaccess = {NA}, author = {Weber, H. and Hutzschenreuter, D. and Smith, I. and Rhodes, S. and Dawkins, J. and Brown, C. and Maennel, O. and Hovhannisyan, K. and Kuosmanen, P. and Mustap{\"a}{\"a}, T. and Elo, T. and Nikander, P. and Heeren, W. and Sch{\"o}nhals, S. and Wiedenh{\"o}fer, Th.} } @Article { HuynhMOKABKI2020, subid = {1432}, title = {Measurement setup for differential spectral responsivity of solar cells}, journal = {Optical Review}, year = {2020}, month = {2}, day = {12}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Radiometry, Solar cell, Spectral responsivity, Efficacy, Electricity, Bifacial}, web_url = {https://link.springer.com/article/10.1007\%2Fs10043-020-00584-x}, misc2 = {EMPIR 2016: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1340-6000, 1349-9432}, DOI = {10.1007/s10043-020-00584-x}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}rh{\"a}, P. and Baumgartner, H. and Askola, J. and Kylm{\"a}nen, K. and Oksanen, B. and Maham, K. and Huynh, V. and Ikonen, E.} } @Article { BeyerKP2020, subid = {1356}, title = {An unfolding algorithm for high resolution microcalorimetric beta spectrometry}, journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment}, year = {2020}, month = {2}, volume = {953}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {163128}, keywords = {Beta spectrometry, Unfolding, Deconvolution, Microcalorimeter, Monte Carlo Simulation, Bremsstrahlung}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2019.163128}, stag_bib_extends_levelofaccess = {NA}, author = {Paulsen, M. and Kossert, K. and Beyer, J.} } @Proceedings { ObatonKRMBACD2020, subid = {1759}, title = {Reference standards for XCT measurements of additively manufactured parts }, journal = {Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020}, year = {2020}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {152}, keywords = {X-ray computed tomography (XCT), dimensional metrology, reference standards, additive manufacturing}, web_url = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {10th Conference on Industrial Computed Tomography (iCT 2020)}, event_date = {04-02-2020 to 07-02-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf}, author = {Obaton, A. and Klingaa, C. and Rivet, C. and Mohaghegh, K. and Baier, S. and Andreasen, J. and Carli, L. and De Chiffre, L.} } @Proceedings { BircherMT2020, subid = {1757}, title = {X-ray source tracking to compensate focal spot drifts for dimensional CT measurements}, journal = {Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020}, year = {2020}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {110}, keywords = {industrial CT, X-ray tube, focal spot drift, CT geometry compensation, dimensional metrology}, web_url = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id110.pdf}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {10th Conference on Industrial Computed Tomography (iCT 2020)}, event_date = {04-02-2020 to 07-02-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id110.pdf}, author = {Bircher, B. and Meli, F. and Thalmann, R.} } @Manual { PearceABEdIKS2020, subid = {1766}, title = {Guidelines on the Calibration of Thermocouples: EURAMET Calibration Guide No. 8}, year = {2020}, month = {2}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, keywords = {Thermocouples, calibration, thermoelectric, thermometry, ITS-90, EMPRESS 2}, web_url = {https://www.euramet.org/publications-media-centre/calibration-guidelines/}, misc2 = {EMPIR 2017: Industry}, publisher = {EURAMET}, address = {Braunschweig}, language = {30}, ISBN = {ISBN 978-3-942992-57-2}, ISSN = {N/A}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISBN 978-3-942992-57-2}, author = {Pearce, J. and Arifovic, N. and Bojkovski, J. and Edler, F. and de Groot, M. and Izquierdo, G.G. and Kalemci, M. and Strnad, R.} } @Article { BiaekVGAGFU2020, subid = {1904}, title = {Monte Carlo–Based Quantification of Uncertainties in Determining Ocean Remote Sensing Reflectance from Underwater Fixed-Depth Radiometry Measurements}, journal = {Journal of Atmospheric and Oceanic Technology}, year = {2020}, month = {2}, volume = {37}, number = {2}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {177-196}, keywords = {Monte Carlo, Ocean colour, Uncertainty evaluation, Radiometry}, misc2 = {EMPIR 2016: Environment}, publisher = {American Meteorological Society}, language = {30}, ISSN = {0739-0572, 1520-0426}, DOI = {10.1175/JTECH-D-19-0049.1}, stag_bib_extends_levelofaccess = {NA}, author = {Białek, A. and Vellucci, V. and Gentil, B. and Antoine, D. and Gorro{\~n}o, J. and Fox, N. and Underwood, C.} } @Proceedings { IurlaroSMIBMCFMIPD2020, subid = {2019}, title = {DOSE RATE DATA OF MEASURING INSTRUMENTS USED IN NONGOVERNMENTAL NETWORKS (MINNs) IN THE FRAMEWORK OF PREPAREDNESS EMPIR PROJECT}, journal = {EUROSAFE}, year = {2020}, month = {2}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, keywords = {dose rate, measuring instruments, non-governmental networks, preparedness}, web_url = {http://www.etson.eu/sites/default/files/eurosafes/2019/EUROSAFE2019_Proceedings.pdf}, misc2 = {EMPIR 2016: Environment}, event_place = {Cologne}, event_name = {EUROSAFE 2019}, event_date = {04-11-2019 to 05-11-2019}, language = {30}, ISBN = {978-3-947685-51-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {978-3-947685-51-6}, author = {Iurlaro, G. and Sperandio, L. and Morosh, V. and ŽIivanovic, M. and Bell, S. and Mariotti, F. and Campani, L. and Ferrari, P. and Morelli, B. and Ioannidis, S. and Pantelić, G. and De Cort, M.} } @Article { OverneyPBKBJ2020, subid = {1546}, title = {Load compensation bridge for Josephson arbitrary waveform synthesizers}, journal = {Measurement Science and Technology}, year = {2020}, month = {1}, day = {31}, volume = {31}, number = {5}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {055004}, keywords = {Load compensation bridge for Josephson arbitrary}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab62c7}, stag_bib_extends_levelofaccess = {NA}, author = {Overney, F. and Pimsut, Y. and Bauer, S. and Kieler, O. and Behr, R. and Jeanneret, B.} } @Article { WiekhorstLMSJB2020, subid = {1504}, title = {Quantitative 2D Magnetorelaxometry Imaging of Magnetic Nanoparticles Using Optically Pumped Magnetometers}, journal = {Sensors}, year = {2020}, month = {1}, day = {29}, volume = {20}, number = {3}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {753}, keywords = {magnetic nanoparticles; optically pumped magnetometers; magnetorelaxometry imaging}, web_url = {https://www.mdpi.com/1424-8220/20/3/753/htm}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20030753}, stag_bib_extends_levelofaccess = {NA}, author = {Jaufenthaler, A. and Schier, P. and Middelmann, T. and Liebl, M. and Wiekhorst, F. and Baumgarten, D.} } @Article { SchwarzSSBKLMCS2020, subid = {1540}, title = {Coherent laser spectroscopy of highly charged ions using quantum logic}, journal = {Nature}, year = {2020}, month = {1}, day = {29}, volume = {578}, number = {7793}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {60-65}, keywords = {spectroscopy highly charged ions atomic clocks3}, web_url = {https://arxiv.org/abs/2010.15984}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0028-0836, 1476-4687}, DOI = {10.1038/s41586-020-1959-8}, stag_bib_extends_levelofaccess = {NA}, author = {Schwarz, M. and Schm{\"o}ger, L. and Spie{\ss}, L.J. and Benkler, E. and King, S.A. and Leopold, T. and Micke, P. and Crespo L{\'o}pez-Urrutia, J.R. and Schmidt, P.O.} } @Article { HatanoMKTIGFTHGGB2020, subid = {1394}, title = {Spectroscopic investigations of negatively charged tin-vacancy centres in diamond}, journal = {New Journal of Physics}, year = {2020}, month = {1}, day = {23}, volume = {22}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {013048}, keywords = {colour centres, diamond, tin-vacancy centre, single photons,Fourier-limited Emission lines,electron–Phonon scattering}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab6631/pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab6631}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}rlitz, J. and Herrmann, D. and Thiering, G. and Fuchs, P. and Gandil, M. and Iwasaki, T. and Taniguchi, T. and Kieschnick, M. and Meijer, J. and Hatano, M. and Gali, A. and Becher, C.} } @Article { BurnellLRvHBNSRMHBFZM2020, subid = {1425}, title = {Diameter-independent skyrmion Hall angle observed in chiral magnetic multilayers}, journal = {Nature Communications}, year = {2020}, month = {1}, day = {22}, volume = {11}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {skyrmion motion, spin-orbit torque}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-14232-9}, stag_bib_extends_levelofaccess = {NA}, author = {Zeissler, K. and Finizio, S. and Barton, C. and Huxtable, A.J. and Massey, J. and Raabe, J. and Sadovnikov, A.V. and Nikitov, S.A. and Brearton, R. and Hesjedal, T. and van der Laan, G. and Rosamond, M.C. and Linfield, E.H. and Burnell, G. and Marrows, C.H.} } @Article { SetionoBNXFKUDFSWP2020, subid = {2362}, title = {In-Plane and Out-of-Plane MEMS Piezoresistive Cantilever Sensors for Nanoparticle Mass Detection}, journal = {Sensors}, year = {2020}, month = {1}, day = {22}, volume = {20}, number = {3}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {618}, keywords = {MEMS piezoresistive cantilever sensors, dynamic mode, carbon nanoparticle, particle mass measurement}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20030618}, stag_bib_extends_levelofaccess = {NA}, author = {Setiono, A. and Bertke, M. and Nyang’au, W.O. and Xu, J. and Fahrbach, M. and Kirsch, I. and Uhde, E. and Deutschinger, A. and Fantner, E.J. and Schwalb, C. H. and Wasisto, H.S. and Peiner, E.} } @Article { SarjonenRBSB2020, subid = {1391}, title = {A Versatile Capacitive Sensing Platform for the Assessment of the Composition in Gas Mixtures}, journal = {Micromachines}, year = {2020}, month = {1}, day = {21}, volume = {11}, number = {2}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {116}, keywords = {energy  transition;  gas  composition  sensor;  capacitive  sensor  array;  interdigitated  electrodes; responsive coatings; tunable filter infrared spectrometer; LNG; biogas}, tags = {EnG}, web_url = {https://www.mdpi.com/2072-666X/11/2/116/pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, address = {Postfach Basel CH-4005 Switzerland}, language = {30}, ISSN = {2072-666X}, DOI = {10.3390/mi11020116}, stag_bib_extends_levelofaccess = {NA}, author = {Sweelssen, J. and Blokland, H. and Rajamaki, T. and Sarjonen, R. and Boersma, A.} } @Article { FortmeierSLMSHBBKSE2020, subid = {1374}, title = {Round robin comparison study on the form measurement of optical freeform surfaces}, journal = {Journal of the European Optical Society-Rapid Publications}, year = {2020}, month = {1}, volume = {16}, number = {1}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, keywords = {Freeform optical surfaces, Metrology, Interlaboratory comparison}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1990-2573}, DOI = {10.1186/s41476-019-0124-1}, stag_bib_extends_levelofaccess = {NA}, author = {Fortmeier, I. and Schachtschneider, R. and L{\'e}dl, V. and Matoušek, O. and Siepmann, J. and Harsch, A. and Beisswanger, R. and Bitou, Y. and Kondo, Y. and Schulz, M. and Elster, C.} } @Article { MinkMFMZSBSMNAAL2020, subid = {1399}, title = {Experimental Low-Latency Device-Independent Quantum Randomness}, journal = {Physical Review Letters}, year = {2020}, month = {1}, volume = {124}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {quantum randomness}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.124.010505}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1812.07786}, author = {Zhang, Y. and Shalm, L.K. and Bienfang, J.C. and Stevens, M.J. and Mazurek, M.D. and Nam, S.W. and Abell{\'a}n, C. and Amaya, W. and Mitchell, M.W. and Fu, H. and Miller, C.A. and Mink, A. and Knill, E.} } @Article { LeviBTCLL2020, subid = {1397}, title = {Sideband-Enhanced Cold Atomic Source for Optical Clocks}, journal = {Physical Review Applied}, year = {2020}, month = {1}, volume = {13}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {014013}, keywords = {Optical Lattice Clock,cold atomic sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.13.014013}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1909.05810}, author = {Barbiero, M. and Tarallo, M.G. and Calonico, D. and Levi, F. and Lamporesi, G. and Ferrari, G.} } @Article { ZilbertiKLGCBAZ2020, subid = {1334}, title = {Accuracy Assessment of Numerical Dosimetry for the Evaluation of Human Exposure to Electric Vehicle Inductive Charging Systems}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2020}, volume = {ea}, number = {ea}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-12}, keywords = {Basic restrictions, electric vehicles, electro-magnetic fields, inductive charging, numerical dosimetry, safety}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2019.2954111}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Bottauscio, O. and Chiampi, M. and Giaccone, L. and Liorni, I. and Kuster, N. and Zilberti, L. and Zucca, M.} } @Article { GoenagaInfantePRdBAC2020, subid = {1417}, title = {The accurate determination of number concentration of inorganic nanoparticles using spICP-MS with the dynamic mass flow approach}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, keywords = {nanoparticles, nanoparticle number concentration, spICP-MS, inorganic nanoparticles, Au nanoparticles, TiO2 nanoparticles}, web_url = {https://pubs.rsc.org/en/content/articlepdf/2020/ja/c9ja00415g}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, DOI = {10.1039/c9ja00415g}, stag_bib_extends_levelofaccess = {NA}, author = {Cuello-Nu{\~n}ez, S. and Abad-{\'A}lvaro, I. and Bartczak, D. and del Castillo Busto, M.E. and Ramsay, D.A. and Pellegrino, F. and Goenaga-Infante, H.} } @Article { GuoPBGPKHU2020, subid = {1494}, title = {Interaction of nanoparticle properties and X-ray analytical techniques}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, volume = {35}, number = {5}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {1022-1033}, keywords = {X-ray Standing Wavefield, GIXRF, TXRF, NEXAFS, Core-Shell Nanoparticles}, web_url = {https://arxiv.org/abs/2004.02955}, misc2 = {EMPIR 2016: Environment}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/D0JA00049C}, stag_bib_extends_levelofaccess = {NA}, author = {Unterumsberger, R. and Honicke, P. and Kayser, Y. and Pollakowski-Herrmann, B. and Gholhaki, S. and Guo, Q. and Palmer, R.E. and Beckhoff, B.} } @Article { BinkowskiBCHZB2020, subid = {1557}, title = {Quasinormal mode expansion of optical far-field quantities}, journal = {Physical Review B}, year = {2020}, volume = {102}, number = {3}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {035432}, keywords = {near field to far field transformation, numerical simulation}, web_url = {https://arxiv.org/abs/2003.11305}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.102.035432}, stag_bib_extends_levelofaccess = {NA}, author = {Binkowski, F. and Betz, F. and Colom, R. and Hammerschmidt, M. and Zschiedrich, L. and Burger, S.} } @Article { FlierlRBMS2020, subid = {1598}, title = {Absolute isotope ratios of carbon dioxide – a feasibility study}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, keywords = {Gas Metrology, SI traceability, Carbon Dioxide refrence maerial}, web_url = {https://pubs.rsc.org/is/content/articlelanding/2020/ja/d0ja00318b\#!divAbstract}, misc2 = {EMPIR 2016: Environment}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/d0ja00318b}, stag_bib_extends_levelofaccess = {NA}, author = {Flierl, L. and Rienitz, O. and Brewer, P.J. and Meijer, H.A.J. and Steur, F.M.} } @Article { ArrheniusFBAELR2020, subid = {1602}, title = {Analytical methods for the determination of oil carryover from CNG/biomethane refueling stations recovered in a solvent}, journal = {RSC Advances}, year = {2020}, volume = {10}, number = {20}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, pages = {11907-11917}, keywords = {Biomethane oilcarryoveranaytical method}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2046-2069}, DOI = {10.1039/D0RA01399D}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Fischer, A. and B{\"u}ker, O. and Adrien, H. and El Masri, A. and Lestremau, F. and Robinson, T.} } @Article { BurkeUK2020, subid = {1644}, title = {A psychoacoustical study to investigate the perceived unpleasantness of infrasound combined with audio-frequency sound}, journal = {Acta Acustica}, year = {2020}, volume = {4}, number = {5}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {20}, keywords = {Infrasound / Unpleasantness / Psychoacoustic scaling methods / Detection threshold}, misc2 = {EMPIR 2015: Health}, publisher = {EDP Sciences}, language = {30}, ISSN = {2681-4617}, DOI = {10.1051/aacus/2020019}, stag_bib_extends_levelofaccess = {NA}, author = {Burke, E. and Uppenkamp, S. and Koch, C.} } @Article { WanslebenVWBHBK2020, subid = {1685}, title = {Speciation of iron sulfide compounds by means of X-ray emission spectroscopy using a compact full-cylinder von Hamos spectrometer}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, volume = {35}, number = {11}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {2679-2685}, keywords = {-}, web_url = {https://arxiv.org/abs/2005.09509}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/D0JA00244E}, stag_bib_extends_levelofaccess = {NA}, author = {Wansleben, M. and Vinson, J. and W{\"a}hlisch, A. and Bzheumikhova, K. and Honicke, P. and Beckhoff, B. and Kayser, Y.} } @Article { PetriniMBTTCDG2020, subid = {1713}, title = {Is a Quantum Biosensing Revolution Approaching? Perspectives in NV‐Assisted Current and Thermal Biosensing in Living Cells}, journal = {Advanced Quantum Technologies}, year = {2020}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {2000066}, keywords = {color centers, diamond, biosensing}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, DOI = {10.1002/qute.202000066}, stag_bib_extends_levelofaccess = {NA}, author = {Petrini, G. and Moreva, E. and Bernardi, E. and Traina, P. and Tomagra, G. and Carabelli, V. and Degiovanni, I.P. and Genovese, M.} } @Article { BernardiMTPDFPDOG2020, subid = {1712}, title = {A biocompatible technique for magnetic field sensing at (sub)cellular scale using Nitrogen-Vacancy centers}, journal = {EPJ Quantum Technology}, year = {2020}, volume = {7}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {13}, keywords = {NV centers, Quantum sensing, Magnetic measurements}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1140/epjqt/s40507-020-00088-2}, stag_bib_extends_levelofaccess = {NA}, author = {Bernardi, E. and Moreva, E. and Traina, P. and Petrini, G. and Ditalia Tchernij, S. and Forneris, J. and Pastuović, Ž. and Degiovanni, I.P. and Olivero, P. and Genovese, M.} } @Article { HorenzTBNAGV2020, subid = {1716}, title = {A Study on the Analysis of Particle Size Distribution for Bimodal Model Nanoparticles by Electron Microscopy}, journal = {Microscopy and Microanalysis}, year = {2020}, volume = {26}, number = {S2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {2282}, keywords = {nanoparticles, size traceability, bi-modal distribution, silica, gold, electron microscoopy}, web_url = {https://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/study-on-the-analysis-of-particle-size-distribution-for-bimodal-model-nanoparticles-by-electron-microscopy/B9157A370AC198219A734770694340F3}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, address = {Cambridge}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927620021054}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}renz, C. and Tache, O. and Bartczak, D. and Nunez, S. and Abad Alvaro, I. and Goenaga-Infante, H. and Vasile-Dan Hodoroaba, V-D.} } @Proceedings { HahtelaKLMMPYBGKMMPP2020, subid = {1810}, title = {Coulomb Blockade Thermometry on a Wide Temperature Range}, journal = {Proceedings of 2020 Conference on Precision Electromagnetic Measurements (CPEM 2020)}, year = {2020}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, keywords = {Temperature measurement, thermometers, cryogenics, nanoelectronics, tunneling, single electron devices}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Denver (Aurora), CO, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM 2020)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2101.03932}, author = {Hahtela, O.M. and Kemppinen, A. and Lehtinen, J. and Manninen, A.J. and Mykk{\"a}nen, E. and Prunnila, M. and Yurttag{\"u}l, N. and Blanchet, F. and Gramich, M. and Karimi, B. and Mannila, E.T. and Muhojoki, J. and Peltonen, J.T. and Pekola, J.P.} } @Article { CuelloNunezABdRPG2020, subid = {1848}, title = {The accurate determination of number concentration of inorganic nanoparticles using spICP-MS with the dynamic mass flow approach}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, volume = {35}, number = {9}, number2 = {18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration}, pages = {1832-1839}, keywords = {number concentration, spICP-MS, nanoparticle}, misc2 = {EMPIR 2018: Support for Impact}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/C9JA00415G}, stag_bib_extends_levelofaccess = {NA}, author = {Cuello-Nu{\~n}ez, S. and Abad-{\'A}lvaro, I. and Bartczak, D. and Del Castillo Busto, M.E. and Ramsay, D.A. and Pellegrino, F. and Goenaga-Infante, H.} } @Article { CaraMSGRCDHKBMZCLBF2020, subid = {1829}, title = {Towards a traceable enhancement factor in surface-enhanced Raman spectroscopy}, journal = {Journal of Materials Chemistry C}, year = {2020}, volume = {8}, number = {46}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {16513-16519}, keywords = {Raman spectroscopy (SERS)}, misc2 = {EMPIR 2016: Environment}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2050-7526, 2050-7534}, DOI = {10.1039/D0TC04364H}, stag_bib_extends_levelofaccess = {NA}, author = {Cara, E. and Mandrile, L. and Sacco, A. and Giovannozzi, A.M. and Rossi, A.M. and Celegato, F. and De Leo, N. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Marchi, D. and Zoccante, A. and Cossi, M. and Laus, M. and Boarino, L. and Ferrarese Lupi, F.} } @Article { OchoaBTC2020, subid = {1870}, title = {Challenges and opportunities for an efficiency boost of next generation Cu(In,Ga)Se2 solar cells: prospects for a paradigm shift}, journal = {Energy \& Environmental Science}, year = {2020}, volume = {13}, number = {7}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {2047-2055}, keywords = {CIGS, metrology}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {1754-5692, 1754-5706}, DOI = {10.1039/D0EE00834F}, stag_bib_extends_levelofaccess = {NA}, author = {Ochoa, M. and Buecheler, S. and Tiwari, A.N. and Carron, R.} } @Article { SachseBSHHKNL2020, subid = {2015}, title = {Colloidal bimetallic platinum–ruthenium nanoparticles in ordered mesoporous carbon films as highly active electrocatalysts for the hydrogen evolution reaction}, journal = {Catalysis Science \& Technology}, year = {2020}, volume = {10}, number = {7}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {2057-2068}, keywords = {Hydrogen, Nanoparticles, Hyrdrogen evolution reaction (HER)}, web_url = {https://pubs.rsc.org/en/content/articlelanding/2020/CY/C9CY02285F\#!divAbstract}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2044-4753, 2044-4761}, DOI = {10.1039/C9CY02285F}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Bernsmeier, D. and Schmack, R. and H{\"a}usler, I. and Hertwig, A. and Kraffert, K. and Nissen, J. and Lewis, H.} } @Article { BernardiMTPDFPDOG20200, subid = {1712}, title = {A biocompatible technique for magnetic field sensing at (sub)cellular scale using Nitrogen-Vacancy centers}, journal = {EPJ Quantum Technology}, year = {2020}, volume = {7}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {13}, keywords = {NV centers, Quantum sensing, Magnetic measurements}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1140/epjqt/s40507-020-00088-2}, stag_bib_extends_levelofaccess = {NA}, author = {Bernardi, E. and Moreva, E. and Traina, P. and Petrini, G. and Ditalia Tchernij, S. and Forneris, J. and Pastuović, Ž. and Degiovanni, I.P. and Olivero, P. and Genovese, M.} } @Article { BurkeUK2020_2, subid = {2543}, title = {A psychoacoustical study to investigate the perceived unpleasantness of infrasound combined with audio-frequency sound}, journal = {Acta Acustica}, year = {2020}, volume = {4}, number = {5}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {20}, keywords = {annoyance, infrasound, unpleaseantness, hearing experiment}, misc2 = {EMPIR 2015: Health}, publisher = {EDP Sciences}, language = {30}, ISSN = {2681-4617}, DOI = {10.1051/aacus/2020019}, stag_bib_extends_levelofaccess = {NA}, author = {Burke, E. and Uppenkamp, S. and Koch, C.} } @Proceedings { ZhangHLBAJN2019, subid = {1422}, title = {Deep Learning Applied to Attractor Images Derived from ECG Signals for Detection of Genetic Mutation}, journal = {2019 Computing in Cardiology Conference (CinC)}, year = {2019}, month = {12}, day = {30}, volume = {46}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {097}, keywords = {Symmetric Projection Attractor Reconstruction, ECG signals, transfer learning}, web_url = {http://www.cinc.org/archives/2019/pdf/CinC2019-097.pdf}, misc2 = {EMPIR 2018: Health}, publisher = {Computing in Cardiology}, event_place = {Singapore}, event_name = {Computing in Cardiology}, event_date = {08-09-2019 to 11-09-2019}, language = {30}, ISSN = {2325-887X}, DOI = {10.22489/CinC.2019.097}, stag_bib_extends_levelofaccess = {NA}, author = {Aston, P. and Lyle, J. and Bonet-Luz, E. and Huang, C. and Zhang, Y. and Jeevaratnam, K. and Nandi, M.} } @Article { ArrheniusBBdHM2019, subid = {1820}, title = {Hydrogen Purity Analysis: Suitability of Sorbent Tubes for Trapping Hydrocarbons, Halogenated Hydrocarbons and Sulphur Compounds}, journal = {Applied Sciences}, year = {2019}, month = {12}, day = {23}, volume = {10}, number = {1}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {120}, keywords = {hydrogen; fuel cells; hydrogen vehicle; sorbent; thermal desorption; hydrogen quality}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app10010120}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, Karine and Bohlen, Haleh and B{\"u}ker, Oliver and de Krom, Iris and Heikens, Dita and Murugan, Arul} } @Article { BrunoGCBPL2019, subid = {1400}, title = {Narrowband photon pairs with independent frequency tuning for quantum light-matter interactions}, journal = {Optics Express}, year = {2019}, month = {12}, day = {18}, volume = {27}, number = {26}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {38463}, keywords = {Parametric Down-conversion, Photon correlation, photon entnglement}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.382474}, stag_bib_extends_levelofaccess = {NA}, author = {Prakash, V. and Bianchet, Lorena C. and Cuairan, M.T. and Gomez, P. and Bruno, N. and Mitchell, M.W.} } @Article { ZilbertiCBBA2019, subid = {1328}, title = {In silico evaluation of the thermal stress induced by MRI switched gradient fields in patients with metallic hip implant}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {12}, day = {13}, volume = {64}, number = {24}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {245006}, keywords = {dosimetry, magnetic resonance imaging (MRI), MR safety, gradient coils, medical implants, prostheses, numerical simulation}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab5428}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Bottauscio, O. and Br{\"u}hl, R. and Chiampi, M. and Zilberti, L.} } @Article { SchinkeFBN2019, subid = {1641}, title = {Implementation and uncertainty evaluation of spectral stray light correction by Zong’s method}, journal = {Applied Optics}, year = {2019}, month = {12}, day = {13}, volume = {58}, number = {36}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {9998}, keywords = {spectral stray light, spectrometer, measurement uncertainty analysis}, misc2 = {EMPIR 2016: Energy}, publisher = {The Optical Society}, language = {30}, ISSN = {1559-128X, 2155-3165}, DOI = {10.1364/AO.58.009998}, stag_bib_extends_levelofaccess = {NA}, author = {Schinke, C. and Franke, M. and Bothe, K. and Nevas, S.} } @Article { KungBM2019, subid = {1762}, title = {Low-Cost 2D Index and Straightness Measurement System Based on a CMOS Image Sensor}, journal = {Sensors}, year = {2019}, month = {12}, day = {11}, volume = {19}, number = {24}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {5461}, keywords = {2D position sensor, 2D index sensor, straightness sensor, machine tool geometry correction}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s19245461}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ng, A. and Bircher, B.A. and Meli, F.} } @Article { GomezFGLDBMFMMGARPABCDH2019, subid = {1260}, title = {Hydrogen fuel quality from two main production processes: Steam methane reforming and proton exchange membrane water electrolysis}, journal = {Journal of Power Sources}, year = {2019}, month = {12}, volume = {444}, number2 = {15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications}, pages = {227170}, keywords = {Fuel cell electrical vehicles, ISO14687, Gas analysis, Hydrogen production, Hydrogen quality}, web_url = {https://www.sciencedirect.com/science/article/pii/S0378775319311632}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0378-7753}, DOI = {10.1016/j.jpowsour.2019.227170}, stag_bib_extends_levelofaccess = {NA}, author = {Bacquart, T. and Arrhenius, K. and Persijn, S. and Rojo, A. and Aupr{\^e}tre, F. and Gozlan, B. and Moore, N. and Morris, A. and Fischer, A. and Murugan, A. and Bartlett, S. and Doucet, G. and Laridant, F. and Gernot, E. and Fern{\'a}ndez, T. E. and G{\'o}mez, C. and Carr{\'e}, M. and De Reals, G. and Haloua, F.} } @Article { TrusheimFGBA2019, subid = {1315}, title = {Quantum nanophotonics with group IV defects in diamond}, journal = {Nature Communications}, year = {2019}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {5625}, keywords = {diamond, photonics, quantum optics, color centers, quantum technologies}, web_url = {https://www.nature.com/articles/s41467-019-13332-w}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-13332-w}, stag_bib_extends_levelofaccess = {NA}, author = {Bradac, C. and Gao, W. and Forneris, J. and Trusheim, M. E. and Aharonovich, I.} } @Article { LeviHVBH2019, subid = {1398}, title = {Cavity-enhanced non-destructive detection of atoms for an optical lattice clock}, journal = {Optics Express}, year = {2019}, month = {12}, volume = {27}, number = {26}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {37099}, keywords = {Non destructive measurement, Optical Lattice Clocks}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.037099}, stag_bib_extends_levelofaccess = {NA}, author = {Hobson, R. and Bowden, W. and Vianello, A. and Hill, I.R. and Gill, P.} } @Article { BenklerLPWRS2019, subid = {1661}, title = {End-to-end topology for fiber comb based optical frequency transfer at the 10−21 level}, journal = {Optics Express}, year = {2019}, month = {12}, volume = {27}, number = {25}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {36886}, keywords = {optical frequency combs, stability transfer}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.036886}, stag_bib_extends_levelofaccess = {NA}, author = {Benkler, E. and Lipphardt, B. and Puppe, T. and Wilk, R. and Rohde, F. and Sterr, U.} } @Article { RanitzschABBBEKKLMNPRW2019, subid = {1729}, title = {MetroMMC: Electron-Capture Spectrometry with Cryogenic Calorimeters for Science and Technology}, journal = {Journal of Low Temperature Physics}, year = {2019}, month = {12}, volume = {199}, number = {1-2}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {441-450}, keywords = {Electron-capture decay, Metallic magnetic calorimeter, Radionuclide metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0022-2291, 1573-7357}, DOI = {10.1007/s10909-019-02278-4}, stag_bib_extends_levelofaccess = {NA}, author = {Ranitzsch, P.C-O. and Arnold, D. and Beyer, J. and Bockhorn, L. and Bonaparte, J.J. and Enss, C. and Kossert, K. and Kempf, S. and Loidl, M. and Mariam, R. and N{\"a}hle, O. J. and Paulsen, M. and Rodrigues, M. and Wegner, M.} } @Article { BockhornPBKLNRR2019, subid = {1355}, title = {Improved Source/Absorber Preparation for Radionuclide Spectrometry Based on Low-Temperature Calorimetric Detectors}, journal = {Journal of Low Temperature Physics}, year = {2019}, month = {11}, day = {30}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, keywords = {Beta spectrometry, Preparation techniques, Low-temperature detectors}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0022-2291, 1573-7357}, DOI = {10.1007/s10909-019-02274-8}, stag_bib_extends_levelofaccess = {NA}, author = {Bockhorn, L. and Paulsen, M. and Beyer, J. and Kossert, K. and Loidl, M. and N{\"a}hle, O. J. and Ranitzsch, P. C.-O. and Rodrigues, M.} } @Article { RibeiroPBAM2019, subid = {1427}, title = {Method selection to evaluate measurement uncertainty in microflow applications}, journal = {Journal of Physics: Conference Series}, year = {2019}, month = {11}, day = {29}, volume = {1379}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {012033}, keywords = {Uncertainty, microflow, Monte Carlo method, Bayesian method}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1379/1/012033/pdf}, misc2 = {EMPIR 2018: Health}, publisher = {IOP science}, language = {30}, ISSN = {17426588}, DOI = {10.1088/1742-6596/1379/1/012033}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Batista, E. and Pellegrino, O. and Ribeiro, {\'A}. and Martins, L.} } @Article { GeislerNBHSRKWHTHMSU2019, subid = {1316}, title = {Determining the Thickness and Completeness of the Shell of Polymer Core–Shell Nanoparticles by X-ray Photoelectron Spectroscopy, Secondary Ion Mass Spectrometry, and Transmission Scanning Electron Microscopy}, journal = {The Journal of Physical Chemistry C}, year = {2019}, month = {11}, day = {26}, number2 = {17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses}, keywords = {Nanoparticles, core-shell, XPS, SIMS, T-SEM, polymer}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.9b09258}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, A. and Heinrich, T. and Tougaard, S. and Werner, W. S. M. and Hronek, M. and Kunz, V. and Radnik, J. and Stockmann, J. M. and Hodoroaba, V-D. and Benemann, S. and Nirmalananthan-Budau, N. and Gei{\ss}ler, D. and Sparnacci, K. and Unger, W. E. S } } @Article { KashcheyevsFBJLSGFRK2019, subid = {1312}, title = {Continuous-variable tomography of solitary electrons}, journal = {Nature Communications}, year = {2019}, month = {11}, day = {22}, volume = {10}, number = {1}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, keywords = {Single electron, Electron wave packet, Tomography}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-13222-1}, stag_bib_extends_levelofaccess = {NA}, author = {Fletcher, J. D. and Johnson, N. and Locane, E. and See, P. and Griffiths, J. P. and Farrer, I. and Ritchie, D. A. and Brouwer, P. W. and Kashcheyevs, V. and Kataoka, M.} } @Article { BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019, subid = {2340}, title = {The Metrological Traceability, Performance and Precision of European Radon Calibration Facilities}, journal = {International Journal of Environmental Research and Public Health}, year = {2019}, month = {11}, day = {21}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, keywords = {radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.3390/ijerph182212150}, stag_bib_extends_levelofaccess = {NA}, author = {Beck, T.R. and Antohe, A. and Cardellini, F. and Cucoş, A. and Fialova, E. and Grossi, C. and Hening, K. and Jensen, J. and Kastratović, D. and Krivoš{\'i}k, M. and Lobner, P. and Luca, A. and Maringer, F.J. and Michielsen, N. and Otahal, P.P.S. and Quindos, L. and Rabago, D. and Sainz, C. and Sz{\"u}cs, L. and Teodorescu, T. and Tolinsson, C. and Tugulan, C.L. and Turtiainen, T. and Vargas, A. and Vosahlik, J. and Vukoslavovic, G. and Wiedner, H. and Wołoszczuk, K.} } @Article { GeorgievMDBD2019, subid = {1560}, title = {Partition Coefficients and Diffusion Lengths of 222Rn in Some Polymers at Different Temperatures}, journal = {International Journal of Environmental Research and Public Health}, year = {2019}, month = {11}, day = {15}, volume = {16}, number = {22}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {4523}, keywords = {Partition Coefficients and Diffusion Lengths of 222Rn in Some Polymers at Different Temperatures}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, address = {Postfach Basel CH-4005 Switzerland}, language = {30}, ISSN = {1660-4601}, DOI = {10.3390/ijerph16224523}, stag_bib_extends_levelofaccess = {NA}, author = {Georgiev, Strahil and Mitev, Krasimir and Dutsov, Chavdar and Boshkova, Tatiana and Dimitrova, Ivelina} } @Manual { SmithHWB2019, subid = {1448}, title = {Document describing a universal and flexible structure for digital calibration certificates (DCC)}, year = {2019}, month = {11}, day = {11}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {digital calibration certificate (DCC), data communication, IoT-communication, IoT-networking SmartCom, minimum requirements}, misc2 = {EMPIR 2017: Industry}, publisher = {SmartCom}, language = {30}, DOI = {10.5281/zenodo.3696567}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, I. and Hutzschenreuter, D. and Wiedenh{\"o}fer, T. and Brown, C.} } @Article { RanitzschPNMKKEBBLRS2019, subid = {1234}, title = {Beta spectrometry with metallic magnetic calorimeters in the framework of the European EMPIR project MetroBeta}, journal = {Applied Radiation and Isotopes}, year = {2019}, month = {11}, volume = {153}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {108830}, keywords = {Beta spectrometry; Metallic magnetic calorimeter; Ionizing radiation metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2019.108830}, stag_bib_extends_levelofaccess = {NA}, author = {Loidl, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Mariam, R. and N{\"a}hle, O. and Paulsen, M. and Ranitzsch, P. and Rodrigues, M. and Schmidt, M.} } @Article { IkonenKOB2019, subid = {1286}, title = {Optical Characterization of III-V Multijunction Solar Cells for Temperature-Independent Band Gap Features}, journal = {IEEE Journal of Photovoltaics}, year = {2019}, month = {11}, volume = {9}, number = {6}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {1631-1636}, keywords = {Band gap, light-emitting diode (LED), spectral response, temperature, III-V solar cells}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2019.2933190}, stag_bib_extends_levelofaccess = {NA}, author = {Baumgartner, H. and Oksanen, B. and K{\"a}rh{\"a}, P. and Ikonen, E.} } @Article { KlenovskyBMASS2019, subid = {1361}, title = {Optical response of (InGa)(AsSb)/GaAs quantum dots embedded in a GaP matrix}, journal = {Physical Review B}, year = {2019}, month = {11}, volume = {100}, number = {19}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {electronic structure, quantum dot}, web_url = {https://arxiv.org/abs/1906.09842}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.195407}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Marr{\'o}n, D.F. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { KipperHLBPHLV2019, subid = {1406}, title = {Retention of acidic and basic analytes in reversed phase column using fluorinated and novel eluent additives for liquid chromatography-tandem mass spectrometry}, journal = {Journal of Chromatography A}, year = {2019}, month = {11}, volume = {in press}, number = {in press}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {460667}, keywords = {Eluent additivesHFIPHFTBPPNFTBRetention mechanisms}, web_url = {https://www.sciencedirect.com/search/advanced?qs=Retention\%20of\%20acidic\%20and\%20basic\&pub=Journal\%20of\%20Chromatography\%20A\&cid=271409\&volumes=0\&lastSelectedFacet=volumes}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-9673}, DOI = {10.1016/j.chroma.2019.460667}, stag_bib_extends_levelofaccess = {NA}, author = {Veigure, R. and Lossmann, K. and Hecht, M. and Parman, E. and Born, R. and Leito, I. and Herodes, K. and Kipper, K.} } @Article { RibeiroPBSM2019, subid = {1419}, title = {Method selection to evaluate measurement uncertainty in microflow applications}, journal = {Journal of Physics: Conference Series}, year = {2019}, month = {11}, volume = {1379}, number = {2019}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, pages = {012033}, keywords = {microflow, medicine, neonatology, oncology, measurement uncertainty, GUM, Monte Carlo}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1379/1/012033}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Batista, E. and Pellegrino, O. and Ribeiro, A.S. and Martins, L.L.} } @Manual { EloKnKALSZSFRBSHWHHHNHMMHP2019, subid = {1433}, title = {SmartCom Digital System of Units (D-SI) Guide for the use of the metadata-format used in metrology for the easy-to-use, safe, harmonised and unambiguous digital transfer of metrological data}, year = {2019}, month = {11}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Digital-SI (D-SI) metrology data digital exchange format SmartCom data communication IoT-networking IoT-communication}, web_url = {https://zenodo.org/record/3522631\#.XlTbaTFKhaQ}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.3522631}, stag_bib_extends_levelofaccess = {NA}, author = {Elo, T. and Kuosmanen, P. and  Mustap{\"a}{\"a}, T. and Klobucar, R. and Acko, B. and Linkeov{\'a}, I. and S{\'y}kora, J. and Zelen{\'y}, V. and Smith, I. and Forbes, A. and Rhodes, S. and Brown, C. and Scheibner, A. and Hackel, S.G. and Wiedenh{\"o}fer, T. and Heeren, W. and Haertig, F. and Hutschenreuter, D. and Nikander, P. and Hovhannisyan, K. and Maennel, O. and Muller, B. and Heindorf, L. and Paciello, V.} } @Techreport { SmithWHHB2019, subid = {1434}, title = {D-SI in Short - Digital brochure on establishing the use of units in digitalised communication}, journal = {Zenodo}, year = {2019}, month = {11}, volume = {1}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Digital-SI (D-SI) data communication IoT-communication IoT-networking metrology data SmartCom digital exchange format}, web_url = {https://zenodo.org/record/3522074\#.XlTiRTFKhaQ}, misc2 = {EMPIR 2017: Industry}, publisher = {SmartCom}, language = {30}, DOI = {10.5281/zenodo.3522074}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, I. and Wiedenh{\"o}fer, T. and Haertig, F. and Hutschenreuter, D. and Brown, C.} } @Article { AlveseSousaMB2019, subid = {1426}, title = {Calibration of insulin pumps}, journal = {Journal of Diabetes and Treatment}, year = {2019}, month = {11}, volume = {4}, number = {3}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {1075}, keywords = {Calibration, measurement, microflow, insulin pump, gravimetry, optical method}, misc2 = {EMPIR 2018: Health}, publisher = {Gavin Publishers}, language = {30}, ISSN = {2574-7568}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.gavinpublishers.com/assets/articles_pdf/1575449809article_pdf938882132.pdf}, author = {Sousa, J.A. and Martins, R. and Batista, E.} } @Thesis { Bogen2019, subid = {1367}, title = {Frequenz-, Leistungs- und Positionsstabilisierung von UV-Lasersystemen fur Frequenzmetrologie mit hochgeladenen Ionen, Master Thesis, Ruprecht-Karls-Universitat, Heidelberg (2019)}, year = {2019}, month = {10}, day = {28}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {Optical ClockTrapped Ions}, web_url = {https://pure.mpg.de/rest/items/item_3175862_1/component/file_3175863/content}, misc2 = {EMPIR 2017: Fundamental}, school = {Ruprecht-Karls-Universit{\"a}t, Heidelberg}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/21.11116/0000-0005-1733-8}, author = {Bogen, S.} } @Article { BinghamWSTMFZSRKH2019, subid = {1353}, title = {Formation of N{\'e}el-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy}, journal = {Physical Review B}, year = {2019}, month = {10}, day = {25}, volume = {100}, number = {14}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {144435}, keywords = {Skyrmions, DMI, spin waves}, web_url = {https://arxiv.org/abs/1910.04515}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.144435}, stag_bib_extends_levelofaccess = {NA}, author = {Saha, S. and Zelent, M. and Finizio, S. and Mruczkiewicz, M. and Tacchi, S. and Suszka, A. K. and Wintz, S. and Bingham, N. S. and Raabe, J. and Krawczyk, M. and Heyderman, L. J.} } @Article { CalonicoLRBBP2019, subid = {1443}, title = {Absolute frequency measurement of the1S0 –3P0 transition of171Yb with a link to International Atomic Time}, journal = {Metrologia}, year = {2019}, month = {10}, day = {24}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {optical lattice clock, SI second, frequency metrology}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab50e8}, stag_bib_extends_levelofaccess = {NA}, author = {Pizzocaro, M. and Bregolin, F. and Barbieri, P. and Rauf, . and Levi, F. and Calonico, D.} } @Article { KayserUWBWHH2019, subid = {1269}, title = {Experimental determination of line energies, line widths and relative transition probabilities of the Gadolinium L x-ray emission spectrum}, journal = {Metrologia}, year = {2019}, month = {10}, day = {21}, volume = {56}, number = {6}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {065007}, keywords = {x-ray spectrometry, von Hamos spectrometer, rare earth metal, x-ray metrology, HAPG, gadolinium, atomic fundamental parameters}, web_url = {https://arxiv.org/abs/1903.08085}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab40d2}, stag_bib_extends_levelofaccess = {NA}, author = {Wansleben, M. and Kayser, Y. and Honicke, P. and Holfelder, I. and W{\"a}hlisch, A. and Unterumsberger, R. and Beckhoff, B.} } @Article { MarcqMHGFCBBTBMWW2019, subid = {1248}, title = {RadCalNet: A Radiometric Calibration Network for Earth Observing Imagers Operating in the Visible to Shortwave Infrared Spectral Range}, journal = {Remote Sensing}, year = {2019}, month = {10}, day = {16}, volume = {11}, number = {2401}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {20}, keywords = {RadCalNet, CEOS, radiometric calibration, SI-traceable, surface reflectance, network, instrument}, web_url = {https://doi.org/10.3390/rs11202401\&\#160;}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs11202401}, stag_bib_extends_levelofaccess = {NA}, author = {Bouvet, M. and Thome, K. and Berthelot, B. and Bialek, A. and Czapla-Myers, J. and Fox, N. and Goryl, P. and Henry, P. and Ma, L. and Marcq, S. and Meygret, A. and Wenny, B. and Woolliams, E.} } @Article { PfleidererRRLBAPWB2019, subid = {1313}, title = {Ferromagnetic Resonance with Magnetic Phase Selectivity by Means of Resonant Elastic X-Ray Scattering on a Chiral Magnet}, journal = {Physical Review Letters}, year = {2019}, month = {10}, day = {14}, volume = {123}, number = {16}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {Skyrmions, X-ray scattering, Ferromagnetic resonance}, web_url = {https://arxiv.org/abs/1909.08293}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.123.167201}, stag_bib_extends_levelofaccess = {NA}, author = {P{\"o}llath, S. and Aqeel, A. and Bauer, A. and Luo, C. and Ryll, H. and Radu, F. and Pfleiderer, C. and Woltersdorf, G. and Back, C. H.} } @Article { AlvesBLLPB2019, subid = {1401}, title = {Maltese cross coupling to individual cold atoms in free space}, journal = {Optics Express}, year = {2019}, month = {10}, day = {11}, volume = {27}, number = {21}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {31042}, keywords = {Sub-Pissonian statistics, photon anti bounching}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.031042}, stag_bib_extends_levelofaccess = {NA}, author = {Bruno, Natalia and Bianchet, Lorena C. and Prakash, Vindhiya and Li, Nan and Alves, Nat{\'a}lia and Mitchell, M.W.} } @Article { BochudNHLJJ2019, subid = {1231}, title = {Development and validation of a double focalizing magnetic spectrometer for beta spectrum measurements}, journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment}, year = {2019}, month = {10}, volume = {942}, number = {21 October}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {162384}, keywords = {magnetic spectrometer, beta shape measurement, acquisition system, Cl-36}, web_url = {https://reader.elsevier.com/reader/sd/pii/S0168900219309684?token=9907411027790E1C7A6500A4337D2D10E57E40E772BECF66298808C0FD62E4F989D02F38F9DA80F8EEB0FCC5EF556A53}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2019.162384}, stag_bib_extends_levelofaccess = {NA}, author = {Juget, F. and Juget, F. and Lorusso, G. and Haefeli, G. and Nedjadi, Y. and Bochud, F.} } @Article { BurgerHZB2019, subid = {1249}, title = {Modal analysis for nanoplasmonics with nonlocal material properties}, journal = {Physical Review B}, year = {2019}, month = {10}, volume = {100}, number = {15}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {155406}, keywords = {Nanophotonics, Plasmonic, Drude model, Electromagnetic wave theory, Finite-element method}, web_url = {https://arxiv.org/abs/1906.01941}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.155406}, stag_bib_extends_levelofaccess = {NA}, author = {Binkowski, F. and Zschiedrich, L. and Hammerschmidt, M. and Burger, S.} } @Article { LaihoSSKHSBWR2019, subid = {2617}, title = {Photon-number parity of heralded single photons from a Bragg-reflection waveguide reconstructed loss-tolerantly via moment generating function}, journal = {New Journal of Physics}, year = {2019}, month = {10}, volume = {21}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {103025}, keywords = {factorial moment of photon number, photon-number parity, moment generating function, parametric down-conversion, Bragg-reflection waveguide, transition-edge sensor}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab42ae}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab42ae}, stag_bib_extends_levelofaccess = {NA}, author = {Laiho, K. and Schmidt, M. and Suchomel, H. and Kamp, M. and H{\"o}fling, S. and Schneider, C. and Beyer, J. and Weihs, G. and Reitzenstein, S.} } @Proceedings { BagciHYTAGD2019, subid = {1325}, title = {Improvement of dynamic pressure standard for calibration of dynamic pressure transducers}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number = {2019}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, keywords = {dynamic pressure, measurement, calibration, drop mass, dynamic calibration machine}, misc2 = {EMPIR 2017: Industry}, publisher = {EDP Sciences}, address = {17 av. du Hoggar PA de Courtaboeuf BP 112 PA de Courtaboeuf BP 112 Les Ulis cedex A 91944 France}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201927009}, stag_bib_extends_levelofaccess = {NA}, author = {Durgut, Y. and Ganioglu, O. and Aydemir, B. and Turk, A. and Yilmaz, R. and Hamarat, A. and Bağcı, E.} } @Proceedings { CucciaSBLvAMCVSBPCT2019, subid = {1781}, title = {Development of standardized methods for the analysis of amines, terpenes and ammonia in biomethane}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, keywords = {biomethane, terpenes, amines, ammonia}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201906001}, stag_bib_extends_levelofaccess = {NA}, author = {Cuccia, L. and Sanz, B. and Ballestas Castro, D. and Li, J. and van der Veen, A.M.H. and Amico di Meane, E. and Moreno, S. and Culleton, L.P. and Vorin, D. and Senn{\'e}, C. and Bougueroua, F. and Pyr{\'e}e, L. and Courtois, Y. and Tastard, C.} } @Article { HohlsBL2019, subid = {1310}, title = {Time-energy filtering of single electrons in ballistic waveguides}, journal = {New Journal of Physics}, year = {2019}, month = {9}, day = {19}, volume = {21}, number = {9}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {093042}, keywords = {Single electrons, time-energy filtering}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab3fbb}, stag_bib_extends_levelofaccess = {NA}, author = {Locane, E. and Brouwer, P.W. and Kashcheyevs, V.} } @Article { BurgerHSGSR2019, subid = {1291}, title = {Benchmarking Five Global Optimization Approaches for Nano-optical Shape Optimization and Parameter Reconstruction}, journal = {ACS Photonics}, year = {2019}, month = {9}, day = {17}, volume = {6}, number = {11}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {2726-2733}, keywords = {shape optimization, parameter reconstruction, machine learning, global optimization, Bayesian optimization}, web_url = {https://arxiv.org/abs/1809.06674}, misc2 = {EMPIR 2017: Fundamental}, publisher = {ACS}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.9b00706}, stag_bib_extends_levelofaccess = {NA}, author = {Schneider, P.I. and Garcia Santiago, X. and Soltwisch, Vi. and Hammerschmidt, M. and Burger, S. and Rockstuhl, C.} } @Article { MayrBWHFMRWZ2019, subid = {1370}, title = {Deterministic Field-Free Skyrmion Nucleation at a Nanoengineered Injector Device}, journal = {Nano Letters}, year = {2019}, month = {9}, day = {17}, volume = {19}, number = {10}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {7246-7255}, keywords = {Skyrmion; nanomagnetism, spin-orbit torque}, web_url = {https://arxiv.org/abs/1902.10435}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Contract \#: 19-0000016470-01 PO \#: 6000110532 Columbus Ohio 43210 United States}, language = {30}, ISSN = {1530-6984, 1530-6992}, DOI = {10.1021/acs.nanolett.9b02840}, stag_bib_extends_levelofaccess = {NA}, author = {Finizio, S. and Zeissler, K. and Wintz, S. and Mayr, S. and We{\ss}els, T. and Huxtable, A.J. and Burnell, G. and Marrows, C.H. and Raabe, J.} } @Article { BlakesleyK2019, subid = {1951}, title = {Energy Rating for Evaluating Performance of Perovskite and Perovskite-on-Silicon Tandem Devices in Real-World Conditions}, journal = {36th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2019}, month = {9}, day = {13}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {623 - 628}, keywords = {Energy Rating Perovskite Based Photovoltaics}, web_url = {https://zenodo.org/record/4055579}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {3-936338-60-4}, author = {Blakesley, J.C. and Koutsourakis, G. } } @Article { BremerFPRSHW2019, subid = {1804}, title = {Cesium‐Vapor‐Based Delay of Single Photons Emitted by Deterministically Fabricated Quantum Dot Microlenses}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {9}, day = {12}, volume = {3}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1900071}, keywords = {atomic vapors delays deterministic fabrication quantum dots single‐photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900071}, stag_bib_extends_levelofaccess = {NA}, author = {Bremer, L. and Fischbach, S. and Park, S‐I. and Rodt, S. and Song, J‐Dong. and Heindel, T. and Weber, N.} } @Article { PalonenOKBLGG2019, subid = {1293}, title = {Laser Spectroscopy for Monitoring of Radiocarbon in Atmospheric Samples}, journal = {Analytical Chemistry}, year = {2019}, month = {9}, day = {10}, volume = {91}, number = {19}, number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities}, pages = {12315-12320}, keywords = {Radiocarbon, Laser spectroscopy}, web_url = {https://pubs.acs.org/doi/10.1021/acs.analchem.9b02496}, misc2 = {EMPIR 2016: Environment}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0003-2700, 1520-6882}, DOI = {10.1021/acs.analchem.9b02496}, stag_bib_extends_levelofaccess = {NA}, author = {Genoud, G. and Genoud, G. and Lehmuskoski, J. and Bell, S. and Palonen, V. and Oinonen, M. and Koskinen-Soivi, M.L.} } @Proceedings { ChiampiBAZ2019, subid = {1271}, title = {Uncertainty propagation in phaseless electric properties tomography}, journal = {2019 International Conference on Electromagnetics in Advanced Applications (ICEAA)}, year = {2019}, month = {9}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, keywords = {magnetic resonance imaging (MRI), phaseless contrast source inversion (CSI), electric properties tomography (EPT), uncertainty propagation, Monte Carlo method}, web_url = {https://arxiv.org/abs/1911.02809}, misc2 = {EMPIR 2018: Health}, publisher = {IEEE}, event_place = {Granada}, event_name = {2019 International Conference on Electromagnetics in Advanced Applications}, event_date = {09-09-2019 to 13-09-2019}, language = {30}, DOI = {10.1109/ICEAA.2019.8879147}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, Alessandro and Bottauscio, O. and Chiampi, M. and Zilberti, L.} } @Article { Bossew2019, subid = {1289}, title = {Radon Priority Areas and Radon Extremes – Initial Statistical Considerations}, journal = {Radiation Environment and Medicine}, year = {2019}, month = {9}, volume = {8}, number = {2}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {94-104}, keywords = {radon priority area, anomaly, extreme}, misc2 = {EMPIR 2016: Environment}, publisher = {Hirosaki University press}, language = {30}, ISSN = {2423-9097}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://crss.hirosaki-u.ac.jp/wp-content/files_mf/1568795052Web_REMVol828_PeterBossew.pdf}, author = {Bossew, P.} } @Proceedings { KrokerWSKB2019, subid = {1282}, title = {Sub-Wavelength Features in Spectroscopic Mueller Matrix Ellipsometry}, journal = {Deutsche Gesellschaft f{\"u}r angewandte Optik Proceedings 2019}, year = {2019}, month = {9}, volume = {120}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Gratings, Measurement Technology, Scatterometry}, web_url = {https://www.dgao-proceedings.de/download/120/120_p9.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Deutsche Gesellschaft f{\"u}r angewandte Optik e.V. (DGaO)}, event_place = {Darmstadt}, event_name = {120. Jahrestagung der Deutschen Gesellschaft f{\"u}r angewandte Optik}, event_date = {11-06-2019 to 15-06-2019}, language = {30}, ISSN = {1614-8436}, stag_bib_extends_levelofaccess = {NA}, author = {Kroker, Stefanie and Wurm, Matthias and Siefke, Thomas and K{\"a}seberg, Tim and Bodermann, Bernd} } @Proceedings { BermbachSHTL2019, subid = {1294}, title = {Guards and Watchdogs in One-Way Synchronization with Delay-Related Authentication Mechanisms}, journal = {2019 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, year = {2019}, month = {9}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-6}, keywords = {Synchronization, Protocols, Servers, Cryptography, Clocks, Global navigation satellite system}, tags = {SEG}, web_url = {https://doi.org/10.1109/ISPCS.2019.8886633}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Portland (Oregon) United States}, event_name = {International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication}, event_date = {22-09-2019 to 27-09-2019}, language = {30}, ISBN = {978-1-5386-7607-3, 978-1-5386-}, ISSN = {1949-0313, 1949-0305}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.17IND06.CA.20191126}, author = {Bermbach, R. and Sibold, D. and Heine, K. and Teichel, K. and Langer, M.} } @Proceedings { LuisoRBCM2019, subid = {1295}, title = {Setup and Characterisation of Reference Current-to-Voltage Transformers for Wideband Current Transformers Calibration up to 2 kA}, journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2019}, month = {9}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {64-69}, keywords = {wideband, current transformers, calibration, measurement uncertainty, instrument transformers, power quality}, tags = {SEG}, web_url = {https://doi.org/10.1109/AMPS.2019.8897759}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Aachen, Germany}, event_name = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems}, event_date = {25-09-2019 to 27-09-2019}, language = {30}, ISBN = {978-1-7281-0075-3, 978-1-7281-}, ISSN = {2475-2304, 2473-1315}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1109/AMPS.2019.8897759}, author = {Luiso, M. and Rather, P. and Badura, H. and Chen, Y. and Mohns, E.} } @Article { ReitzensteinSZBRDDDMWPOMKSSGSMoU2019, subid = {1363}, title = {Method for direct coupling of a semiconductor quantum dot to an optical fiber for single-photon source applications}, journal = {Optics Express}, year = {2019}, month = {9}, volume = {27}, number = {19}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {26772}, keywords = {semiconductor quantum dot, single-photon source}, web_url = {https://www.osapublishing.org/DirectPDFAccess/08FE2392-996C-94FE-814D27FFE5E6D46E_418606/oe-27-19-26772.pdf?da=1\&id=418606\&seq=0\&mobile=no}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.026772}, stag_bib_extends_levelofaccess = {NA}, author = {Żołnacz, K. and Musiał, A. and Srocka, N. and Gro{\ss}e, J. and Schl{\"o}singer, M.J. and Schneider, P-I. and Kravets, O. and Mikulicz, M. and Olszewski, J. and Poturaj, K. and W{\'o}jcik, G. and Mergo, P. and Dybka, K. and Dyrkacz, M. and Dłubek, M. and Rodt, S. and Burger, S. and Zschiedrich, L. and Sęk, G. and Reitzenstein, S. and Urbańczyk, W.} } @Article { RietveldKvWB2019, subid = {1377}, title = {Detection Methods for Current Signals Causing Errors in Static Electricity Meters}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {Power Quality Electricity Meters Short Time Fourier Transform Wavelet Transform Multiresolution Signal Decomposition Wavelets Smart Meters}, web_url = {https://zenodo.org/record/3582153\#.XiGzUXu7KUm}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/EMCEurope.2019.8872120}, stag_bib_extends_levelofaccess = {NA}, author = {Barakou, F. and Wright, P.S. and van den Brom, H.E. and Kok, G.J.P and Rietveld, G.} } @Proceedings { MarrowsKGDCCBSK2019, subid = {1428}, title = {Measuring Interfacial Dzyaloshinskii-Moriya Interaction: A Review}, journal = {Proceedings}, year = {2019}, month = {9}, volume = {26}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {41}, keywords = {Dzyaloshinskii-Moriya interaction}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, event_place = {Ferrara}, event_name = {XXXVII International Symposium on Dynamical Properties of Solids}, event_date = {08-09-2019 to 12-09-2019}, language = {30}, ISSN = {2504-3900}, DOI = {10.3390/proceedings2019026041}, stag_bib_extends_levelofaccess = {NA}, author = {Back, C. and Carlotti, G. and Casiraghi, A. and Durin, G. and Garcia-Sanchez, F. and Kuepferling, M. and Marrows, C. and Soares, G. and Tacchi, S.} } @Article { KellmanMRSBXORNIRMGNPC2019, subid = {1474}, title = {Simultaneous 13N-Ammonia and gadolinium first-pass myocardial perfusion with quantitative hybrid PET-MR imaging: a phantom and clinical feasibility study}, journal = {European Journal of Hybrid Imaging}, year = {2019}, month = {9}, volume = {3}, number = {1}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, keywords = {myocardial perfusion, hybrid PET-MR}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2510-3636}, DOI = {10.1186/s41824-019-0062-6}, stag_bib_extends_levelofaccess = {NA}, author = {Nazir, M.S. and Gould, S-M. and Milidonis, X. and Reyes, E. and Ismail, T.F. and Neji, R. and Roujol, S. and O’Doherty, J. and Xue, H. and Barrington, S.F. and Schaeffter, T. and Razavi, R. and Marsden, P. and Kellman, P. and Plein, S. and Chiribiri, A.} } @Thesis { Barbiero2019, subid = {1812}, title = {Novel techniques for a Strontium Optical Lattice Clock}, year = {2019}, month = {9}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Sr OLC, Laser cooling,}, web_url = {http://hdl.handle.net/11583/2750550}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Politecnico Torino}, school = {Politecnico di Torino}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/11583/2750550}, author = {Barbiero, M.} } @Proceedings { SeferiCBMS2019, subid = {1964}, title = {Power Quality Event Analysis in 25 kV 50 Hz AC Railway System Networks}, journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2019}, month = {9}, volume = {1}, number = {1}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Railway transportation power systems, power quality, power system transients, voltage interruption}, web_url = {https://strathprints.strath.ac.uk/70058/}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Aachen, Germany}, event_name = {International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {25-09-2019 to 27-09-2012}, language = {30}, ISBN = {978-1-7281-0075-3}, ISSN = {2475-2304g}, DOI = {10.1109/AMPS.2019.8897765}, stag_bib_extends_levelofaccess = {NA}, author = {Seferi, Y. and Clarkson, P. and Blair, S.M. and Mariscotti, A. and Stewart, B.G.} } @Proceedings { LuisoLGFSGCBD2019, subid = {1946}, title = {Monitoring Energy and Power Quality On Board Train}, journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2019}, month = {9}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Power and Energy measurement, Railway system, Energy saving, Reversible Substation, DC Power Quality}, web_url = {https://zenodo.org/record/4598462}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Dubrovnik, Croatia}, event_name = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {25-05-2020 to 28-05-2020}, language = {30}, ISBN = {978-1-7281-0075-3}, ISSN = {2475-2304}, DOI = {10.1109/AMPS.2019.8897794}, stag_bib_extends_levelofaccess = {NA}, author = {Luiso, M. and Landi, C. and Gallo, D. and Femine, A.D. and Signorino, D. and Giordano, D. and Crotti, G. and Biancucci, A. and Donadio, L.} } @Proceedings { SauzayRJBBWS2019, subid = {1302}, title = {Estimating Uncertainty in Loss Measurement of Power Transformers}, journal = {Proceedings of the 21st International Symposium on High Voltage Engineering}, year = {2019}, month = {8}, day = {30}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {power transformers, losses, measurement, uncertainty.}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Budapest}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3559837}, stag_bib_extends_levelofaccess = {NA}, author = {Sauzay, M. and Rietveld, G. and J{\"o}nsson, B. and Bergman, A. and Bergman, A. and Walmsley, J. and Sund, J-B.} } @Proceedings { KaramanDMEBHHRGG2019, subid = {1186}, title = {Comparison of PD calibration capabilities in four National Metrology Institutes down to 0.1 pC}, journal = {Proceedings of ISH2019}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {partial discharge, calibration}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3243449}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Bergman, A.E. and Elg, A-P. and Merev, A. and Dedeoğlu, S. and Karaman, I. and Rovira, J. and Garcia, T. and Garnacho, F.} } @Inbook { RuttingerPGCPSKBJSBSWWS2019, subid = {1193}, title = {European Research on Magnetic Nanoparticles for Biomedical Applications: Standardisation Aspects}, year = {2019}, month = {8}, day = {23}, volume = {Advances i}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {316-326}, keywords = {magnetic nanoparticles, standardisation European research}, web_url = {https://arxiv.org/abs/1905.08791}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer International Publishing}, address = {Cham}, booktitle = {Current Trends in Biomedical Engineering and Bioimages Analysis. PCBEE 2019.}, language = {30}, ISBN = {978-3-030-29884-5}, DOI = {10.1007/978-3-030-29885-2_29}, stag_bib_extends_levelofaccess = {NA}, author = {Schier, Peter and Barton, Craig and Spassov, Simo and Johansson, Christer and Baumgarten, Daniel and Kazakova, Olga and Southern, Paul and Pankhurst, Quentin and Coisson, Marco and Gr{\"u}ttner, Cordula and Price, Alex and R{\"u}ttinger, Roman and Wiekhorst, Frank and Wells, James and Steinhoff, Uwe} } @Proceedings { VentreMDBCFPPRSTBASSGHBZFDKL2019, subid = {1200}, title = {Metrology for Inductive Charging of Electric Vehicles (MICEV)}, journal = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, year = {2019}, month = {8}, day = {19}, volume = {Electrical}, number = {2019 AEIT}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {6 pages}, keywords = {Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety}, tags = {SEG}, web_url = {http://arxiv.org/abs/1908.11108}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Turin (Italy)}, event_name = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, event_date = {02-07-2019 to 04-07-2019}, language = {30}, ISBN = {978-8-8872-3743-6}, ISSN = {0018-9219}, DOI = {10.23919/EETA.2019.8804498}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Bottauscio, O. and Harmon, S. and Guilizzoni, R. and Schilling, F. and Schmidt, M. and Ankarson, P. and Bergsten, T. and Tammi, K. and Sainio, P. and Romero, J.B. and Puyal, E.L. and Pichon, L. and Freschi, F. and Cirimele, V. and Bauer, P. and Dong, J. and Maffucci, A. and Ventre, S. and Femia, N. and Di Capua, G. and Kuster, N. and Liorni, I.} } @Article { GomaZHB2019, subid = {1331}, title = {Comparison of PENH, FLUKA and Geant4/TOPAS for absorbed dose calculations in air cavities representing ionization chambers in high‐energy photon and proton beams}, journal = {Medical Physics}, year = {2019}, month = {8}, day = {19}, volume = {46}, number = {10}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {4639-4653}, keywords = {beam quality correction factors, dosimetry, high‐energy photon and proton radiation, Monte Carlo simulation, radiation therapy}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.13737}, stag_bib_extends_levelofaccess = {NA}, author = {Baumann, K.‐S. and Horst, F. and Zink, K. and Gom{\`a}, C.} } @Article { WendischPMWIBABOKK2019, subid = {1057}, title = {Optical Pulse-Drive for the Pulse-Driven AC Josephson Voltage Standard}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2019}, month = {8}, volume = {29}, number = {5}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {1200205}, keywords = {Optical pulses, Optical fibers, Optical distortion, High-speed optical techniques, Optical attenuators, Optical crosstalk}, web_url = {https://ieeexplore.ieee.org/document/8643521}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2019.2899851}, stag_bib_extends_levelofaccess = {NA}, author = {Kieler, O. and Karlsen, B. and Ohlckers, P.A. and Bardalen, E. and Akram, M.N. and Behr, R. and Ireland, J. and Williams, J. and Malmbekk, H. and Palafox, L. and Wendisch, R.} } @Article { NahleMLKKEBBPRR2019, subid = {1235}, title = {Development of a beta spectrometry setup using metallic magnetic calorimeters}, journal = {Journal of Instrumentation}, year = {2019}, month = {8}, volume = {14}, number = {08}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {P08012-P08012}, keywords = {Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/14/08/P08012}, stag_bib_extends_levelofaccess = {NA}, author = {Paulsen, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Loidl, M. and Mariam, R. and N{\"a}hle, O. and Ranitzsch, P. and Rodrigues, M.} } @Article { NahleMLKKEBBPRR20190, subid = {1235}, title = {Development of a beta spectrometry setup using metallic magnetic calorimeters}, journal = {Journal of Instrumentation}, year = {2019}, month = {8}, volume = {14}, number = {08}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {P08012-P08012}, keywords = {Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/14/08/P08012}, stag_bib_extends_levelofaccess = {NA}, author = {Paulsen, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Loidl, M. and Mariam, R. and N{\"a}hle, O. and Ranitzsch, P. and Rodrigues, M.} } @Article { ChouhaniFiPBJVH2019, subid = {2041}, title = {A Unique Interactive Nanostructure Knitting based Passive Sampler Adsorbent for Monitoring of Hg2+ in Water}, journal = {Sensors}, year = {2019}, month = {8}, volume = {19}, number = {15}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {3432}, keywords = {Nanostructure Knitting based Passive Sampler , Hg2+, Water}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s19153432}, stag_bib_extends_levelofaccess = {NA}, author = {Chouhan, R.S. and Žitko, G. and Fajon, V. and Živković, I. and Pavlin, M. and Berisha, S. and Jerman, I. and Vesel, A. and Horvat, M.} } @Article { BausiKBC2019, subid = {1736}, title = {High-speed digital light source photocurrent mapping system}, journal = {Measurement Science and Technology}, year = {2019}, month = {7}, day = {30}, volume = {30}, number = {9}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {095902}, keywords = {High-speed digital light source photocurrent mapping system}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab1f40}, stag_bib_extends_levelofaccess = {NA}, author = {Bausi, F. and Koutsourakis, G. and Blakesley, J.C. and Castro, F.A.} } @Article { GennserCPBBMCKCRMBJDH2019, subid = {1311}, title = {Quantum tomography of electrical currents}, journal = {Nature Communications}, year = {2019}, month = {7}, day = {29}, volume = {10}, number = {1}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, keywords = {Electronic wavefunction, Quantum tomography}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-11369-5}, stag_bib_extends_levelofaccess = {NA}, author = {Bisognin, R. and Marguerite, A. and Roussel, B. and Kumar, M. and Cabart, C. and Chapdelaine, C. and Mohammad-Djafari, A. and Berroir, J.-M. and Bocquillon, E. and Pla\c{c}ais, B. and Cavanna, A. and Gennser, U. and Jin, Y. and Degiovanni, P. and F{\`e}ve, G.} } @Article { SOCHOROVARLLKFDCCBBT2019, subid = {1285}, title = {Activity measurements and determination of nuclear decay data of 166Ho in the MRTDosimetry project}, journal = {Applied Radiation and Isotopes}, year = {2019}, month = {7}, day = {20}, volume = {153}, number = {November 2}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {1-11}, keywords = {Ho166, Activity standardization, gamma-spectrometry, Half-life measurements, Molecular radiotherapy, MRTDosimetry}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2019.108826}, stag_bib_extends_levelofaccess = {NA}, author = {Bobin, C. and BOUCHARD, J. and CHISTE, V. and COLLINS, S. and Dry{\'a}k, P. and FENWICK, A. and Keightley, J. and L{\'e}py, M.C. and Lourenco, V. and Robinson, A. and Sochorov{\'a}, J. and THIAM, C.} } @Article { RedshawQPMIHGEDBSRY2019, subid = {1232}, title = {Direct determination of the La138\(\beta\)-decay Q value using Penning trap mass spectrometry}, journal = {Physical Review C}, year = {2019}, month = {7}, day = {11}, volume = {100}, number = {1}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {014308}, keywords = {138La, high-precision Q-values, mass spectrometry, Penning trap}, web_url = {https://arxiv.org/abs/1904.12076v2}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9985, 2469-9993}, DOI = {10.1103/PhysRevC.100.014308}, stag_bib_extends_levelofaccess = {NA}, author = {Sandler, R. and Bollen, G. and Dissanayake, J. and Eibach, M. and Gulyuz, K. and Hamaker, A. and Izzo, C. and Mougeot, X. and Puentes, D. and Quarati, F. G. A. and Redshaw, M. and Ringle, R. and Yandow, I.} } @Article { CalonicoLPCB2019, subid = {1229}, title = {Spectral purity transfer with 5 \(\times\) 10−17 instability at 1 s using a multibranch Er:fiber frequency comb}, journal = {Metrologia}, year = {2019}, month = {7}, volume = {56}, number = {4}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {045008}, keywords = {optical frequency comb, multibranch Er:fiber comb, spectral purity transfer,ultrastable laser}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab2b0f}, stag_bib_extends_levelofaccess = {NA}, author = {Barbieri, P. and Clivati, C. and Pizzocaro, M. and Levi, F. and Calonico, D.} } @Article { PollakowskiMKNDHB2019, subid = {1267}, title = {Reference-free grazing incidence x-ray fluorescence and reflectometry as a methodology for independent validation of x-ray reflectometry on ultrathin layer stacks and a depth-dependent characterization}, journal = {Journal of Vacuum Science \& Technology A}, year = {2019}, month = {7}, volume = {37}, number = {4}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {041502}, keywords = {XRR, GIXRF, nanolayers}, web_url = {https://arxiv.org/abs/1903.01196}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5094891}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Detlefs, B. and Nolot, E. and Kayser, Y. and M{\"u}hle, U. and Pollakowski, B. and Beckhoff, B.} } @Article { SchmidtCOHBMLK2019, subid = {1340}, title = {A cryogenic radio-frequency ion trap for quantum logic spectroscopy of highly charged ions}, journal = {Review of Scientific Instruments}, year = {2019}, month = {7}, volume = {90}, number = {7}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {073201}, keywords = {Optical ClocksTrapped Ions}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5100594}, stag_bib_extends_levelofaccess = {NA}, author = {Leopold, T. and King, S. A. and Micke, P. and Bautista-Salvador, A. and Heip, J. C. and Ospelkaus, C. and Crespo L{\'o}pez-Urrutia, J. R. and Schmidt, P. O.} } @Article { HonickeKMBPD2019, subid = {1270}, title = {Reference-free grazing incidence x-ray fluorescence and reflectometry as a methodology for independent validation of x-ray reflectometry on ultrathin layer stacks and a depth-dependent characterization}, journal = {Journal of Vacuum Science \& Technology A}, year = {2019}, month = {7}, volume = {37}, number = {4}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {041502}, keywords = {nanolayer stacks}, web_url = {https://arxiv.org/abs/1903.01196}, misc2 = {EMPIR 2016: Environment}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5094891}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Detlefs, B. and Kayser, Y. and M{\"u}hle, U. and Pollakowski, B. and Beckhoff, B.} } @Proceedings { HoffmannVQZB2019, subid = {1610}, title = {Fabrication and Measurements of Inductive Devices for Scanning Microwave Microscopy}, journal = {2019 IEEE 19th International Conference on Nanotechnology (IEEE-NANO)}, year = {2019}, month = {7}, volume = {2019}, number = {-}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {1-4}, keywords = {calibration, doping profiles, inductors, scanning probe microscopy, silicon compounds}, web_url = {https://zenodo.org/record/4275929}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Macao}, event_name = {IEEE Nano}, event_date = {22-07-2019 to 26-07-2019}, language = {30}, ISBN = {Electronic ISBN: 978-1-7281-28}, ISSN = {Electronic ISSN: 1944-9380 Pri}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4275929}, author = {Hoffmann, J. and Vasyukov, D. and Quang, T. L. and Ziade, F. and Buchter, A.} } @Article { MurugandBvAtH2019, subid = {1816}, title = {Measurement challenges for hydrogen vehicles}, journal = {International Journal of Hydrogen Energy}, year = {2019}, month = {7}, volume = {44}, number = {35}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {19326-19333}, keywords = {Hydrogen; Fuel cell; Vehicles; ISO 14687; Metrology; Measurement; Flow metering; Quality control}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2019.03.190}, stag_bib_extends_levelofaccess = {NA}, author = {Murugan, A. and de Huu, M. and Bacquart, T. and van Wijk, J. and Arrhenius, K. and te Ronde, I. and Hemfrey, D.} } @Article { KoutsourakisBC2019, subid = {1735}, title = {Signal Amplification Gains of Compressive Sampling for Photocurrent Response Mapping of Optoelectronic Devices}, journal = {Sensors}, year = {2019}, month = {6}, day = {28}, volume = {19}, number = {13}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {2870}, keywords = {non-destructive testing, current mapping, digital micromirror device, compressed sensing}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s19132870}, stag_bib_extends_levelofaccess = {NA}, author = {Koutsourakis, G. and Blakesley, J.C. and Castro, F.A.} } @Article { DRONNEAUFBMG2019, subid = {1275}, title = {Use Of An Imaging Luminance Measuring Device To Evaluate Road Lighting Performance At Different Angles Of Observation}, journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE}, year = {2019}, month = {6}, day = {24}, number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting}, keywords = {road lighting, dynamic luminance measurements, Imaging Luminance Measuring Device (ILMD), moving observer, angles of observation, 16NRM02}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {International Commission on Illumination, CIE}, language = {30}, DOI = {10.25039/x46.2019.OP75}, stag_bib_extends_levelofaccess = {NA}, author = {GREFFIER, F. and Muzet, V. and BOUCHER, V. and FOURNELA, F. and DRONNEAU, R.} } @Article { BrinkmannMSBLI2019, subid = {1322}, title = {3D nonrigid motion correction for quantitative assessment of hepatic lesions in DCE‐MRI}, journal = {Magnetic Resonance in Medicine}, year = {2019}, month = {6}, day = {22}, volume = {82}, number = {5}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, pages = {1753-1766}, keywords = {quantification, nonrigid motion correction, hepatic lesions, DCE-MRI}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.27867}, stag_bib_extends_levelofaccess = {NA}, author = {Ippoliti, M. and Lukas, M. and Brenner, W. and Schaeffter, T. and Makowski, M. R. and Kolbitsch, C.} } @Proceedings { KrokerWSDKB2019, subid = {1281}, title = {Mueller matrix ellipsometry for enhanced optical form metrology of sub-lambda structures}, journal = {Modeling Aspects in Optical Metrology VII}, year = {2019}, month = {6}, day = {21}, volume = {11057}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {155-165}, keywords = {Plasmonics, Ellipsometry, Scanning electron microscopy, Numerical simulations, Metrology, Nanostructures, Near field optics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {SPIE}, event_place = {Munich}, event_name = {International Society for Optics and Photonics Optical Metrology}, event_date = {24-06-2019 to 27-06-2019}, language = {30}, DOI = {10.1117/12.2527419}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}seberg, T. and Dickmann, J. and Siefke, T. and Wurm, M. and Kroker, S. and Bodermann, B.} } @Article { MottonenRKBYFGK2019, subid = {1110}, title = {Evidence for universality of tunable-barrier electron pumps}, journal = {Metrologia}, year = {2019}, month = {6}, day = {13}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Single electron pumps, electrical metrology, quantum electrical standards}, web_url = {https://arxiv.org/abs/1901.05218}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab29a5}, stag_bib_extends_levelofaccess = {NA}, author = {Giblin, S. and Fujiwara, A. and Yamahata, G. and Bae, M.H. and Kim, N. and Rossi, A. and M{\"o}tt{\"o}nen, M. and Kataoka, M.} } @Article { BeckerGKDS2019, subid = {1104}, title = {Electrometer Calibration With Sub-Part-Per-Million Uncertainty}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {1887-1894}, keywords = {Ammeters, calibration, current measurement, measurement standards, measurement uncertainty, precisionmeasurements}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2019.2900129}, stag_bib_extends_levelofaccess = {NA}, author = {Scherer, H. and Drung, D. and Krause, C. and G{\"o}tz, M. and Becker, U.} } @Article { vandenBromHHBKWI2019, subid = {1154}, title = {An Optoelectronic Pulse Drive for Quantum Voltage Synthesizer}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {2066-2071}, keywords = {Josephson arbitrary waveform synthesizer, Josephson arrays, measurement, metrology, optoelectronics, voltage measurement}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2877562}, stag_bib_extends_levelofaccess = {NA}, author = {Ireland, J. and Williams, J. and Kieler, O. and Behr, R. and Houtzager, E. and Hornecker, R. and van den Brom, H.E.} } @Article { BursikovaKC2019, subid = {1250}, title = {Fast mechanical model for probe–sample elastic deformation estimation in scanning probe microscopy}, journal = {Ultramicroscopy}, year = {2019}, month = {6}, volume = {201}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {18-27}, keywords = {Scanning Probe Microscopy,Uncertainty,Elastic deformation}, web_url = {https://www.sciencedirect.com/science/article/pii/S0304399118302638}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2019.03.010}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P. and Charv{\'a}tov{\'a} Campbell, A. and Burš{\'i}kov{\'a}, V. } } @Article { TeodoroFBS2019, subid = {1265}, title = {3D-Simulation of a Bayard Alpert ionisation gauge using SIMION program}, journal = {Vacuum}, year = {2019}, month = {6}, volume = {164}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {300-307}, keywords = {Vacuum measurementIonisation gaugeSimulationGauge sensitivity}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2019.03.039}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, R. and Bundaleski, N. and Fonseca, A.L. and Teodoro, O.} } @Article { KorpelainenBDS2019, subid = {1297}, title = {Tip wear and tip breakage in high-speed atomic force microscopes}, journal = {Ultramicroscopy}, year = {2019}, month = {6}, volume = {201}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {28-37}, keywords = {Atomic force microscopy (AFM), High-speed AFM, Tip wear, Tip breakage, Tip characterization, Tip-sample interaction}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2019.03.013}, stag_bib_extends_levelofaccess = {NA}, author = {Strahlendorff, T. and Dai, G. and Bergmann, D. and Tutsch, R.} } @Proceedings { Buermann2019, subid = {1323}, title = {Steps Towards Personalized Dosimetry in Computed Tomography}, journal = {Book of Extended Synopses}, year = {2019}, month = {6}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, pages = {216-217}, keywords = {dosimetry, personalised medicine, CT}, misc2 = {EMPIR 2015: Health}, publisher = {International Atomic Energy Agency}, event_place = {Vienna, Austria}, event_name = {International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry (IDOS 2019)}, event_date = {18-06-2019 to 21-06-2019}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.iaea.org/sites/default/files/19/06/cn-273-book-extended-synopses.pdf}, author = {B{\"u}ermann, L.} } @Article { IvanovGWRBBR2019, subid = {1128}, title = {Complete dissolution of solid matrices using automated borate fusion in support of nuclear decommissioning and production of reference materials}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2019}, month = {5}, day = {28}, volume = {321}, number = {1}, number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities}, pages = {183-196}, keywords = {Fusion, dissolution, radionuclide, decommissioning, reference material, characterisation}, web_url = {https://link.springer.com/article/10.1007/s10967-019-06572-z}, misc2 = {EMPIR 2016: Environment}, publisher = {Springer Science and Business Media LLC}, address = {233 Spring St. New York NY 10013 United States}, language = {30}, ISSN = {0236-5731, 1588-2780}, DOI = {10.1007/s10967-019-06572-z}, stag_bib_extends_levelofaccess = {NA}, author = {Braysher, E. and Russell, B. and Woods, S. and Garc{\'i}a-Miranda, M. and Ivanov, P. and Bouchard, B. and Read, D.} } @Article { MainzBGWSZW2019, subid = {1206}, title = {Photon flux determination of a liquid-metal jet X-ray source by means of photon scattering}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2019}, month = {5}, day = {23}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, keywords = {Liquid-metal jet, X-ray sources, photon flux determination, elastic and inelastic photon scattering}, web_url = {https://arxiv.org/abs/1903.06024}, misc2 = {EMPIR 2016: Energy}, language = {30}, DOI = {10.1039/C9JA00127A}, stag_bib_extends_levelofaccess = {NA}, author = {Wansleben, M. and Zech, C. and Streeck, C. and Weser, J. and Genzel, C. and Beckhoff, B. and Mainz, R.} } @Article { OliveroBOFCJGSPBFHBER2019, subid = {1261}, title = {Quantum Micro–Nano Devices Fabricated in Diamond by Femtosecond Laser and Ion Irradiation}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {5}, day = {20}, volume = {2}, number = {5-6}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1900006}, keywords = {diamond, ion‐beam irradiation, nitrogen vacancies ,NV magnetometry, quantum sensing, ultrafast laser writing}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900006}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/2318/1704485}, author = {Eaton, S.M. and Hadden, J.P. and Bharadwaj, V. and Forneris, J. and Picollo, F. and Bosia, F. and Sotillo, B. and Giakoumaki, A.N. and Jedrkiewicz, O. and Chiappini, A. and Ferrari, M. and Osellame, R. and Barclay, P.E. and Olivero, P. and Ramponi, R.} } @Article { TibertoCCBMF2019, subid = {1266}, title = {Infuence of shape, size and magnetostatic interactions on the hyperthermia properties of permalloy nanostructures}, journal = {Scientific Reports}, year = {2019}, month = {4}, day = {29}, volume = {9}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {6591}, keywords = {Magnetic nanostructures, Hysteresis losses, Micromagnetic modelling}, web_url = {https://www.nature.com/articles/s41598-019-43197-4}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322 (online)}, DOI = {10.1038/s41598-019-43197-4}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Manzin, A. and Barrera, G. and Celegato, F. and Co{\"i}sson, M. and Tiberto, P.} } @Article { MartinezVerduVVBP2019, subid = {1014}, title = {Graininess characterization by multidimensional scaling}, journal = {Journal of Modern Optics}, year = {2019}, month = {4}, volume = {67}, number = {1}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {1-10}, keywords = {graininess, special-effect pigments, multidimensional scaling algorithm, psychophysical experiment}, web_url = {https://www.tandfonline.com/doi/full/10.1080/09500340.2019.1589006}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Taylor \& Francis}, language = {30}, ISSN = {1362-3044}, DOI = {10.1080/09500340.2019.1589006}, stag_bib_extends_levelofaccess = {NA}, author = {Perales, E. and Burgos, F.J. and Vilaseca, M. and Viqueira, V. and Mart{\'i}nez-Verd{\'u}, F.M.} } @Article { BergstenSSM2019, subid = {1076}, title = {Four-Terminal Pair Digital Sampling Impedance Bridge up to 1MHz}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {4}, volume = {68}, number = {6}, number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements}, pages = {1860 - 1869}, keywords = {Bridge circuits, Impedance, Topology, Uncertainty, Standards, Calibration, Multiplexing, impedance measurement, phase comparators, sampling methods, shunts (electrical)}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2019.2908649}, stag_bib_extends_levelofaccess = {NA}, author = {Maslan, S. and Š{\'i}ra, M. and Skalicka, T. and Bergsten, T.} } @Article { BuechelerTSALWCW2019, subid = {1241}, title = {Time-resolved photoluminescence on double graded Cu(In,Ga)Se2 – Impact of front surface recombination and its temperature dependence}, journal = {Science and Technology of Advanced Materials}, year = {2019}, month = {4}, volume = {20}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {313-323}, keywords = {time-resolved photoluminescence}, misc2 = {EMPIR 2016: Energy}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1468-6996, 1878-5514}, DOI = {10.1080/14686996.2019.1586583}, stag_bib_extends_levelofaccess = {NA}, author = {Weiss, T.P. and Carron, R. and Wolter, M.H. and L{\"o}ckinger, J. and Avancini, E. and Siebentritt, S. and Buecheler, S. and Tiwari, A.N.} } @Article { MehlstaublerOBID2019, subid = {1040}, title = {946-nm Nd:YAG digital-locked laser at 1.1 \(\times\) 10−16 in 1  s and transfer-locked to a cryogenic silicon cavity}, journal = {Optics Letters}, year = {2019}, month = {3}, day = {29}, volume = {44}, number = {7}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {1781}, keywords = {Ultra-stable laser; Nd:YAG; Fabry-Perot cavity; time and frequency metrology; optical clock;}, web_url = {https://arxiv.org/abs/1902.07012}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.44.001781}, stag_bib_extends_levelofaccess = {NA}, author = {Didier, A. and Ignatovich, S. and Benkler, E. and Okhapkin, M. and Mehlst{\"a}ubler, T.E.} } @Article { TiwariBCFBW2019, subid = {1240}, title = {Bulk and surface recombination properties in thin film semiconductors with different surface treatments from time-resolved photoluminescence measurements}, journal = {Scientific Reports}, year = {2019}, month = {3}, day = {29}, volume = {9}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, keywords = {thin filmsemiconductor}, misc2 = {EMPIR 2016: Energy}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-41716-x}, stag_bib_extends_levelofaccess = {NA}, author = {Weiss, T.P. and Bissig, B. and Feurer, T. and Carron, R. and Buecheler, S. and Tiwari, A.N.} } @Article { RosendahlBBKSKS2019, subid = {1550}, title = {CT beam dosimetric characterization procedure for personalized dosimetry}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {3}, day = {29}, volume = {64}, number = {7}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, pages = {075009}, keywords = {CT beam dosimetric characterization procedure for personalized dosimetry}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab0e97}, stag_bib_extends_levelofaccess = {NA}, author = {Rosendahl, S. and B{\"u}ermann, L. and Borowski, M. and Kortesniemi, M. and Sundell, V-M. and Kosunen, A. and Siiskonen, T.} } @Article { BurgerZB2019, subid = {1058}, title = {An auxiliary field approach for computing optical resonances in dispersive media}, journal = {Journal of the European Optical Society-Rapid Publications}, year = {2019}, month = {3}, day = {27}, volume = {15}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {3}, keywords = {Maxwell’s equations, Material dispersion, Nonlinear eigenvalue problems, Auxiliary field approach}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1186/s41476-019-0098-z}, stag_bib_extends_levelofaccess = {NA}, author = {Binkowski, F. and Zschiedrich, L. and Burger, S.} } @Proceedings { BurgerZHS2019, subid = {1217}, title = {Using Gaussian process regression for efficient parameter reconstruction}, journal = {Metrology, Inspection, and Process Control for Microlithography XXXIII}, year = {2019}, month = {3}, day = {26}, volume = {10959}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1095911}, keywords = {computational metrology, optical metrology, computational lithography, Bayesian optimization,machine learning, finite-element methods, nanooptics}, web_url = {https://arxiv.org/abs/1903.12128}, misc2 = {EMPIR 2017: Fundamental}, publisher = {SPIE}, event_place = {San Jose, USA}, event_name = {Metrology, Inspection, and Process Control for Microlithography XXXIII}, event_date = {24-02-2019 to 28-02-2019}, language = {30}, DOI = {10.1117/12.2513268}, stag_bib_extends_levelofaccess = {NA}, author = {Schneider, P-I. and Hammerschmidt, M. and Zschiedrich, L. and Burger, S.} } @Article { KiselevDMFVPABBLXBHD2019, subid = {1024}, title = {Long Slender Piezo-Resistive Silicon Microprobes for Fast Measurements of Roughness and Mechanical Properties inside Micro-Holes with Diameters below 100 µm}, journal = {Sensors 2019}, year = {2019}, month = {3}, day = {22}, volume = {19(6)}, number = {1410}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {cantilever microprobe; high-speed; contact resonance; tip wear; piezo-resistive; mechanical damping; tip-testing standard}, web_url = {https://www.mdpi.com/1424-8220/19/6/1410}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, address = {Basel}, language = {30}, DOI = {10.3390/s19061410}, stag_bib_extends_levelofaccess = {NA}, author = {Brand, U. and XU, M. and Doering, L. and Langfahl-Klabes, J. and Behle, H. and B{\"u}tefisch, S. and Ahbe, T. and Peiner, E. and V{\"o}llmeke, S. and Frank, T. and Mickan, B. and Kiselev, I. and Hauptmannl, M. and Drexel, M.} } @Article { OelfkeBBD2019_2, subid = {1047}, title = {The effect of magnetic field strength on the response of Gafchromic EBT-3 film}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {3}, day = {14}, volume = {64}, number = {6}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {06NT03}, keywords = {MRI-Linac, MRI-guided radiotherapy, film dosimetry, magnetic field}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/ab0503}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab0503}, stag_bib_extends_levelofaccess = {NA}, author = {Billas, I. and Bouchard, H. and Oelfke, U. and Duane, S.} } @Article { MinelliBPRUSSGS2019, subid = {1543}, title = {Sticky Measurement Problem: Number Concentration of Agglomerated Nanoparticles}, journal = {Langmuir}, year = {2019}, month = {3}, day = {14}, volume = {35}, number = {14}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {4927-4935}, keywords = {Sticky Measurement Problem: Number Concentration of Agglomerated Nanoparticles}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0743-7463, 1520-5827}, DOI = {10.1021/acs.langmuir.8b04209}, stag_bib_extends_levelofaccess = {NA}, author = {Minelli, C. and Bartczak, D. and Peters, R. and Rissler, J. and Undas, A. and Sikora, A. and Sj{\"o}str{\"o}m, E. and Goenaga-Infante, H. and Shard, A.G.} } @Article { BraunBRSB2019, subid = {1033}, title = {Measurement and Analysis of PMU Reporting Latency for Smart Grid Protection and Control Applications}, journal = {IEEE Access}, year = {2019}, month = {3}, day = {12}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-1}, keywords = {Phasor measurement units, Ethernet, Hardware, Real-time systems, Synchronization, Task analysis}, misc2 = {EMPIR 2017: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2169-3536}, DOI = {10.1109/ACCESS.2019.2903929}, stag_bib_extends_levelofaccess = {NA}, author = {Blair, S.M. and Syed, M.H. and Roscoe, A.J. and Burt, G.M. and Braun, J.P.} } @Article { KurlyandskayaSCMBACT2019, subid = {944}, title = {Specific loss power measurements by calorimetric and thermal methods on \(\gamma\)-Fe2O3 nanoparticles for magnetic hyperthermia}, journal = {Journal of Magnetism and Magnetic Materials}, year = {2019}, month = {3}, volume = {473}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {403-409}, keywords = {Magnetic hyperthermia, Fe-oxide, Magnetic nanoparticles}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-8853}, DOI = {10.1016/j.jmmm.2018.10.107}, stag_bib_extends_levelofaccess = {NA}, author = {Co{\"i}sson, M. and Barrera, G. and Appino, C. and Celegato, F. and Martino, L. and Safronov, A.P. and Kurlyandskaya, G.V. and Tiberto, P.} } @Article { PisaniBE2019, subid = {1000}, title = {High-Index Glass Ball Retroreflectors for Measuring Lateral Positions}, journal = {Sensors}, year = {2019}, month = {3}, volume = {19}, number = {5}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, pages = {1082}, keywords = {backscattering, retroreflectors, glory, ray tracing, high index ball lenses}, web_url = {https://www.mdpi.com/1424-8220/19/5/1082}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s19051082}, stag_bib_extends_levelofaccess = {NA}, author = {Egidi, A. and Balsamo, A. and Pisani, M.} } @Proceedings { ThalmannMBK2019, subid = {1030}, title = {CT machine geometry changes under thermal load}, journal = {Nondestructive Testing}, year = {2019}, month = {3}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {23681}, keywords = {CT machine geometry, thermal influences, geometry measurement system, metrology}, web_url = {http://www.ndt.net/?id=23681}, misc2 = {EMPIR 2017: Industry}, publisher = {NDT.net}, event_place = {Padova}, event_name = {9th Conference on Industrial Computed Tomography (iCT) 2019}, event_date = {13-02-2019 to 15-02-2019}, language = {30}, ISSN = {1435-4934}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2019/papers/iCT2019_Full_paper_47.pdf}, author = {Thalmann, R. and Meli, F. and Bircher, B.A. and K{\"u}ng, A.} } @Proceedings { ThalmannMBK2019_2, subid = {1029}, title = {CT geometry determination using individual radiographsof calibrated multi-sphere standards}, journal = {Nondestructive Testing}, year = {2019}, month = {3}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {23677}, keywords = {CT machine geometry, correction, multi-sphere standard, metrology}, web_url = {https://www.ndt.net/search/docs.php3?showForm=off\&id=23677}, misc2 = {EMPIR 2017: Industry}, publisher = {NDT.net}, event_place = {Padova}, event_name = {9th Conference on Industrial Computed Tomography (iCT) 2019}, event_date = {13-02-2019 to 15-02-2019}, language = {30}, ISSN = {1435-4934}, stag_bib_extends_levelofaccess = {NA}, author = {Thalmann, R. and Meli, F. and Bircher, B.A. and K{\"u}ng, A.} } @Article { ChunnilallKBGRKLPRGD2019, subid = {1012}, title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source}, journal = {Metrologia}, year = {2019}, month = {2}, day = {22}, volume = {56}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {025004}, keywords = {single-photon sources, quantum technologies, quantum characterization}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab022e}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.} } @Article { ChunnilallKBGRKLPRGD20190, subid = {1012}, title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source}, journal = {Metrologia}, year = {2019}, month = {2}, day = {22}, volume = {56}, number = {2}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {025004}, keywords = {single-photon sources, quantum technologies, quantum characterization}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab022e}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.} } @Article { ChunnilallKBGRKLPRGD20191, subid = {1012}, title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source}, journal = {Metrologia}, year = {2019}, month = {2}, day = {22}, volume = {56}, number = {2}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {025004}, keywords = {single-photon sources, quantum technologies, quantum characterization}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab022e}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.} } @Article { BurgerRRHS2019, subid = {1520}, title = {Numerical Investigation of Light Emission from Quantum Dots Embedded into On‐Chip, Low‐Index‐Contrast Optical Waveguides}, journal = {physica status solidi (b)}, year = {2019}, month = {2}, day = {15}, volume = {256}, number = {7}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1800437}, keywords = {single photon emitters, coherent light matter interaction, numerical simulations, finite element methods}, web_url = {https://arxiv.org/abs/2006.10466}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {0370-1972, 1521-3951}, DOI = {10.1002/pssb.201800437}, stag_bib_extends_levelofaccess = {NA}, author = {Hoehne, T. and Schnauber, P. and Rodt, S. and Reitzenstein, S. and Burger, S.} } @Article { NeuCJBPKC2019, subid = {1305}, title = {Frontiers of magnetic force microscopy}, journal = {Journal of Applied Physics}, year = {2019}, month = {2}, day = {14}, volume = {125}, number = {6}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {060901}, keywords = {MFM}, web_url = {https://aip.scitation.org/doi/10.1063/1.5050712}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979, 1089-7550}, DOI = {10.1063/1.5050712}, stag_bib_extends_levelofaccess = {NA}, author = {Kazakova, O. and Puttock, R. and Barton, C. and Corte-Le{\'o}n, H. and Corte-Leon, Hector and Jaafar, M. and Neu, V.} } @Article { MendezSBCKSD2019, subid = {1021}, title = {Characterization of an analog-to-digital converter frequency response by a Josephson arbitrary waveform synthesizer}, journal = {Measurement Science and Technology}, year = {2019}, month = {2}, day = {11}, volume = {30}, number = {3}, number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements}, pages = {035006}, keywords = {quantum standard, digital converter, Josephson arbitrary waveform synthesizer, programmable Josephson voltage standard, Monte Carlo method, Sine fitting algorithms, artificial neural network (ANN)}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/aafb27/meta}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aafb27}, stag_bib_extends_levelofaccess = {NA}, author = {Diaz de Aguilar, J. and Salinas, J.R. and Kieler, O. and Caballero, R. and Behr, R. and Sanmamed, Y.A. and M{\'e}ndez, A.} } @Article { McPeakBHGW2019, subid = {1059}, title = {Correlation of circular differential optical absorption with geometric chirality in plasmonic meta-atoms}, journal = {Optics Express}, year = {2019}, month = {2}, day = {11}, volume = {27}, number = {4}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {5097}, keywords = {circular differential optical absorption, chirality, plasmonics}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1364/OE.27.005097}, stag_bib_extends_levelofaccess = {NA}, author = {Wilson, J.C. and Gutsche, P. and Herrmann, S. and Burger, S. and McPeak, K.M.} } @Article { DittmannFHGBHKWPSDM2019, subid = {1001}, title = {Results of four European round-robins on short-circuit current temperature coefficient measurements of photovoltaic devices of different size}, journal = {Solar Energy}, year = {2019}, month = {2}, volume = {179}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {424-436}, keywords = {Photovoltaics, Short-circuit current temperature coefficient intercomparisons, Spectral temperature coefficients, Bare cells to full-size modules}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2018.10.051}, stag_bib_extends_levelofaccess = {NA}, author = {Salis, E. and Pavanello, D. and Kr{\"o}ger, I. and Winter, S. and Bothe, K. and Hinken, D. and Gandy, T. and Hohl-Ebinger, J. and Friesen, G. and Dittmann, S. and Dubard, J. and M{\"u}llejans, H.} } @Article { LazzeriniDGVKYB2019, subid = {1074}, title = {Design and performance of a test rig for evaluation of nanopositioning stages}, journal = {Measurement Science and Technology}, year = {2019}, month = {2}, volume = {30}, number = {3}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {035002}, keywords = {multi-axis positioning stages, traceability, nanopositioning, dimensional metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aafd03}, stag_bib_extends_levelofaccess = {NA}, author = {Yacoot, Andrew and Klapetek, Petr and Valtr, Miroslav and Grolich, Petr and Dongmo, Herve and Lazzerini, Giovanni M and Bridges, Angus} } @Article { HarrisDBSKDS2019, subid = {1160}, title = {Children With Cystic Fibrosis Are Infected With Multiple Subpopulations of Mycobacterium abscessus With Different Antimicrobial Resistance Profiles}, journal = {Clinical Infectious Diseases}, year = {2019}, month = {1}, day = {26}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, keywords = {lung transplant, whole-genome sequencing, within-patient diversity, macrolides, physiological niches}, misc2 = {EMPIR 2015: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {1058-4838, 1537-6591}, DOI = {10.1093/cid/ciz069}, stag_bib_extends_levelofaccess = {NA}, author = {Shaw, L.P. and Doyle, R.M. and Kavaliunaite, E. and Spencer, H. and Balloux, F. and Dixon, G. and Harris, K.A.} } @Article { DegiovanniB2019, subid = {1011}, title = {Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology}, journal = {Metrologia}, year = {2019}, month = {1}, day = {25}, volume = {56}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {024001}, keywords = {quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf7b2}, stag_bib_extends_levelofaccess = {NA}, author = {Berchera, I.R. and Degiovanni, I.P.} } @Article { DegiovanniB20190, subid = {1011}, title = {Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology}, journal = {Metrologia}, year = {2019}, month = {1}, day = {25}, volume = {56}, number = {2}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {024001}, keywords = {quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf7b2}, stag_bib_extends_levelofaccess = {NA}, author = {Berchera, I.R. and Degiovanni, I.P.} } @Article { DegiovanniB20191, subid = {1011}, title = {Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology}, journal = {Metrologia}, year = {2019}, month = {1}, day = {25}, volume = {56}, number = {2}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {024001}, keywords = {quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf7b2}, stag_bib_extends_levelofaccess = {NA}, author = {Berchera, I.R. and Degiovanni, I.P.} } @Article { KochKBWHBISIK2019, title = {Does airborne ultrasound lead to activation of the auditory cortex?}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2019}, month = {1}, day = {18}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, keywords = {airborne ultrasound; brain imaging; hearingthreshold}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {1862-278X, 0013-5585}, DOI = {10.1515/bmt-2018-0048}, stag_bib_extends_levelofaccess = {NA}, author = {Koch, C. and K{\"u}hler, R. and Bauer, M. and Weichenberger, M. and Hensel, J. and Br{\"u}hl, R. and Ihlenfeld, A. and Sander, T. and Ittermann, B. and K{\"u}hn, S.} } @Article { JarosovaKBPN2019, subid = {975}, title = {Intraocular Pressure Response to Short-Term Extreme Normobaric Hypoxia Exposure}, journal = {Frontiers in Endocrinology}, year = {2019}, month = {1}, volume = {9}, number = {785}, number2 = {16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements}, pages = {1-7}, keywords = {intraocular pressure, hypoxia, normobaric hypoxia, glaucoma, oxygen saturation}, web_url = {https://www.frontiersin.org/research-topics/6935/the-role-of-hypoxia-in-the-regulation-of-metabolism}, misc2 = {EMPIR 2016: Research Potential}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {1664-2392}, DOI = {10.3389/fendo.2018.00785}, stag_bib_extends_levelofaccess = {NA}, author = {Najmanov{\'a}, E. and Pluh{\'a}ček, F. and Botek, M. and Krejč{\'i}, J. and Jarošov{\'a}, J.} } @Article { OliveroDFGRBLKTMCKGD2019, subid = {1007}, title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range}, journal = {Metrologia}, year = {2019}, month = {1}, volume = {56}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {015016}, keywords = {colour centers, single-photon source, metrology for quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf6c8}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.} } @Article { ZschiedrichFRBHG2019, subid = {1060}, title = {Decomposition of scattered electromagnetic fields into vector spherical wave functions on surfaces with general shapes}, journal = {Physical Review B}, year = {2019}, month = {1}, volume = {99}, number = {4}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {045406}, keywords = {light scattering, vector spherical wave functions}, web_url = {https://arxiv.org/abs/1808.02315}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1103/PhysRevB.99.045406}, stag_bib_extends_levelofaccess = {NA}, author = {Garcia Santiago, X. and Hammerschmidt, M. and Burger, S. and Rockstuhl, C. and Fernandez-Corbaton, I. and Zschiedrich, L.} } @Article { OliveroDFGRBLKTMCKGD20190, subid = {1007}, title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range}, journal = {Metrologia}, year = {2019}, month = {1}, volume = {56}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {015016}, keywords = {colour centers, single-photon source, metrology for quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf6c8}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.} } @Article { OliveroDFGRBLKTMCKGD20191, subid = {1007}, title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range}, journal = {Metrologia}, year = {2019}, month = {1}, volume = {56}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {015016}, keywords = {colour centers, single-photon source, metrology for quantum technologies}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf6c8}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.} } @Article { MohnsHBHR2019, subid = {1041}, title = {Comparison of Reference Setups for Calibrating Power Transformer Loss Measurement Systems}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {power transformers, loss measurement, power transformer losses, load loss, shunt reactor, power measurement, comparison, calibration, high voltage, uncertainty.}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.1109/TIM.2018.2879171}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, Gert and Mohns, Enrico and Houtzager, Ernest and Badura, Henrik and Hoogenboom, Dennis} } @Article { BaduraCMR2019, subid = {1042}, title = {A Fundamental Step-Up Method for Standard Voltage Transformers Based on an Active Capacitive High-Voltage Divider}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {Capacitors, Standards, Voltage measurement, Calibration, Uncertainty, Gain, Voltage transformersCapacitive divider, high voltage, inductive voltage divider (IVD), phase displacement, ratio error}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.7795/EMPIR.17NRM01.CA.20190408}, stag_bib_extends_levelofaccess = {NA}, author = {Badura, H. and Chunyang, J. and Mohns, E. and Raether, P.} } @Article { AkramMNBKKO2019, subid = {1056}, title = {Pulsation of InGaAs photodiodes in liquid helium for driving Josephson arrays in ac voltage realization}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2019}, volume = {29}, number = {7}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {1200308}, keywords = {Photodiodes, Integrated circuits, Josephson junctions, Optical distortion, Junctions, Bit rate, Optical pulses}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2019.2901573}, stag_bib_extends_levelofaccess = {NA}, author = {Karlsen, B. and Kieler, O. and Behr, R. and Tuan Nguyen, T.A. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.A.} } @Article { RydlerB2019, subid = {1138}, title = {Realization of Absolute Phase and AC Resistance of Current Shunts by Ratio Measurements}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, volume = {68}, number = {6}, number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements}, pages = {2041-2046}, keywords = {Capacitance, current shunt,impedance measurement, inductance, measurement standards, phase measurement, resistance}, web_url = {https://ieeexplore.ieee.org/document/8608020}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, language = {30}, ISSN = {1557-9662}, DOI = {10.1109/TIM.2018.2882927}, stag_bib_extends_levelofaccess = {NA}, author = {Bergsten, T. and Rydler, K.E.} } @Inbook { PriceRBSW2019, subid = {1192}, title = {Standardisation of magnetic nanomaterials: Steps towards magnetic reference particles}, year = {2019}, volume = {PTB-Berich}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {200-208}, keywords = {standardisation, magnetic nanomaterials, reference materials,}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Fachverlag NW in Carl Ed. Sch{\"u}nemann KG}, address = {Bremen}, booktitle = {NanoWorkshop 2018: Workshop on Reference Nanomaterials}, language = {30}, ISBN = {978-3-95606-440-1}, ISSN = {0179-0609}, DOI = {10.7795/110.20190412}, stag_bib_extends_levelofaccess = {NA}, author = {Price, A. and R{\"u}ttinger, R. and Bleul, R. and Steinhoff, U. and Wiekhorst, F.} } @Article { GodDCBYDDRW2019, subid = {1238}, title = {High-rank Symmetries in Nuclei: Challenges for Prediction Capacities of the Nuclear Mean-field Theories}, journal = {Acta Physica Polonica B}, year = {2019}, volume = {50}, number = {3}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {685}, keywords = {Nuclear mean field theory, modeling prediciton capacities, nuclear point group symmetreis, high-rank symmetries}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Jagiellonian University}, language = {30}, ISSN = {0587-4254, 1509-5770}, DOI = {10.5506/APhysPolB.50.685}, stag_bib_extends_levelofaccess = {NA}, author = {Dudek, J. and Dedes, I. and Yang, J. and Baran, A. and Curien, D. and Dickel, T. and G{\'o}źdź, A. and Rouvel, D. and Wang, H.L.} } @Proceedings { BuzoianuRF2019, subid = {1244}, title = {Recent progress in chemical measuring capabilities in INM as a result of EMRP/EMPIR Programme}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, number = {20004 (2019)}, number2 = {16RPT02: ALCOREF: Certified forensic alcohol reference materials}, pages = {1-13}, keywords = {ICP-MS, gas chromatography}, misc2 = {EMPIR 2016: Research Potential}, publisher = {EDP Sciences}, event_place = {LNE}, event_name = {CIM 2019 - 19th International Metrology Congress}, event_date = {16-09-2019 to 21-09-2019}, language = {30}, DOI = {10.1051/metrology/201920004}, stag_bib_extends_levelofaccess = {NA}, author = {Buzoianu, M. and Radu, M. and Ionescu, G.V.} } @Proceedings { Buzoianu2019, subid = {1245}, title = {Work at the INM to Develop Measurement Capabilities to Assign Reference Values in Proficiency Testing Schemes}, journal = {-}, year = {2019}, volume = {-}, number = {-}, number2 = {16RPT01: ChemMet-Cap: Development of scientific and technical capabilities in the field of chemical analysis}, keywords = {Proficiency Testing Schemes}, web_url = {http://www.pt-conf.org/2019/wp-content/uploads/2019/09/Proceedings-PT-Conf-2019.pdf}, misc2 = {EMPIR 2016: Research Potential}, publisher = {-}, address = {1 rue Gaston Boissier}, event_place = {LNE}, event_name = {7TH INTERNATIONAL PROFICIENCY TESTING CONFERENCE}, event_date = {10-09-2019 to 13-09-2019}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://www.pt-conf.org/2019/wp-content/uploads/2019/09/Proceedings-PT-Conf-2019.pdf}, author = {Buzoianu, M.} } @Proceedings { BuzoianuRF20190, subid = {1244}, title = {Recent progress in chemical measuring capabilities in INM as a result of EMRP/EMPIR Programme}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, number = {20004 (2019)}, number2 = {16RPT01: ChemMet-Cap: Development of scientific and technical capabilities in the field of chemical analysis}, pages = {1-13}, keywords = {ICP-MS, gas chromatography}, misc2 = {EMPIR 2016: Research Potential}, publisher = {EDP Sciences}, event_place = {LNE}, event_name = {CIM 2019 - 19th International Metrology Congress}, event_date = {16-09-2019 to 21-09-2019}, language = {30}, DOI = {10.1051/metrology/201920004}, stag_bib_extends_levelofaccess = {NA}, author = {Buzoianu, M. and Radu, M. and Ionescu, G.V.} } @Proceedings { SpasovaBNOSCTHZSAV2019, subid = {1490}, title = {A new EMPIR Project “MetForTC” for Developing Traceable Measurement Capabilities for Monitoring Thermocouple Performance}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, volume = {-}, number = {2019}, number2 = {18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance}, pages = {5/18006}, keywords = {EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple}, misc2 = {EMPIR 2018: Research Potential}, publisher = {EDP Sciences}, event_place = {Paris, France}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201918006}, stag_bib_extends_levelofaccess = {NA}, author = {Arifovic, N. and Sestan, D. and Zvizdić, D. and Hozic, N. and Turz{\'o}-Andr{\'a}s, E. and Čohodarević, S. and Strnad, R. and Opel, K. and Neagu, D. and Bordianu, C. and Spasova, S. and Vukičević, T.} } @Article { Brown2019, subid = {1728}, title = {Semantic Web Technologies for Data Curation and Provenance}, journal = {Zenodo}, year = {2019}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Semantic Data Curation Provenance}, web_url = {https://zenodo.org/record/4305667}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.4305667}, stag_bib_extends_levelofaccess = {NA}, author = {Brown, C.} } @Proceedings { GiordanoCRMGLFRSBD2019, subid = {1945}, title = {Pantograph-Catenary Arc Detection Technique based on Conducted Effects Measurement on Railway Supply System}, journal = {WCRR Papers}, year = {2019}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {arc discharge; electric arc; Power quality; rail transportation system;}, misc2 = {EMPIR 2016: Energy}, event_place = {Tokyo, Japan}, event_name = {WORLD CONGRESS OF RAIL RESEARCH (WCRR), Tokyo, Japan, 28 October - 1 November 2019}, event_date = {28-10-2019 to 01-11-2019}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4587794}, author = {Giordano, D. and Crotti, G. and Roccato, P. and Mariscotti, A. and Gallo, D. and Luiso, M. and Filippini, N. and Rossetta, I. and Spalvieri, C. and Biancucci, A. and Domandio, L.} } @Article { SchererBKDG2018, subid = {1105}, title = {Calibrating Ultrastable Low-Noise Current Amplifiers of the Second Generation With a Cryogenic Current Comparator}, journal = {IEEE TRANSACTIONS ON INSTRUMENTATION AND MEASUREMENT}, year = {2018}, month = {12}, day = {21}, volume = {68}, number = {6}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {2027-2033}, keywords = {Calibration, current comparator, current measurement, low-noise amplifiers, measurement uncertainty.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2018.2884060}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}tz, M. and Drung, D. and Krause, C. and Becker, U. and Scherer, H.} } @Article { SchioppoNMMLLIHCFBBBBAWSLWZZZ2018, subid = {958}, title = {New bounds on dark matter coupling from a global network of optical atomic clocks}, journal = {Science Advances}, year = {2018}, month = {12}, volume = {4}, number = {12}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {eaau4869}, keywords = {optical atomic clocks, sensor network, dark matter}, web_url = {http://advances.sciencemag.org/content/4/12/eaau4869.full}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Association for the Advancement of Science (AAAS)}, language = {30}, ISSN = {2375-2548}, DOI = {10.1126/sciadv.aau4869}, stag_bib_extends_levelofaccess = {NA}, author = {Wcisło, P. and Ablewski, P. and Beloy, K. and Bilicki, S. and Bober, M. and Brown, R. and Fasano, R. and Ciuryło, R. and Hachisu, H. and Ido, T. and Lodewyck, J. and Ludlow, A. and McGrew, W. and Morzyński, P. and Nicolodi, D. and Schioppo, M. and Sekido, M. and Le Targat, R. and Wolf, P. and Zhang, X. and Zjawin, B. and Zawada, M.} } @Proceedings { nceABADU2018, subid = {1023}, title = {Development of Dynamic Calibration Machine for Pressure Transducers}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {12}, volume = {1065}, number = {2018}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {162013}, keywords = {dynamic pressure, dynamic calibration, pressure measurement, pressure calibration, pressure transducer, traceability, signal conditioning, drop mass}, web_url = {https://doi.org/10.1088/1742-6596/1065/16/162013}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, event_place = {Belfast}, event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, ISBN = {1742-6588, 1742-6596}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/16/162013}, stag_bib_extends_levelofaccess = {NA}, author = {Durgut, Y. and Aydemir, B. and Bağcı, E. and Akşahin, E. and İnce, A.T. and Uslukılı\c{c}, U.} } @Thesis { BrunPicard2018, subid = {1218}, title = {Une nouvelle g{\'e}n{\'e}ration d'{\'e}talons quantiques fond{\'e}e sur l'effet Hall quantique}, year = {2018}, month = {12}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Graph{\`e}ne, effet Hall quantique, m{\'e}trologie}, web_url = {https://hal.archives-ouvertes.fr/tel-01973021}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Universit{\'e} Paris-Saclay}, school = {Paris-Saclay}, language = {37}, stag_bib_extends_levelofaccess = {NA}, author = {Brun-Picard, J.} } @Techreport { KleinHDBBK2018, subid = {1413}, title = {NanoWorkshop 2018: Workshop on Reference Nanomaterials; Current Situation and needs: development, measurement, Standardization}, journal = {PTB bericht}, year = {2018}, month = {12}, volume = {F-61}, number = {F-61}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {1-315}, keywords = {Comparability of Measurement Results;Nanomaterial Properties;Nanometrology;Nanoparticle Characterization;Reference Nanomaterials;Standardization}, web_url = {https://oar.ptb.de/resources/show/10.7795/110.20190412}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Physikalisch-Technische Bundesanstalt}, language = {30}, ISBN = {78-3-95606-440-1}, ISSN = {0179-0609}, DOI = {10.7795/110.20190412}, stag_bib_extends_levelofaccess = {NA}, author = {Klein, T. and Hodoroaba, V.-D. and Dziomba, T. and Buhr, E. and Bosse, H. and Krumrey, M.} } @Article { ColemanGKBDR2018, subid = {970}, title = {Flow rate measurement in stacks with cyclonic flow – Error estimations using CFD modelling}, journal = {Measurement}, year = {2018}, month = {12}, volume = {129}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, pages = {167-183}, keywords = {flow measurement, cyclonic flow, velocity measurements, standard reference method, ultrasonic flow measurement, EN ISO 16911-2, validated computational fluid dynamics (CFD) modelling, OpenFoam software, Emissions Trading System}, web_url = {https://arxiv.org/ftp/arxiv/papers/1808/1808.10159.pdf}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2018.06.032}, stag_bib_extends_levelofaccess = {NA}, author = {Gersl, J. and Knotek, S. and Belligoli, Z. and Dwight, R.P. and Robinson, R.A. and Coleman, M.D.} } @Article { DorscherASBSSPOHHSL2018, subid = {1054}, title = {Towards an optical clock for space: Compact, high-performance optical lattice clock based on bosonic atoms}, journal = {Physical Review A}, year = {2018}, month = {11}, day = {29}, volume = {98}, number = {5}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {053443}, keywords = {optical clocks, optical lattice clock, isotope shift, clock comparisons}, web_url = {https://www.ptb.de/cms/fileadmin/internet/fachabteilungen/abteilung_4/4.3_quantenoptik_und_laengeneinheit/4.32/ori18.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.98.053443}, stag_bib_extends_levelofaccess = {NA}, author = {Origlia, S. and Pramod, M.S. and Schiller, S. and Singh, Y. and Bongs, K. and Schwarz, R. and Al-Masoudi, A. and D{\"o}rscher, S. and Herbers, S. and H{\"a}fner, S. and Sterr, U. and Lisdat, C.} } @Proceedings { PeinerXBVKF2018, subid = {1025}, title = {Optimizing a Cantilever Measurement System towards High Speed, Nonreactive Contact-Resonance-Profilometry}, journal = {Proceedings}, year = {2018}, month = {11}, day = {21}, volume = {2}, number = {13}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {889}, keywords = {contact resonance spectroscopy; layer analysis; piezoresistive; tactile cantilever;automatic gain control; phase-locked-loop}, web_url = {https://www.mdpi.com/2504-3900/2/13/889}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, event_place = {Graz, Austria}, event_name = {Eurosensors 2018}, event_date = {09-09-2018 to 12-09-2018}, language = {30}, ISSN = {2504-3900}, DOI = {10.3390/proceedings2130889}, stag_bib_extends_levelofaccess = {NA}, author = {Fahrbach, M. and Krieg, L. and Voss, T. and Bertke, M. and Xu, J. and Peiner, E.} } @Article { BarreraFigueroa2018, title = {Free-field reciprocity calibration of measurement microphones at frequencies up to 150 kHz}, journal = {The Journal of the Acoustical Society of America}, year = {2018}, month = {10}, day = {31}, volume = {144}, number = {4}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {2575-2583}, keywords = {airborne noise assessment, ultrasound in air, microphone calibration, free-field reciprocity}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Acoustical Society of America (ASA)}, language = {30}, ISSN = {0001-4966}, DOI = {10.1121/1.5063815}, stag_bib_extends_levelofaccess = {NA}, author = {Barrera-Figueroa, S.} } @Article { VargasBCMPR2018, subid = {894}, title = {An Unmanned Aircraft System to Detect a Radiological Point Source Using RIMA Software Architecture}, journal = {Remote Sensing}, year = {2018}, month = {10}, day = {30}, volume = {10}, number = {11}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {1712}, keywords = {UAS, CZT, UAS software Architecture, radiological detection}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs10111712}, stag_bib_extends_levelofaccess = {NA}, author = {Royo, P. and Pastor, E. and Macias, M. and Cuadrado, R. and Barrado, C. and Vargas, A.} } @Article { ClarkPLPBDMSSS2018, subid = {883}, title = {Crystallographic texture can be rapidly determined by electrochemical surface analytics}, journal = {Acta Materialia}, year = {2018}, month = {10}, day = {15}, volume = {159}, number = {1}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {89-101}, keywords = {Orientation mapping, Crystallographic characterisation, Electrochemical jet processing,}, web_url = {https://www.sciencedirect.com/science/article/pii/S1359645418305998}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {1359-6454}, DOI = {10.1016/j.actamat.2018.07.059}, stag_bib_extends_levelofaccess = {NA}, author = {Speidel, A. and Su, R. and Su, R. and Mitchell-Smith, J. and Dryburgh, P. and Bisterov, I. and Pieris, D. and Li, W. and Patel, R. and Clark, M.} } @Article { HuldSBGD2018, title = {Energy-based metric for analysis of organic PV devices in comparison with conventional industrial technologies}, journal = {Renewable and Sustainable Energy Reviews}, year = {2018}, month = {10}, volume = {93}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {76-89}, keywords = {Energy, Transport and Climate}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {1364-0321}, DOI = {10.1016/j.rser.2018.04.029}, stag_bib_extends_levelofaccess = {NA}, author = {Huld, T. and Salis, E. and Bardizza, G. and Gracia-Amillo, A.M. and Dunlop, E.D.} } @Article { BurianovaVS2018, subid = {810}, title = {Tissue-equivalence of 3D-printed plastics for medical phantoms in radiology}, journal = {Journal of Instrumentation}, year = {2018}, month = {9}, day = {20}, volume = {13}, number = {09}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {P09018-P09018}, keywords = {Medical phantom; radiology; ionizing radiation; 3D print; linear attenuation coefficient; Hounsfield unit}, web_url = {http://mrtdosimetry-empir.eu/?page_id=1166}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/13/09/P09018}, stag_bib_extends_levelofaccess = {NA}, author = {Solc, J. and Vrba, T. and Burianov{\'a}, L.} } @Article { YangBJCJTS2018, title = {Individualized magnetoencephalography using optically pumped magnetometers with an anatomy derived sensor holder}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2018}, month = {9}, volume = {63}, number = {s1}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {240}, keywords = {OPM, SQUID, SQUID-MEG, signal-to-noise ratio}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Walter de Gruyter GmbH}, address = {Berlin}, language = {30}, ISSN = {1862-278X, 0013-5585}, DOI = {10.1515/bmt-2018-6045}, stag_bib_extends_levelofaccess = {NA}, author = {Yang, T. and Br{\"u}hl, R. and Jodko-Władzińska, A. and Cotic Smole, P. and Jazbinšek, V. and Trahms, L. and Sander-Th{\"o}mmes, T.} } @Article { HaasSSRBH2018, title = {A gravitational telescope deformation model for geodetic VLBI}, journal = {Journal of Geodesy}, year = {2018}, month = {8}, day = {29}, volume = {93}, number = {5}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {669-680}, keywords = {VLBI, Telescope deformation, Systematic errors, Terrestrial reference frames}, web_url = {http://link.springer.com/article/10.1007/s00190-018-1188-1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-7714, 1432-1394}, DOI = {10.1007/s00190-018-1188-1}, stag_bib_extends_levelofaccess = {NA}, author = {Haas, R. and Svantesson, C.G. and Spetz, J. and Rieck, C. and Bergstrand, S. and Herbertsson, M.} } @Article { CastroBW2018, subid = {786}, title = {Assessing the Validity of Transient Photovoltage Measurements and Analysis for Organic Solar Cells}, journal = {Physical Review Applied}, year = {2018}, month = {8}, day = {24}, volume = {10}, number = {2}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {024038}, keywords = {photovoltaics, transient photovoltage, transient photocurrent, organic solar cells, finite-element method, organic semiconductors}, web_url = {https://journals.aps.org/prapplied/abstract/10.1103/PhysRevApplied.10.024038}, misc2 = {EMPIR 2016: Energy}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.10.024038}, stag_bib_extends_levelofaccess = {NA}, author = {Wood, S. and Blakesley, J.C. and Castro, F.A.} } @Article { StrupinskiUOGPMPMPWKB2018, subid = {992}, title = {Electrical Homogeneity Mapping of Epitaxial Graphene on Silicon Carbide}, journal = {ACS Applied Materials \& Interfaces}, year = {2018}, month = {8}, day = {21}, volume = {10}, number = {37}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, pages = {31641-31647}, keywords = {conductivity; graphene; metrology; micro four-point probe; SiC; terahertz spectroscopy}, web_url = {https://pubs.acs.org/doi/10.1021/acsami.8b11428}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1944-8244, 1944-8252}, DOI = {10.1021/acsami.8b11428}, stag_bib_extends_levelofaccess = {NA}, author = {Whelan, P.R. and Panchal, V. and Petersen, D.H. and Mackenzie, D.M.A. and Melios, C. and Pasternak, I. and Gallop, J. and {\O}sterberg, F.W. and U. Jepsen, P. and Strupinski, W. and Kazakova, O. and B{\o}ggild, P.} } @Article { SieversYSHGBTCBF2018, subid = {996}, title = {Excitation and coherent control of magnetization dynamics in magnetic tunnel junctions using acoustic pulses}, journal = {Applied Physics Letters}, year = {2018}, month = {8}, day = {13}, volume = {113}, number = {7}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, keywords = {Excitation, Coherent control, Magnetization dynamics, magnetic tunnel junctions, acoustic pulses}, web_url = {https://arxiv.org/abs/1804.10503}, misc2 = {EMPIR 2015: SI Broader Scope}, language = {30}, DOI = {10.1063/1.5037780}, stag_bib_extends_levelofaccess = {NA}, author = {Yang, H.F. and Garcia-Sanchez, F. and Hu, X.K. and Sievers, S. and B{\"o}hnert, T. and Costa, J.D. and Tarequzzaman, M. and Ferreira, R. and Bieler, M. and Schumacher, H.W.} } @Article { BruchertseiferFCDPHVPLMM2018, title = {Measurement of absolute \(\gamma\)-ray emission probabilities in the decay of 227Ac in equilibrium with its progeny}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {8}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, keywords = {\(\gamma\)-ray intensities, 227Ac, 227Th, 223Ra, decay data, \(\gamma\)-ray spectrometry}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2018.08.023}, stag_bib_extends_levelofaccess = {NA}, author = {Bruchertseifer, F. and Fazio, A. and Carconi, P. and Dry{\'a}k, P. and Pierre, S. and Hult, M. and Van Ammel, R. and Pomm{\'e}, S. and Lutter, G. and Marouli, M. and Morgenstern, A.} } @Article { NeuvonenAALBBPMSPFWSBL2018, subid = {1062}, title = {Establishing traceability for liquid density measurements in Europe: 17RPT02-rhoLiq a new EMPIR joint research project}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number = {8}, number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements}, pages = {082013}, keywords = {density of liquids; hydrostatic weighing; oscillation-type density meters}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/8/082013/pdf}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IOP Publishing}, address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/8/082013}, stag_bib_extends_levelofaccess = {NA}, author = {Furtado, A. and Pereira, J. and Schiebl, M. and Mares, G. and Popa, G. and Bartos, P. and Bebic, J. and Lenard, E. and Alic, A. and Alisic, S. and Neuvonen, P. and Wolf, H. and Sariyerli, G. and Bescupschii, A. and Laky, B.} } @Article { OguzAytekinKMSISFSZSJoHBHPV2018, subid = {1086}, title = {Improving emerging European NMIs’ capabilities in humidity measurement}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {122019}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/12/122019}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Zvizdić, D. and Sestan, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Article { BehrHDBIIWBS2018, subid = {1153}, title = {Towards a Metrology class ADC based on Josephson junction devices}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {052044}, keywords = {Metrology, Josephson, ADC, DC Voltage, AC Voltage}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/5/052044}, stag_bib_extends_levelofaccess = {NA}, author = {Belcher, A. and Williams, J. and Ireland, J. and Iuzzolino, R. and Bierzychudek, M.E. and Dekker, R. and Herick, J. and Behr, R. and Schaapman, K.} } @Article { OlbrichSROBS2018, subid = {1626}, title = {Validation of simulations in multiphase flow metrology by comparison with experimental video observations}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {092015}, keywords = {Multiphase flow, slug flow, CFD, liquid level extraction, frequency analysis}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/9/092015}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and Schmeyer, E. and Riazy, L. and Oberleithner, K. and B{\"a}r, M. and Schmelter, S.} } @Article { KuuskABVF2018, subid = {2453}, title = {Implication of Illumination Beam Geometry on Stray Light and Bandpass Characteristics of Diode Array Spectrometer}, journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing}, year = {2018}, month = {8}, volume = {11}, number = {8}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {2925-2932}, keywords = {Optical fibre devices, Optical spectroscopy, stray light, laser measurement, Illumination beam geometry}, misc2 = {EMPIR 2016: Environment}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1939-1404, 2151-1535}, DOI = {10.1109/JSTARS.2018.2841772}, stag_bib_extends_levelofaccess = {NA}, author = {Kuusk, J. and Ansko, I. and Bialek, A. and Vendt, R. and Fox, N.} } @Article { McKennaGSBCHGP2018, subid = {608}, title = {Exposure of mass-selected bimetallic Pt–Ti nanoalloys to oxygen explored using scanning transmission electron microscopy and density functional theory}, journal = {RSC Advances}, year = {2018}, month = {7}, day = {31}, volume = {8}, number = {52}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {27276–27282}, keywords = {Nanoparticles, nanotechnology, nanoalloys, platinum, bimetallic, electron microscopy}, web_url = {http://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra02449a}, misc2 = {EMPIR 2014: Industry}, publisher = {The Royal Society of Chemistry}, language = {30}, ISSN = {2046-2069}, DOI = {10.1039/C8RA02449A}, stag_bib_extends_levelofaccess = {NA}, author = {Gholhaki, S. and Hung, S. and Cant, D. and Blackmore, C. and Shard, A. and Guo, Q. and McKenna, K. and Palmer, R.} } @Article { BoarinoRDSPDGFMC2018, subid = {846}, title = {Influence of the long-range ordering of gold-coated Si nanowires on SERS}, journal = {Scientific Reports}, year = {2018}, month = {7}, day = {27}, volume = {8}, number = {1}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, keywords = {surface-enhanced Raman spectroscopy; substrates for bio-analytical applications; flexible gold-coated Si nanowires}, web_url = {https://www.nature.com/articles/s41598-018-29641-x.pdf}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-29641-x}, stag_bib_extends_levelofaccess = {NA}, author = {Cara, E. and Mandrile, L. and Ferrarese Lupi, F. and Giovannozzi, A.M. and Dialameh, M. and Portesi, C. and Sparnacci, K. and De Leo, N. and Rossi, A.M. and Boarino, L.} } @Article { HoflingSBBHSGLFSKRS2018_2, subid = {696}, title = {Photon-Number-Resolved Measurement of an Exciton-Polariton Condensate}, journal = {Physical Review Letters}, year = {2018}, month = {7}, day = {25}, volume = {121}, number = {4}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {047401}, keywords = {Exciton Polariton, Photon Statistics}, web_url = {https://arxiv.org/abs/1805.02959}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.121.047401}, stag_bib_extends_levelofaccess = {NA}, author = {Klaas, M. and Schlottmann, E. and Flayac, H. and Laussy, F. P. and Gericke, F. and Schmidt, M. and Helversen, M. v. and Beyer, J. and Brodbeck, S. and Suchomel, H. and H{\"o}fling, S. and Reitzenstein, S. and Schneider, C.} } @Article { JelezkoDNAEBGJSMTFDGO2018, subid = {1010}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept}, journal = {Physical Review Applied}, year = {2018}, month = {7}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance}, web_url = {https://arxiv.org/abs/1706.07935}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.10.014024}, stag_bib_extends_levelofaccess = {NA}, author = {Forneris, J. and Ditalia Tchernij, S. and Traina, P. and Moreva, E. and Skukan, N. and Jakšić, M. and Grilj, V. and Bosia, F. and Enrico, E. and Amato, G. and Degiovanni, I.P. and Naydenov, B. and Jelezko, F. and Genovese, M. and Olivero, P.} } @Article { JelezkoDNAEBGJSMTFDGO20180, subid = {1010}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept}, journal = {Physical Review Applied}, year = {2018}, month = {7}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.10.014024}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1706.07935}, author = {Forneris, J. and Ditalia Tchernij, S. and Traina, P. and Moreva, E. and Skukan, N. and Jakšić, M. and Grilj, V. and Bosia, F. and Enrico, E. and Amato, G. and Degiovanni, I.P. and Naydenov, B. and Jelezko, F. and Genovese, M. and Olivero, P.} } @Article { vanSchaikPBP2018, subid = {999}, title = {Climatic chamber for dew-point temperatures up to 150 \(^{\circ}\)C}, journal = {Metrologia}, year = {2018}, month = {7}, day = {13}, volume = {55}, number = {4}, number2 = {14IND11: HIT: Metrology for humidity at high temperatures and transient conditions}, pages = {597-608}, keywords = {calibration, high temperatures, relative humidity, sensors, speed of sound}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/aacecc/meta}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aacecc}, stag_bib_extends_levelofaccess = {NA}, author = {Bosma, R. and Pouw, R.J. and van Schaik, W. and Peruzzi, A.} } @Article { RottgerDDBKN2018, title = {Novel spectrometers for environmental dose rate monitoring}, journal = {Journal of Environmental Radioactivity}, year = {2018}, month = {7}, volume = {187}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {115-121}, keywords = {Environmental dosimetry, Spectrometers, MetroERM, Early warning networks}, web_url = {https://www.sciencedirect.com/science/article/pii/S0265931X17304976?via\%3Dihub}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0265-931X}, DOI = {10.1016/j.jenvrad.2018.01.020}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and Dombrowski, H. and Dabrowski, R. and Behnke, B. and Kessler, P. and Neumaier, S.} } @Article { WeisbachKHDBALKHW2018, subid = {515}, title = {Development and characterization of sub-monolayer coatings as novel calibration samples for X-ray spectroscopy}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2018}, month = {7}, volume = {145}, number2 = {14IND07: 3D Stack: Metrology for manufacturing 3D stacked integrated circuits}, pages = {36-42}, keywords = {X-ray fluorescence, calibration samples}, web_url = {https://arxiv.org/abs/1801.04246}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2018.04.001}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Kr{\"a}mer, M. and L{\"u}hl, L. and Andrianov, K. and Beckhoff, B. and Dietsch, R. and Holz, T. and Kanngie{\ss}er, B. and Wei{\ss}bach, D. and Wilhein, T.} } @Article { SigrayLCBMBBAHRGCBD2018, subid = {904}, title = {Calibration standards for hydrophones and autonomous underwater noise recorders for frequencies below 1 kHz: current activities of EMPIR “UNAC-LOW” project}, journal = {ACTA IMEKO}, year = {2018}, month = {7}, volume = {7}, number = {2}, number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz}, pages = {32}, keywords = {low frequency hydrophone calibration; low frequency underwater noise recorders; underwater acoustics; calibration}, web_url = {http://dx.doi.org/10.21014/acta_imeko.v7i2.542}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v7i2.542}, stag_bib_extends_levelofaccess = {NA}, author = {Biber, A. and \c{C}orak\c{c}ı, A.C. and Golick, A. and Robinson, S. and Hayman, G. and Ablitt, J. and Barrera-Figueroa, S. and Buogo, S. and Mauro, S. and Borsani, F. and Curcuruto, S. and Linn{\'e}, M. and Sigray, P. and Davidsson, P.} } @Article { EllingsbergBAVLRWPS2018, subid = {1376}, title = {Evaluation of EMI Effects on Static Electricity Meters}, journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters.}, tags = {SEG}, web_url = {https://zenodo.org/record/3587786\#.XiGxp3u7KUn}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/CPEM.2018.8500945}, stag_bib_extends_levelofaccess = {NA}, author = {Wright, P.S. and Rietveld, G. and Leferink, F. and van den Brom, H.E. and Alonso, F.R.I and Braun, J.P. and Ellingsberg, K. and Pous, M. and Svoboda, M.} } @Article { LudwigSKSDGTNPFJBPKRI2018, subid = {900}, title = {Development of white LED illuminants for colorimetry and recommendation of white LED reference spectrum for photometry}, journal = {Metrologia}, year = {2018}, month = {6}, day = {28}, volume = {55}, number = {4}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {526-534}, keywords = {Photometry, colorimetry, illuminant, reference spectrum, photometer, calibration, uncertainty}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aacae7}, stag_bib_extends_levelofaccess = {NA}, author = {Kokka, A. and Poikonen, T. and Blattner, P. and Jost, S. and Ferrero, A. and Pulli, T. and Ngo, M. and Thorseth, A. and Gerloff, T. and Dekker, P. and Stuker, F. and Klej, A. and Ludwig, K. and Schneider, M. and Reiners, T. and Ikonen, E.} } @Article { YuWMGDCBBTCOGM2018, subid = {955}, title = {Preliminary assessment of stable nitrogen and oxygen isotopic composition of USGS51 and USGS52 nitrous oxide reference gases and perspectives on calibration needs}, journal = {Rapid Communications in Mass Spectrometry}, year = {2018}, month = {6}, day = {26}, volume = {32}, number = {15}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {1207-1214}, keywords = {N2O, reference material, isotope delta value, USGS51, USGS52}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/rcm.8257}, misc2 = {EMPIR 2016: Environment}, publisher = {Wiley}, language = {30}, ISSN = {0951-4198}, DOI = {10.1002/rcm.8157}, stag_bib_extends_levelofaccess = {NA}, author = {Ostrom, N.E. and Gandhi, H. and Coplen, T.B. and Toyoda, S. and B{\"o}hlke, J.K. and Brand, W.A. and Casciotti, K.L. and Dyckmans, J. and Giesemann, A. and Mohn, J. and Mohn, J. and Well, R. and Yu, L.} } @Manual { KielerBWMRCSBSSCDOB2018, subid = {719}, title = {Good Practice Guide on the operation of AC quantum voltage standards}, year = {2018}, month = {6}, day = {21}, volume = {1}, number2 = {14RPT01: ACQ-PRO: Towards the propagation of ac quantum voltage standards}, note = {ISBN ok https://grp.isbn-international.org/search/piid_cineca_solr/978-80-905619\%2B\%2528ISBNPrefix\%2529?keys=978-80-905619\%2B\%2528ISBNPrefix\%2529}, keywords = {Good Practice Guide, quantum standards, alternating voltage, Josephson effect, measurement techniques, uncertainty estimation, software tools, safe operation, cryogenic equipment}, misc2 = {EMPIR 2014: Research Potential}, publisher = {Czech Metrology Institute}, address = {Brno}, language = {30}, ISBN = {978-80-905619-2-2}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://acqpro.cmi.cz/index.php/results/28-good-practice-guide}, author = {Kieler, O. and Behr, R. and Williams, J.M. and Malmbekk, H. and Ribeiro, L. and Cabral, V. and Sosso, A. and Bruszewski, P. and Š{\'i}ra, M. and Sanmamed, Y.A. and Caballero, R. and Diaz de Aguilar, J. and Orhan, R. and Bonfait, G.} } @Article { HarrisHRB2018, subid = {905}, title = {Signal-modelling methods applied to the free-field calibration of hydrophones and projectors in laboratory test tanks}, journal = {Measurement Science and Technology}, year = {2018}, month = {6}, day = {19}, volume = {29}, number = {8}, number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz}, pages = {085001}, keywords = {underwater acoustics, transducer calibration, signal-modelling, non-linear least-squares}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aac752}, stag_bib_extends_levelofaccess = {NA}, author = {Robinson, S.P. and Hayman, G. and Harris, P.M. and Beamiss, G.A.} } @Article { GoenagaInfanteBWSSSM2018, subid = {575}, title = {Measuring the relative concentration of particle populations using differential centrifugal sedimentation}, journal = {Analytical Methods}, year = {2018}, month = {6}, day = {14}, volume = {10}, number = {22}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {2539 - 2660}, keywords = {Relative, concentration, particle, populations, differential centrifugal sedimentation, DCS, spherical particles}, web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ay/c8ay00491a}, misc2 = {EMPIR 2014: Industry}, publisher = {The Royal Society of Chemistry}, language = {30}, ISSN = {1759-9679}, DOI = {10.1039/c8ay00491a}, stag_bib_extends_levelofaccess = {NA}, author = {Shard, A. and Sparnacci, K. and Sikora, A. and Wright, L. and Bartczak, D. and Goenaga-Infante, H. and Minelli, C.} } @Article { MalhiARNDBOCL2018, subid = {959}, title = {Realistic Forest Stand Reconstruction from Terrestrial LiDAR for Radiative Transfer Modelling}, journal = {Remote Sensing}, year = {2018}, month = {6}, day = {13}, volume = {10}, number = {6}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {933}, keywords = {tree reconstruction, radiative transfer, terrestrial LiDAR, forestry, 3D modelling, calibration and validation, end-to-end traceability}, web_url = {https://www.mdpi.com/2072-4292/10/6/933}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs10060933}, stag_bib_extends_levelofaccess = {NA}, author = {Calders, K. and Origo, N. and Burt, A. and Disney, M. and Nightingale, J. and Raumonen, P. and {\AA}kerblom, M. and Malhi, Y. and Lewis, P.} } @Article { elGawharyLWNSRBF2018, title = {Sensitivity study of the instrumental temperature corrections on Brewer total ozone column measurements}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {6}, day = {11}, volume = {11}, number = {6}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {3323-3337}, keywords = {Brewer, instrumental temperature}, web_url = {https://www.atmos-meas-tech.net/11/3323/2018/amt-11-3323-2018.html}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-3323-2018}, stag_bib_extends_levelofaccess = {NA}, author = {El Gawhary, O. and Le{\'o}n-Luis, S.F. and Wilson, K. and Nevas, S. and Sildoja, M.M. and Redondas, A. and Berjon, A. and Fountoulakis, I.} } @Article { EbertWBSLW2018, title = {High-resolution Fourier transform measurements of air-induced broadening and shift coefficients in the 00 0 2–00 0 0 main isotopologue band of nitrous oxide}, journal = {Journal of Molecular Spectroscopy}, year = {2018}, month = {6}, volume = {348}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {68-78}, keywords = {Nitrous oxide, Fourier transform infrared spectroscopy, Spectral line parameters, Air-broadening, Air-shift, Gas metrology}, web_url = {https://www.sciencedirect.com/science/article/pii/S0022285217302059?via\%3Dihub}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0022-2852}, DOI = {10.1016/j.jms.2017.07.002}, stag_bib_extends_levelofaccess = {NA}, author = {Ebert, V. and Werhahn, O. and Brunzendorf, J. and Serdyukov, A. and Li, G. and Werwein, V.} } @Article { deClercqZGRPCAB2018, title = {Toward a High-Stability Coherent Population Trapping Cs Vapor-Cell Atomic Clock Using Autobalanced Ramsey Spectroscopy}, journal = {Physical Review Applied}, year = {2018}, month = {6}, volume = {9}, number = {6}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, keywords = {Resonance raman transition, dual-frequency laser, long-term stability, rubidium, standard; compensation, performance, shifts,}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.9.064002}, stag_bib_extends_levelofaccess = {NA}, author = {de Clercq, E. and Zanon-Willette, T. and Gu{\'e}randel, S. and Rocher, C. and Petersen, M. and Coget, G. and Abdel Hafiz, M. and Boudot, R.} } @Article { WebsterCPB2018, subid = {1149}, title = {Patient-centred outcome metrology for healthcare decision-making}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {6}, volume = {1044}, number2 = {15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases}, pages = {012057}, keywords = {patient-centred outcome metrology}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1044/1/012057}, stag_bib_extends_levelofaccess = {NA}, author = {Cano, S.J and Pendrill, L.R and Barbic, S.P and Fisher, W.P} } @Article { BarlowJ2018, subid = {823}, title = {A hybrid 2D/3D inspection concept with smart routing optimisation for high throughput, high dynamic range and traceable critical dimension metrology}, journal = {Measurement Science and Technology}, year = {2018}, month = {5}, day = {23}, volume = {29}, number = {7}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {074004}, keywords = {dimensional metrology, surface topography, hybrid measurement, high dynamic range, process control, inline measurement, calibration}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aababd/meta}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aababd}, stag_bib_extends_levelofaccess = {NA}, author = {Jones, C.W. and O’Connor, D} } @Proceedings { BymanLHBSS2018, subid = {870}, title = {Online measurement of optical fibre geometry during manufacturing}, journal = {Proc. SPIE}, year = {2018}, month = {5}, day = {17}, volume = {10683}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1068318}, keywords = {fibre, manufacturing, concentricity, scatterometry, modelling}, web_url = {https://arxiv.org/abs/1806.07596}, misc2 = {EMPIR 2014: Industry}, publisher = {SPIE}, event_place = {Strasbourg}, event_name = {Fiber Lasers and Glass Photonics: Materials through Applications}, event_date = {22-04-2018 to 26-04-2018}, language = {30}, DOI = {10.1117/12.2314762}, stag_bib_extends_levelofaccess = {NA}, author = {Shpak, M. and Burger, S. and Haapalainen, M. and Lassila, A. and Byman, V. and Saastamoinen, K.} } @Article { LiuHSFB2018, subid = {822}, title = {Fast and cost-effective in-process defect inspection for printed electronics based on coherent optical processing}, journal = {Optics Express}, year = {2018}, month = {5}, day = {16}, volume = {26}, number = {11}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {13927}, keywords = {all-optical difference engine, defects, detection, printed electronics, roll-to-roll, Fourier optics and signal processing, Spatial filtering, Imaging systems, Optical inspection, Optical sensing and sensors}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-11-13927}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.013927}, stag_bib_extends_levelofaccess = {NA}, author = {Feng, X. and Su, R. and Happonen, T. and Liu, J. and Leach, Richard} } @Article { vanSlagerenKFKPFKMPKBMP2018, subid = {898}, title = {Room Temperature Uniaxial Magnetic Anisotropy Induced By Fe-Islands in the InSe Semiconductor Van Der Waals Crystal}, journal = {Advanced Science}, year = {2018}, month = {5}, day = {11}, volume = {5}, number = {7}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {1800257}, keywords = {Magnetic Anisotropy, Nanotechnology, Nano-scale traceable magnetic field measurements}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Wiley}, language = {30}, ISSN = {2198-3844}, DOI = {10.1002/advs.201800257}, stag_bib_extends_levelofaccess = {NA}, author = {Moro, F. and Bhuiyan, M.A. and Kudrynskyi, Z.R. and Puttock, R. and Kazakova, O. and Makarovsky, O. and Fay, M.W. and Parmenter, C. and Kovalyuk, Z.D. and Fielding, A.J. and Kern, M. and van Slageren, J. and Patan{\`e}, A.} } @Article { GenoveseDBTVLGAP2018, subid = {532}, title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement}, journal = {Scientific Reports}, year = {2018}, month = {5}, volume = {8}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-25156-7}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Gramegna, M. and Lussana, R. and Villa, F. and Tosi, A. and Brida, G. and Degiovanni, I.P. and Genovese, M.} } @Article { HudlickaHBL2018, subid = {794}, title = {Prediction of SINR using BER and EVM for Massive MIMO Applications}, journal = {EuCAP}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {SINR, EVM, BER, Interference Characterisation, Massive MIMO}, web_url = {http://epubs.surrey.ac.uk/846356/}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1809.07811}, author = {Hudlicka, M. and Humphreys, D.A. and Brown, T.W.C. and Loh, T. H.} } @Article { BelenguerJKLA2018, subid = {796}, title = {Empty Substrate Integrated Waveguide-Fed MMW Aperture-Coupled Patch Antenna for 5G Applications}, journal = {EuCAP}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {5G, antennas, millimetre-wave, Empty Substrate Integrated Waveguide.}, web_url = {http://www.eucap.org/}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1809.07817}, author = {Belenguer, A. and Jilani, S.F. and Khan, Z.U. and Loh, T. H. and Alomainy, A.} } @Article { BuismanSSN2018, subid = {798}, title = {An Inter-Laboratory Comparison of NVNA Measurements}, journal = {INMMIC}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Nonlinear microwave measurements, NVNA, measurement comparison}, web_url = {http://arxiv.org/abs/1809.07301}, misc2 = {EMPIR 2014: Industry}, language = {30}, DOI = {10.1109/INMMIC.2018.8430012}, stag_bib_extends_levelofaccess = {NA}, author = {Salter, M and Stant, L and Buisman, K and Nielsen, T} } @Article { BuismanCHL2018, subid = {797}, title = {An Evaluation of Distortion and Interference Sources originating Within a Millimeter-wave MIMO Testbed for 5G Communications}, journal = {URSI}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {MIMO, Testbed, Interference, Distortion}, web_url = {http://www.ursi.org/proceedings/procAT18/papers/SA052.pdf}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1809.07825}, author = {Buisman, K. and Cheadle, D. and Humphreys, D. and Loh, T. H.} } @Article { ErikssonHLCB2018, subid = {800}, title = {Millimeter-Wave Over-the-Air Signal-to-Interference-plus-Noise-Ratio Measurements Using aMIMO Testbed}, journal = {URSI}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Millimeter-waveSINRMIMO}, misc2 = {EMPIR 2014: Industry}, language = {30}, DOI = {10.23919/URSI-AT-RASC.2018.8471560}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://research.chalmers.se/en/publication/505084}, author = {Buisman, K and Cheadle, D and Loh, T H and Humphreys, D and Eriksson, T } } @Article { ErikssonB2018, subid = {801}, title = {Designing and characterizing MATE, the Chalmers mm-wave MIMO testbed}, journal = {EuCAP}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {MATE, MIMO ,MM-wave ,Testbed}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://research.chalmers.se/en/publication/508028}, author = {Eriksson, T and Buisman, K} } @Article { GenoveseDBTVLGAP20180, subid = {532}, title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement}, journal = {Scientific Reports}, year = {2018}, month = {5}, volume = {8}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-25156-7}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Gramegna, M. and Lussana, R. and Villa, F. and Tosi, A. and Brida, G. and Degiovanni, I.P. and Genovese, M.} } @Article { KimBBWLAM2018, subid = {843}, title = {Improved Extraction Repeatability and Spectral Reproducibility for Liquid Extraction Surface Analysis–Mass Spectrometry Using Superhydrophobic–Superhydrophilic Patterning}, journal = {Analytical Chemistry}, year = {2018}, month = {4}, day = {27}, volume = {90}, number = {10}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {6001-6005}, keywords = {liquid extraction surface analysis (LESA); Droplet Microarray (DMA); extraction solvent; mass spectrometry}, web_url = {https://pubs.acs.org/doi/pdf/10.1021/acs.analchem.8b00973}, misc2 = {EMPIR 2015: Health}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0003-2700, 1520-6882}, DOI = {10.1021/acs.analchem.8b00973}, stag_bib_extends_levelofaccess = {NA}, author = {Meurs, J. and Alexander, M.R. and Levkin, P.A. and Widmaier, S. and Bunch, J. and Barrett, D.A. and Kim, D.H.} } @Miscellaneous { BastuckKS, subid = {1019}, title = {Condition monitoring of hydraulic systems Data Set}, journal = {Zenodo Community}, year = {2018}, month = {4}, day = {26}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {sensor network, condition monitoring, hydraulic}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.1323610}, stag_bib_extends_levelofaccess = {NA}, author = {Bastuck, M. and Klein, S. and Schneider, T.} } @Article { DickersonBRR2018, subid = {826}, title = {Dealing with front-end white noise on differentiated measurements such as frequency and ROCOF in power systems}, journal = {IEEE Transcations on Instrumentation and Measurement}, year = {2018}, month = {4}, day = {25}, volume = {67}, number = {11}, number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids}, pages = {2579-2591}, keywords = {Frequency measurement, noise measurement, power measurement, phase measurement, white noise, measurement uncertainty, phasor measurement units}, web_url = {https://strathprints.strath.ac.uk/63576/}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, ISSN = {1557-9662}, DOI = {10.1109/TIM.2018.2822438}, stag_bib_extends_levelofaccess = {NA}, author = {Roscoe, A.J. and Blair, S.M. and Dickerson, W. and Rietveld, G.} } @Article { AarhaugHAGCMB2018, subid = {502}, title = {Probability of occurrence of ISO 14687-2 contaminants in hydrogen: Principles and examples from steam methane reforming and electrolysis (water and chlor-alkali) production processes model}, journal = {International Journal of Hydrogen Energy}, year = {2018}, month = {4}, number2 = {15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications}, keywords = {ISO14687-2, Hydrogen quality, Fuel cell electrical vehicle, Probability of occurrence, Hydrogen production process, ISO 19880-8}, web_url = {https://www.sciencedirect.com/science/article/pii/S0360319918308450}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2018.03.084}, stag_bib_extends_levelofaccess = {NA}, author = {Bacquart, T and Murugan, A and Carr{\'e}, M and Gozlan, B and Aupr{\^e}tre, F and Haloua, F and Aarhaug, T.A.} } @Article { MarquesBMHIPSGS2018_2, subid = {520}, title = {Theoretical and experimental determination of K- and L-shell x-ray relaxation parameters in Ni}, journal = {Physical Review A}, year = {2018}, month = {4}, volume = {97}, number = {4}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {042501}, keywords = {Electronic Structure, X-ray Fluorescence, Fundamental Parameters, Fluorescence Yields, Condensed matter}, web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.97.042501}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.97.042501}, stag_bib_extends_levelofaccess = {NA}, author = {Guerra, M. and Sampaio, J. M. and Parente, F. and Indelicato, P. and Honicke, P. and Muller, M. and Beckhoff, B. and Marques, J. P. and Santos, J. P.} } @Article { BoothTDFNMD2018_2, title = {Advanced fault location in MTDC networks utilising optically-multiplexed current measurements and machine learning approach}, journal = {International Journal of Electrical Power \& Energy Systems}, year = {2018}, month = {4}, volume = {97}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {319-333}, keywords = {Fault location, Multi-terminal direct current, Travelling waves, Optical sensors, Machine learning, Pattern recognition}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0142-0615}, DOI = {10.1016/j.ijepes.2017.10.040}, stag_bib_extends_levelofaccess = {NA}, author = {Booth, C. and Tzelepis, D. and Dysko, A. and Fusiek, G. and Niewczas, P. and Mirsaeidi, S. and Dong, X.} } @Article { VenceljPDCBGP2018, title = {Evaluation of the radon interference on the performance of the portable monitoring air pump for radioactive aerosols (MARE)}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {4}, volume = {134}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {439-445}, keywords = {Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements, Radon and thoron background, Radon progeny, Walk-in radon chamber}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.07.039}, stag_bib_extends_levelofaccess = {NA}, author = {Vencelj, M. and Ponikvar, D. and De Felice, P. and Cardellini, F. and Brodnik, D. and Glavič-Cindro, D. and Petrovič, T.} } @Article { deClercqGMB2018, title = {Pulsed coherent population trapping spectroscopy in microfabricated Cs–Ne vapor cells}, journal = {Journal of the Optical Society of America B}, year = {2018}, month = {4}, volume = {35}, number = {5}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {1004}, keywords = {Atomic-frequency references, clock, resonances, frequency stability}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Optical Society}, language = {30}, ISSN = {0740-3224, 1520-8540}, DOI = {10.1364/JOSAB.35.001004}, stag_bib_extends_levelofaccess = {NA}, author = {de Clercq, E. and Gorecki, C. and Maurice, V. and Boudot, R.} } @Article { BuismanN2018, subid = {789}, title = {Measurement Technique to Emulate Signal Coupling Between Power Amplifiers}, journal = {IEEE}, year = {2018}, month = {4}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Active load–pull, antenna array, coupling effect, distortion, emulation, measurement technique, power amplifier (PA)}, web_url = {https://research.chalmers.se/publication/502172/file/502172_Fulltext.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TMTT.2017.2786274}, stag_bib_extends_levelofaccess = {NA}, author = {Nopchinda, D. and Buisman, K.} } @Article { PlimmerOHB2018, subid = {807}, title = {Development and characterisation of a low pressure transfer standard in the range 1 Pa to 10 kPa}, journal = {ACTA IMEKO}, year = {2018}, month = {4}, volume = {7}, number = {1}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {80}, keywords = {pressure, vacuum, transfer standard, resonant silicon gauge, mcapacitance diaphragm gauge}, misc2 = {EMPIR 2014: Industry}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v7i1.496}, stag_bib_extends_levelofaccess = {NA}, author = {Boineau, F. and Huret, S. and Otal, P. and Plimmer, M.} } @Article { WellerJEB2018, subid = {936}, title = {Online immunocapture ICP-MS for the determination of the metalloprotein ceruloplasmin in human serum}, journal = {BMC Research Notes}, year = {2018}, month = {4}, volume = {11}, number = {1}, number2 = {15HLT02: ReMiND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {213-217}, keywords = {Ceruloplasmin, Immunocapture, ICP‑MS, ELISA, Human serum}, web_url = {https://bmcresnotes.biomedcentral.com/articles/10.1186/s13104-018-3324-7}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature}, language = {30}, ISSN = {1756-0500}, DOI = {10.1186/s13104-018-3324-7}, stag_bib_extends_levelofaccess = {NA}, author = {Bernevic, B. and El-Khatib, A.H. and Jakubowski, N. and Weller, M.G.} } @Proceedings { BlissBKG2018, subid = {1096}, title = {Accessing the Performance of Individual Cells of Fully Encapsulated PV Modules Using a Commercial Digital Light Processing Projector}, journal = {PVSAT proceedings}, year = {2018}, month = {4}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Photovoltaic}, web_url = {https://hdl.handle.net/2134/34784}, misc2 = {EMPIR 2016: Energy}, event_place = {London}, event_name = {PVSAT-14}, event_date = {18-04-2018 to 20-04-2018}, language = {30}, ISBN = {0904963845}, stag_bib_extends_levelofaccess = {NA}, author = {Bliss, Martin and Betts, Thomas Richard and Koutsourakis, George and Gottschalg, Ralph} } @Article { ChudnovskyPGWKGWHZBNZZZZ2018, subid = {582}, title = {Direct writing of room temperature and zero field skyrmion lattices by a scanning local magnetic field}, journal = {Applied Physics Letters}, year = {2018}, month = {3}, day = {26}, volume = {112}, number = {13}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {132405}, keywords = {magnetic skyrmion, magnetic force microscopy, stray field, perpendicular magnetic anisotropy}, web_url = {http://hdl.handle.net/10754/627497}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/1.5021172}, stag_bib_extends_levelofaccess = {NA}, author = {Zhang, X, and Zhang, S. and Zhang, J. and Zhang, Q. and Barton, C. and Neu, V. and Zhao, Y. and Hou, Z. and Wen, Y. and Gong, C. and Kazakova, O. and Wang, W. and Peng, Y. and Garanin, D.A. and Chudnovsky, E.M.} } @Article { TabandehBSRCM2018, title = {Development of a low frost-point generator operating at sub-atmospheric pressure}, journal = {Measurement Science and Technology}, year = {2018}, month = {3}, day = {16}, volume = {29}, number = {5}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {054002}, keywords = {hygrometry, humidity generator, frost point, upper-air sensors}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aaa785}, stag_bib_extends_levelofaccess = {NA}, author = {Tabandeh, S. and Beltramino, G. and Smorgon, D. and Rosso, L. and Cuccaro, R. and Mana, G.} } @Article { CarrollMB2018, title = {Novel Calibration Technique for a Coulometric Evolved Vapor Analyzer for Measuring Water Content of Materials}, journal = {International Journal of Thermophysics}, year = {2018}, month = {3}, day = {10}, volume = {39}, number = {4}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {50}, keywords = {Calibration, Evolved vapor analyze,r Measurement traceability, Water content}, web_url = {https://link.springer.com/article/10.1007\%2Fs10765-018-2368-1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-018-2368-1}, stag_bib_extends_levelofaccess = {NA}, author = {Carroll, P. A. and Miao, P. and Bell, S. A.} } @Article { BarlowK2018, subid = {829}, title = {Cross-correlation limit of a SQUID-based noise thermometer of the pMFFT type}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {3}, volume = {969}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {012083}, keywords = {primary magnetic field fluctuation thermometer, SQUID-based, noise thermometer, low temperature}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/969/1/012083}, stag_bib_extends_levelofaccess = {NA}, author = {Kirste, A. and Engert, J} } @Article { ManaBd2018, title = {Air temperature sensors: dependence of radiative errors on sensor diameter in precision metrology and meteorology}, journal = {Metrologia}, year = {2018}, month = {2}, day = {28}, volume = {55}, number = {2}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {229-244}, keywords = {air temperature, meteorology, errors, sensors, metrology}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaaa52}, stag_bib_extends_levelofaccess = {NA}, author = {Mana, G. and Bell, S. and de Podesta, M.} } @Article { Borkowski2018, subid = {473}, title = {Optical Lattice Clocks with Weakly Bound Molecules}, journal = {Physical Review Letters}, year = {2018}, month = {2}, day = {22}, volume = {120}, number = {8}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {083202}, keywords = {optical atomic clocks, ultracold molecules}, web_url = {https://arxiv.org/abs/1802.08291}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.120.083202}, stag_bib_extends_levelofaccess = {NA}, author = {Borkowski, M.} } @Article { EhlersSPPODBS2018, subid = {808}, title = {Calibration methods for negative gauge pressure down to  −100 kPa}, journal = {Measurement Science and Technology}, year = {2018}, month = {2}, day = {17}, volume = {29}, number = {3}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {035007}, keywords = {negative gauge pressure, piston pressure gauge, differential pressure, pressure, calibration, barometer, manometer calibration}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa92ea}, stag_bib_extends_levelofaccess = {NA}, author = {Bentouati, D. and Durgut, Y. and Otal, P. and Plimmer, M. and Praž{\'a}k, D. and Sabuga, W. and Ehlers, S. and Sınır, E.} } @Article { RaumonenLCBBDW2018, title = {Weighing trees with lasers: advances, challenges and opportunities}, journal = {Interface Focus}, year = {2018}, month = {2}, day = {16}, volume = {8}, number = {2}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {20170048}, keywords = {above-ground biomass, terrestrial laser, scanning, lidar, canopy, structure, buttress}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {The Royal Society}, language = {30}, ISSN = {2042-8898, 2042-8901}, DOI = {10.1098/rsfs.2017.0048}, stag_bib_extends_levelofaccess = {NA}, author = {Raumonen, P. and Lewis, S. L. and Calders, K. and Burt, A. and Boni Vicari, M. and Disney, M. I. and Wilkes, P.} } @Article { CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018, subid = {812}, title = {Geodesy and metrology with a transportable optical clock}, journal = {Nature Physics}, year = {2018}, month = {2}, day = {12}, volume = {14}, number = {5}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {437-441}, keywords = {optical fiber, optical frequency transfer}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-017-0042-3}, stag_bib_extends_levelofaccess = {NA}, author = {Costanzo, G.A. and Zucco, M. and Barbieri, P. and Tampellini, A. and Bregolin, F. and Rauf, B. and Pizzocaro, M. and Thoumany, P. and Margolis, H.S. and Zampaolo, M. and Rolland, A. and Baynes, F.N. and Timmen, L. and Denker, H. and Voigt, C. and Lisdat, C. and H{\"a}fner, S. and Sterr, U. and Vogt, S. and Koller, S. and Grotti, J. and Clivati, C. and Levi, F. and Calonico, D.} } @Article { HenaultCLDRBFMBH2018, subid = {374}, title = {A metrological comparison of Raman-distributed temperature sensors}, journal = {Measurement}, year = {2018}, month = {2}, volume = {116}, number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities}, pages = {18-24}, keywords = {Distributed temperature sensors; Raman; Metrology; Structural health monitoring; Optical fibres}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224117306656}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2017.10.041}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Beaumont, O. and Razouk, R. and Delepine-Lesoille, S. and Landolt, M. and Courthial, B. and H{\'e}nault, J.M. and Martinot, F. and Bertrand, J. and Hay, B.} } @Article { StevenSRPGGGHPTB2018, title = {A calibration procedure for a traceable contamination analysis on medical devices by combined X-ray spectrometry and ambient spectroscopic techniques}, journal = {Journal of Pharmaceutical and Biomedical Analysis}, year = {2018}, month = {2}, volume = {150}, number = {1}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {308-317}, keywords = {XRF; Reference-free; N,N’-ethylene-bis (stearamide); Vibrational spectroscopy; Medical device}, web_url = {https://www.sciencedirect.com/science/article/abs/pii/S0731708517310609}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0731-7085}, DOI = {10.1016/j.jpba.2017.12.007}, stag_bib_extends_levelofaccess = {NA}, author = {Steven, R. and Seim, C. and Rossi, A. and Portesi, C. and Gunning, P. and Green, F. and Giovannozzi, A.M. and Hornemann, A. and Pollakowski-Herrmann, B. and Tyler, B. and Beckhoff, B.} } @Article { OhlckersAMKB2018, subid = {455}, title = {Reliability study of fiber-coupled photodiode module for operation at 4 K}, journal = {Microelectronics Reliability}, year = {2018}, month = {2}, volume = {81}, number = {February 2}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {362-367}, keywords = {Optoelectronic packaging, Cryogenics, Voltage standards}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0026-2714}, DOI = {10.1016/j.microrel.2017.10.034}, stag_bib_extends_levelofaccess = {NA}, author = {Bardalen, E. and Karlsen, B. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.} } @Article { BarlowKGAWIOS2018, subid = {830}, title = {Development of large-area high-temperature fixed-point blackbodies for photometry and radiometry}, journal = {Metrologia}, year = {2018}, month = {2}, volume = {55}, number = {2}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {S43-S51}, keywords = {large-area high-temperature fixed point, blackbody, rhenium–carbon,tungsten carbide–carbon, photometry}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://link.springer.com/article/10.1007\%2Fs10765-017-2273-z}, author = {Barlow, C. and Khlevnoy, B. and Grigoryeva, I. and Anhalt, K. and Waehmer, M. and Ivashin, E. and Otryaskin, D. and Solodilov, M.} } @Thesis { Bilicki2018, subid = {1083}, title = {Strontium optical lattice clocks : clock comparisons for timescales and fundamental physics applications}, year = {2018}, month = {1}, day = {24}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, keywords = {Optical lattice clocks, spectroscopy, cold atoms, clock comparisons, timescales, amplified spontaneous emission}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Universit{\'e} Pierre et Marie Curie - Paris VI}, address = {Paris}, school = {Universit{\'e} Pierre et Marie Curie - Paris VI}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://tel.archives-ouvertes.fr/tel-01691598}, author = {Bilicki, S.} } @Article { BarlowLR2018, subid = {820}, title = {Thermography based online characterization of conductive thin films in large-scale electronics fabrication}, journal = {Optics Express}, year = {2018}, month = {1}, day = {11}, volume = {26}, number = {2}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {1219}, keywords = {Flexible electronics, thin film based technology, quality assessment, thin film electronics, synchronized thermography, roll-to-roll}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-2-1219}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.001219}, stag_bib_extends_levelofaccess = {NA}, author = {Remes, K. and Remes, K. and Lepp{\"a}nen, K.} } @Article { VermesseSLDBROGDDPDSGCP2018, title = {Feasibility of using a dose-area product ratio as beam quality specifier for photon beams with small field sizes}, journal = {Physica Medica}, year = {2018}, month = {1}, volume = {45}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {106-116}, keywords = {Dose-area product, Beam quality, DAP ratio, Small photon beams}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2017.12.012}, stag_bib_extends_levelofaccess = {NA}, author = {Vermesse, D. and Sommier, L. and Le Roy, M. and Daures, J. and Bordy, J.M. and Rapp, B. and Ostrowsky, A. and Gouriou, J. and Dufreneix, S. and Delaunay, F. and Petrucci, A. and De Coste, V. and Silvi, L. and Guerra, A.S. and Caporali, C. and Pimpinella, M.} } @Article { ScholzePEKHSB2018, subid = {478}, title = {Element sensitive reconstruction of nanostructured surfaces with finite elements and grazing incidence soft X-ray fluorescence}, journal = {Nanoscale}, year = {2018}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, keywords = {GIXRF, nanostructure characterization, FEM}, web_url = {https://arxiv.org/abs/1801.04157}, misc2 = {EMPIR 2014: Industry}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/C8NR00328A}, stag_bib_extends_levelofaccess = {NA}, author = {Soltwisch, V. and Honicke, P. and Kayser, Y. and Eilbracht, J. and Probst, J. and Scholze, F. and Beckhoff, B.} } @Article { BeckhoffMWJCHU2018, subid = {534}, title = {Accurate experimental determination of Gallium K- and L3-shell XRF fundamental parameters}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2018}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, keywords = {X-ray fluorescence, atomic fundamental parameters}, web_url = {https://arxiv.org/abs/1805.02951}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, address = {Thomas Graham House Science Park, Milton Rd Science Park, Milton Rd Cambridge CB4 0WF United Kingdom}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/C8JA00046H}, stag_bib_extends_levelofaccess = {NA}, author = {Unterumsberger, R. and Honicke, P. and Colaux, J.L. and Jeynes, C. and Wansleben, M. and Muller, M. and Beckhoff, B.} } @Proceedings { GowerBMHLKB2018, title = {Quantitative comparison of different non-destructive techniques for the detection of artificial defects in GFRP}, journal = {Proceedings of 12th European Conference on NDT}, year = {2018}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, keywords = {composites, non-destructive testing, defects}, web_url = {http://www.ndt.net/?id=22834}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Gothenburg}, event_name = {12th European Conference on Non Destructive Testing}, event_date = {11-06-2018 to 15-06-2018}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ecndt2018/papers/ecndt-0297-2018.pdf}, author = {Gower, M. and Brackrock, D. and Maierhofer, C. and Heckel, T. and Lodeiro, M. and Krankenhagen, R. and Baker, G.} } @Proceedings { BosseKJG2018, subid = {879}, title = {Measurement uncertainty estimation of a novel torque transducer for wind turbine test benches}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {torque transducer, force lever, wind turbine, test benches, multiaxial loads, rotational speed}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042050}, stag_bib_extends_levelofaccess = {NA}, author = {Gnauert, J. and Jacobs, G. and Kock, S. and Bosse, D.} } @Proceedings { StrangfeldBJK2018, subid = {880}, title = {Simulation method for the characterisation of the torque transducers in MN·m range}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {wind turbine test benches, torque measurement, multi-axial operation, rotational speed}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042014}, stag_bib_extends_levelofaccess = {NA}, author = {Kock, S. and Jacobs, G. and Bosse, D. and Strangfeld, F.} } @Proceedings { GottschalgBBK2018, subid = {965}, title = {Utilising Digital Light Processing and Compressed Sensing for Photocurrent Mapping of Encapsulated Photovoltaic Modules}, journal = {Proceedings of EUPVSEC}, year = {2018}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Non-Destructive Testing, PV Modules, Compressed Sensing, Current Mapping}, web_url = {https://www.eupvsec-proceedings.com/proceedings?paper=44865}, misc2 = {EMPIR 2016: Energy}, event_place = {Brussels}, event_name = {35th European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {24-09-2018 to 27-09-2018}, language = {30}, ISBN = {3-936338-50-7}, DOI = {10.4229/35thEUPVSEC20182018-5BO.11.6}, stag_bib_extends_levelofaccess = {NA}, author = {Gottschalg, R. and Betts, T. and Bliss, M. and Koutsourakis, G. } } @Article { Bossew2018, subid = {985}, title = {Radon priority areas - definition, estimation and uncertainty}, journal = {Nuclear Technology and Radiation Protection}, year = {2018}, volume = {33}, number = {3}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {286-292}, keywords = {Radon priority area, classification, EURATOM Basic Safety Standards}, misc2 = {EMPIR 2016: Environment}, publisher = {National Library of Serbia}, language = {30}, ISSN = {1451-3994, 1452-8185}, DOI = {10.2298/NTRP180515011B}, stag_bib_extends_levelofaccess = {NA}, author = {Bossew, P.} } @Article { OhlckersAMKB2018_2, subid = {1183}, title = {Evaluation of InGaAs/InP photodiode for high-speed operation at 4 K}, journal = {International Journal of Metrology and Quality Engineering}, year = {2018}, volume = {9}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {13}, keywords = {optoelectronics / cryogenics / voltage standards}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {EDP Sciences}, language = {30}, ISSN = {2107-6847}, DOI = {10.1051/ijmqe/2018015}, stag_bib_extends_levelofaccess = {NA}, author = {Bardalen, E. and Karlsen, B. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.} } @Thesis { Bardalen2018, subid = {1188}, title = {Reliable Packaging and Development of Photodiode Module for Operation at 4 K}, year = {2018}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, keywords = {Packaging, Photodiodes, Low Temperatures}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Eivind Bardalen}, school = {University of South-Eastern Norway}, language = {30}, ISBN = {ISBN: 978-82-7860-317-8 (onlin}, ISSN = {ISSN: 2535-5252(online)}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/11250/2500465}, author = {Bardalen, E.} } @Article { BurnsRMNBFLADYHR2017, subid = {499}, title = {Antimicrobial peptide capsids of de novo design}, journal = {Nature Communications}, year = {2017}, month = {12}, day = {22}, volume = {8}, number = {1}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, pages = {2263}, keywords = {Antimicrobials, Protein design, Self-assembly, Biometrology}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-017-02475-3}, stag_bib_extends_levelofaccess = {NA}, author = {De Santis, E. and Alkassem, H. and Lamarre, B. and Faruqui, N. and Bella, A. and Noble, J.E. and Micale, N. and Ray, S. and Burns, J.R. and Yon, A.R. and Hoogenboom, B.W. and Ryadnov, M.G.} } @Article { MeschkeFMSPB2017, subid = {506}, title = {On-and-off chip cooling of a Coulomb blockade thermometer down to 2.8 mK}, journal = {Applied Physics Letters}, year = {2017}, month = {12}, day = {18}, volume = {111}, number = {25}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {253105}, keywords = {nanoelectronic devices, thermometry}, web_url = {https://aip.scitation.org/doi/10.1063/1.5002565}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1708.09491}, author = {Meschke, M. and Feshchenko, A.V. and Maradan, D. and Scheller, C.P. and Palma, M. and Barlow, C.} } @Article { NeumaierDCBDS2017, title = {Recommendations to harmonize European early warning dosimetry network systems}, journal = {Journal of Instrumentation}, year = {2017}, month = {12}, day = {18}, volume = {12}, number = {12}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {P12024-P12024}, keywords = {data acquisition concepts, dosimetry concepts and apparatus, overall mechanics, design (support structures and materials, vibration analysis etc), radiation monitoring}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/12/12/P12024}, stag_bib_extends_levelofaccess = {NA}, author = {Neumaier, S. and Dabrowski, R. and Cort, M.D. and Bleher, M. and Dombrowski, H. and St{\"o}hlker, U.} } @Article { RuizCMPB2017, subid = {819}, title = {Characterization of the reference wave in a compact digital holographic camera}, journal = {Applied Optics}, year = {2017}, month = {12}, day = {18}, volume = {57}, number = {1}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {A235-A241}, keywords = {holographic, reference wave, optical holography,}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-57-1-A235}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {1559-128X, 2155-3165}, DOI = {10.1364/AO.57.00A235}, stag_bib_extends_levelofaccess = {NA}, author = {Park, I.S. and Middleton, R.J.C. and Coggrave, C.R. and Ruiz, P.D. and Coupland, J M} } @Article { BorkowskiKMuC2017, subid = {594}, title = {Optical Feshbach resonances and ground-state-molecule production in the RbHg system}, journal = {Physical Review A}, year = {2017}, month = {12}, day = {15}, volume = {96}, number = {6}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {063411}, keywords = {Optical Feshbach resonances, ultra-cold molecules}, web_url = {https://arxiv.org/abs/1708.05403}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.96.063411}, stag_bib_extends_levelofaccess = {NA}, author = {Borkowski, M. and Mu{\~n}oz Rodriguez, R. and Kosicki, M.B. and Ciuryło, R. and Żuchowski, P.S.} } @Article { SterrRZSOBHLYMR2017, subid = {720}, title = {Ultrastable Silicon Cavity in a Continuously Operating Closed-Cycle Cryostat at 4 K}, journal = {Physical Review Letters}, year = {2017}, month = {12}, day = {15}, volume = {119}, number = {24}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, keywords = {ultrastable laser, silicon cavity, 4K cryocooler, time and frequency standards}, web_url = {https://arxiv.org/abs/1708.05161}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.119.243601}, stag_bib_extends_levelofaccess = {NA}, author = {Zhang, W. and Robinson, J. M. and Sonderhouse, L. and Oelker, E. and Benko, C. and Hall, J. L. and Legero, T. and Matei, D. G. and Riehle, F. and Sterr, U. and Ye, J.} } @Article { PivacPSDVFWKBHFDDB2017, subid = {544}, title = {Development and Synchrotron-Based Characterization of Al and Cr Nanostructures as Potential Calibration Samples for 3D Analytical Techniques}, journal = {physica status solidi (a)}, year = {2017}, month = {12}, volume = {215}, number = {6}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {1700866}, keywords = {SIMS, APT, GISAXS, 3D nanostructures, di-block copolymers}, misc2 = {EMPIR 2014: Industry}, publisher = {Wiley}, language = {30}, ISSN = {1862-6300}, DOI = {10.1002/pssa.201700866}, stag_bib_extends_levelofaccess = {NA}, author = {Dialameh, M. and Ferrarese Lupi, F. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Weimann, T. and Fleischmann, C. and Vandervorst, W. and Dubček, P. and Pivac, B. and Perego, M. and Seguini, G. and De Leo, N. and Boarino, L.} } @Article { NielsenAKKIIHGFCCBHOOSS2017, title = {New Primary Standards for Establishing SI Traceability for Moisture Measurements in Solid Materials}, journal = {International Journal of Thermophysics}, year = {2017}, month = {12}, volume = {39}, number = {1}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Karl Fischer, Loss-on-drying, Moisture, Oven drying, Traceability}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2340-5}, stag_bib_extends_levelofaccess = {NA}, author = {Nielsen, J. and Aro, R. and Krasheninina, M. and Keawprasert, T. and Ismail, N. and Ionescu, G.V. and Hudoklin, D. and Georgin, E. and Fernicola, V. and Cortellessa, G. and Choi, B.I. and Bell, S. and Heinonen, M. and Oguz Aytekin, S. and {\"O}sterberg, P. and Skabar, J. and Strnad, R.} } @Article { TakasuBBCJYKTT2017, subid = {775}, title = {Beyond-Born-Oppenheimer effects in sub-kHz-precision photoassociation spectroscopy of ytterbium atoms}, journal = {Physical Review A}, year = {2017}, month = {12}, volume = {96}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {063405}, keywords = {photoassociation, spectroscopy, ytterbium,}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.96.063405}, stag_bib_extends_levelofaccess = {NA}, author = {Borkowski, M. and Buchachenko, A.A. and Ciuryło, R. and Julienne, P.S. and Yamada, H. and Kikuchi, Y. and Takahashi, K. and Takahashi, Y. and Takasu, Y.} } @Article { SassiLGWTMPLBPDCESK2017, title = {Preparation and analysis of zero gases for the measurement of trace VOCs in air monitoring}, journal = {Atmospheric Measurement Techniques Discussions}, year = {2017}, month = {11}, day = {28}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {1-17}, keywords = {zero gas, VOC measurements}, web_url = {https://www.atmos-meas-tech-discuss.net/amt-2017-412/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8610}, DOI = {10.5194/amt-2017-412}, stag_bib_extends_levelofaccess = {NA}, author = {Sassi, G. and Lecuna, M. and Ghorafi, Y. and Wortmann, R. and Tensing, E. and Michl, K. and Plass-Duelmer, C. and Li, J. and Baldan, A. and Persijn, S. and Demichelis, A. and Claude, A. and Englert, J. and Sassi, M.P. and Kubistin, D.} } @Article { FountoulakisFGKKKHFDBBLRF2017, title = {Temperature dependence of the Brewer global UV measurements}, journal = {Atmospheric Measurement Techniques}, year = {2017}, month = {11}, day = {22}, volume = {10}, number = {11}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {4491-4505}, keywords = {Brewer spectrophotometer, temperature characterization, UV radiation}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-10-4491-2017}, stag_bib_extends_levelofaccess = {NA}, author = {Fountoulakis, I. and Fragkos, K. and Garane, K. and Koskela, T. and Karhu, J.M. and Karppinen, T. and Heikkila, A. and Feister, U. and Doppler, L. and Bais, A.F. and Berjon, A. and Lakkala, K. and Redondas, A. and Fountoulakis, I.} } @Article { BaeHCGHAK2017, subid = {414}, title = {Upper frequency limit depending on potential shape in a QD-based single electron pump}, journal = {Journal of Applied Physics}, year = {2017}, month = {11}, day = {21}, volume = {122}, number = {19}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {194502}, keywords = {single electron pump, quantum dot, single electron tunneling}, web_url = {http://aip.scitation.org/doi/abs/10.1063/1.5000319}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979, 1089-7550}, DOI = {10.1063/1.5000319}, stag_bib_extends_levelofaccess = {NA}, author = {Ahn, Y.H. and Hong, Y.P. and Hong, C. and Ghee, Y.S. and Chung, Y. and Bae, M.H. and Kim, N.} } @Article { EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017, subid = {602}, title = {First patients treated with a 1.5 T MRI-Linac: clinical proof of concept of a high-precision, high-field MRI guided radiotherapy treatment}, journal = {Physics in Medicine \& Biology}, year = {2017}, month = {11}, day = {14}, volume = {62}, number = {23}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {L41-L50}, keywords = {MRgRT, Radiotherapy, MRI}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aa9517}, stag_bib_extends_levelofaccess = {NA}, author = {Raaymakers, B W and J{\"u}rgenliemk-Schulz, I M and Bol, G H and Glitzner, M and Kotte, A N T J and van Asselen, B and de Boer, J C J and Bluemink, J J and Hackett, S L and Moerland, M A and Woodings, S J and Wolthaus, J W H and van Zijp, H M and Philippens, M E P and Tijssen, R and Kok, J G M and de Groot-van Breugel, E N and Kiekebosch, I and Meijers, L T C and Nomden, C N and Sikkes, G G and Doornaert, P A H and Eppinga, W S C and Kasperts, N and Kerkmeijer, L G W and Tersteeg, J H A and Brown, K J and Pais, B and Woodhead, P and Lagendijk, J J W} } @Article { SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017, title = {The MeteoMet2 project – Highlights and results}, journal = {Measurement Science and Technology}, year = {2017}, month = {11}, day = {13}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa99fc}, stag_bib_extends_levelofaccess = {NA}, author = {Šindel{\'a}rov{\'a}, L. and Sestan, D. and Salminen, J. and Sairanen, H. and Rosso, L. and del Rio, J. and Rasmussen, M.K. and Oguz Aytekin, S. and de Podesta, M. and Pavlasek, P. and Nogueras Cervera, M. and Nielsen, J. and Musacchio, C. and Miao, P. and Lanza, L.G. and Kowal, A. and Kalemci, M. and Hudoklin, D. and H{\"o}gstr{\"o}m, R. and Hernandez de la Villa, S. and Heinonen, M. and Groselj, D. and Gonzalez Calvo, A. and Georgin, E. and Gardiner, T. and Garc{\'i}a Izquierdo, C. and Garcia-Benad{\'i}, A. and Fernicola, V and Ebert, V. and Drnovsek, J. and Dobre, M. and Cuccaro, R. and Coppa, G. and Colli, M. and Chiodo, N. and Castrillo, A. and del Campo, D. and Brunet, M. and Bojkovski, J. and Beltramino, G. and Bell, S.A. and Beges, G. and Sanna, F. and Merlone, A. and Smorgon, D. and Sparasci, F. and Strnad, R. and Vold{\'a}n, M. and Underwood, R.J. and Mana, G.} } @Article { vanderVeenGUTBG2017, title = {Validation and sensitivity evaluation of the ID-GC-TOF-MS method for determination of PAHs in biogas}, journal = {Journal of Chemical Metrology}, year = {2017}, month = {11}, volume = {11}, number = {2}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {78-85}, keywords = {PAH; biogas; biomethane; thermal desorption; isotope dilution; GC-TOF-MS}, tags = {EnG}, web_url = {http://www.acgpubs.org/JCM/2017/Volume\%2011/Issue\%201/11-JCM_2017-11-01.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {ACG Publications}, language = {30}, ISSN = {1307-6183}, DOI = {10.25135/jcm.11.17.11.01}, stag_bib_extends_levelofaccess = {NA}, author = {van der Veen, A. and Goren, A.C. and Un, I. and Tarhan, T. and Bilsel, G. and Gokcen, T.} } @Article { UlmKECCSHFB2017, subid = {450}, title = {A pilot study on fingerprinting Leishmania species from the Old World using Fourier transform infrared spectroscopy}, journal = {Analytical \& Bioanalytical Chemistry}, year = {2017}, month = {10}, day = {28}, volume = {409}, number = {29}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {6907-6923}, keywords = {Fourier transforminfrared spectroscopy, Hierarchical cluster analysis (HCA), Principal componentsanalysis (PCA), Leishmania, DNA, Multivariate differentiation}, misc2 = {EMPIR 2015: Health}, publisher = {Springer}, language = {30}, ISSN = {1618-2642}, DOI = {10.1007/s00216-017-0655-5}, stag_bib_extends_levelofaccess = {NA}, author = {Hornemann, A. and Sinning, D. and Cortes, S. and Campino, L. and Emmer, P. and Kuhls, K. and Ulm, G. and Frohme, M. and Beckhoff, B.} } @Article { QuinceyVTSPMMHWBWWSN2017, subid = {956}, title = {Mobility particle size spectrometers: Calibration procedures and measurement uncertainties}, journal = {Aerosol Science and Technology}, year = {2017}, month = {10}, day = {26}, volume = {52}, number = {2}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {146-164}, keywords = {aerosol metrology , mobility particle size spectrometers , calibration, measurement uncertainties}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, language = {30}, ISSN = {0278-6826, 1521-7388}, DOI = {10.1080/02786826.2017.1387229}, stag_bib_extends_levelofaccess = {NA}, author = {Wiedensohler, A. and Wiesner, A. and Weinhold, K. and Birmili, W. and Hermann, M. and Merkel, M. and M{\"u}ller, T. and Pfeifer, S. and Schmidt, A. and Tuch, T. and Velarde, F. and Quincey, P. and Seeger, S. and Nowak, A.} } @Article { TunnermannESHLWSSPB2017, subid = {388}, title = {Measuring thermal load in fiber amplifiers in the presence of transversal mode instabilities}, journal = {Optics Letters}, year = {2017}, month = {10}, day = {18}, volume = {42}, number = {21}, number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {4311-4314}, keywords = {Fiber optics amplifiers and oscillators, Thermal effects, Fiber properties, High power lasers}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-42-21-4311}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society of America}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.42.004311}, stag_bib_extends_levelofaccess = {NA}, author = {Beier, F. and Pl{\"o}tner, M. and Sattler, B. and Stutzki, F. and Walbaum, T. and Liem, A. and Haarlammert, N. and Schreiber, T. and Eberhardt, R. and T{\"u}nnermann, A.} } @Article { LestremauLKvBMBCBRYAB2017, title = {Suitability of vessels and adsorbents for the short-term storage of biogas/biomethane for the determination of impurities – Siloxanes, sulfur compounds, halogenated hydrocarbons, BTEX}, journal = {Biomass and Bioenergy}, year = {2017}, month = {10}, volume = {105}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {127-135}, keywords = {BiogasCompositionImpuritiesVesselsSampling}, tags = {EnG}, web_url = {http://www.sciencedirect.com/science/article/pii/S0961953417302118}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, DOI = {10.1016/j.biombioe.2017.06.025}, stag_bib_extends_levelofaccess = {NA}, author = {Lestremau, F. and Li, J. and Krom, I. and van der Veen, A.M.H. and Brewer, B. and Murugan, A. and Bartlett, S. and Culleton, L. and B{\"u}ker, O. and Rosell, L. and Yaghooby, H. and Arrhenius, K. and Beranek, J.} } @Inbook { GillBRBBNKJGBM2017, subid = {379}, title = {Absolute frequency measurement of the optical clock transition in 171Yb+ with an uncertainty of 4E-16 using a frequency link to international atomic time}, year = {2017}, month = {10}, volume = {65}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {221-227}, keywords = {Frequency metrology, optical frequency standards, international atomic time}, web_url = {http://empir.npl.co.uk/oc18/wp-content/uploads/sites/13/2016/04/Yb_J_Mod_Op.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Informa UK Limited}, booktitle = {Journal of Modern Optics}, language = {30}, ISBN = {0950-0340, 1362-3044}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1707.00646v2}, author = {Gill, P. and Bongs, K. and Rolland, A. and Baird, P.E.G. and Baynes, F. and Nisbet-Jones, P.B.R. and King, S.A. and Jones, J.M. and Godun, R.M. and Baynham, C.F.A. and Margolis, H.S.} } @Proceedings { GrandidierEBXFMDAHD2017, subid = {421}, title = {Nano-probing station incorporating MEMS probes for 1D device RF on-wafer characterization}, journal = {2017 47th European Microwave Conference (EuMC)}, year = {2017}, month = {10}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {MEMS GSG Probe, nano-prober, Nanowire, on-wafer, microwave}, web_url = {https://hal.archives-ouvertes.fr/hal-01726555}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Nuremberg}, event_name = {EuMC}, event_date = {08-10-2017 to 12-10-2017}, language = {30}, DOI = {10.23919/EuMC.2017.8230973}, stag_bib_extends_levelofaccess = {NA}, author = {Daff{\'e}, K. and Marzouk, J. and Fellahi, A. El and Xu, T. and Boyaval, C. and Eliet, S. and Grandidier, B. and Arscott, S. and Dambrine, G. and Haddadi, K.} } @Article { KabrtSBMRW2017, title = {Production and characterization of a traceable NORM material and its use in proficiency testing of gamma-ray spectrometry laboratories}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, day = {18}, volume = {134}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {45-50}, keywords = {Environmental radioactivity; Gamma-ray spectrometry; NORM; Reference material; Intercomparison; Interlaboratory comparison; Proficiency testing; Quartz sand; Drinking water treatment; Natural radionuclides}, web_url = {https://www.sciencedirect.com/science/article/pii/S0969804317305158}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2017.09.025}, stag_bib_extends_levelofaccess = {NA}, author = {Kabrt, F. and Stietka, M. and Baumgartner, A. and Maringer, F.J. and Riedl, J. and Wiedner, H.} } @Article { BosmaOP2017, title = {Effect of Pressure on Deep-Ocean Thermometers}, journal = {International Journal of Thermophysics}, year = {2017}, month = {9}, day = {13}, volume = {38}, number = {11}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Deep-ocean thermometers · Pressure effect · Thermistors}, web_url = {https://link.springer.com/article/10.1007/s10765-017-2297-4}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2297-4}, stag_bib_extends_levelofaccess = {NA}, author = {Bosma, R. and Ober, S. and Peruzzi, A.} } @Article { SeguiniMLZIFDPRDB2017, subid = {480}, title = {Influence of block copolymer feature size on reactive ion etching pattern transfer into silicon}, journal = {Nanotechnology}, year = {2017}, month = {9}, day = {12}, volume = {28}, number = {40}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {404001}, keywords = {block copolymers, reactive ion etching, self-assembly, cryogenic RIE, holey silicon}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6528/aa8144}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/aa8144}, stag_bib_extends_levelofaccess = {NA}, author = {Dialameh, M. and Ferrarese Lupi, F. and Imbraguglio, D. and Zanenga, F. and Lamperti, A. and Martella, D. and Seguini, G. and Perego, M. and Rossi, A.M. and De Leo, N. and Boarino, L.} } @Article { MoldersBHMRR2017, title = {Reproducibly emitting reference material on thermoplastic polyurethane basis for quality assurance/quality control of emission test chamber measurements}, journal = {Building and Environment}, year = {2017}, month = {9}, volume = {122}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {230-236}, keywords = {Reference material, Emissions testing, Volatile Organic Compounds, Polymeric material, CO2 assisted impregnation}, web_url = {https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/40646}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, address = {230 Park Avenue Suite 800 Shantae McGee 360 Park Avenue South New York NY 10169-0935 United States}, language = {30}, ISSN = {0360-1323}, DOI = {10.1016/j.buildenv.2017.06.005}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"o}lders, Nils and Br{\"o}dner, Doris and Horn, Wolfgang and Mull, Birte and Richter, Matthias and Renner, Manfred} } @Article { BrodnerHSSMR2017, title = {Reproducibly emitting reference materials for volatile and semi-volatile organic compounds—using finite element modeling for emission predictions}, journal = {Air Quality, Atmosphere \& Health}, year = {2017}, month = {9}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, keywords = {Emitting reference material, Emission test chamber, Micro-chamber, FEM model}, web_url = {https://link.springer.com/article/10.1007/s11869-017-0508-6}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature}, language = {30}, ISSN = {1873-9318, 1873-9326}, DOI = {10.1007/s11869-017-0508-6}, stag_bib_extends_levelofaccess = {NA}, author = {Br{\"o}dner, Doris and Horn, Wolfgang and Schultealbert, Caroline and Sauerwald, Tilman and Mull, Birte and Richter, Matthias} } @Article { FailleauHHPSRBZARGVSSKSPLG2017, title = {Metrology for decommissioning nuclear facilities: Partial outcomes of joint research project within the European Metrology Research Program}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Decommissioning, Sample preparation, Metrology}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.032}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Hay, B. and Holm, P. and Per{\"a}j{\"a}rvi, K. and Sand, J. and Rogiers, B. and Boden, S. and Zapata-Garc{\'i}a, D. and Arnold, D. and Russell, B. and Garcia Miranda, M. and Van Ammel, R. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Plumeri, S. and Laurent Beck, Y. and Grisa, T.} } @Article { BogucarskaPdJASSSKSTv2017, title = {New high-throughput measurement systems for radioactive wastes segregation and free release}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {nuclear decommissioning, radioactive waste, free release, clearance level}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.09.043}, stag_bib_extends_levelofaccess = {NA}, author = {Bogucarska, T. and Pedersen, B. and De Felice, P. and Jerome, S. and Arnold, D. and Skala, L. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Tzika, F. and Van Ammel, R.} } @Article { ChoiGIBFBGRPH2017, title = {Effect of Handling, Packing and Transportation on the Moisture of Timber Wood}, journal = {International Journal of Thermophysics}, year = {2017}, month = {8}, day = {29}, volume = {38}, number = {10}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Effect of ambient humidity, Moisture content, Timber wood,Transportation, Wood handling}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2292-9}, stag_bib_extends_levelofaccess = {NA}, author = {Choi, B.I. and Gelil, D.A.E. and Ismail, N. and Beltramino, G. and Fernicola, V. and Ben Ayoub, M.W. and Georgin, E. and Rudolfov{\'a}, M. and Palkova, Z. and Heinonen, M.} } @Proceedings { ZhouLLHBEK2017, subid = {463}, title = {Measurement of the Internal Inductance of Impulse Voltage Generators and the Limits of LI Front Times.}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {lightning impulse, time parameters, front time, impulse generator}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International conference on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_569-measurement-of-the-internal-inductance-of-impulse-voltage-generators-and-the-limits-of-li-front-times}, author = {Zhou, L. and Li, Y. and Larzelere, W. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Elg, A.P. and Kl{\"u}ss, J.} } @Proceedings { HallstromBNEMP2017, subid = {460}, title = {Characterization of a fast step generator}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Step response, impulse measurment, lightning impulse}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_484-characterization-of-a-fast-step-generator}, author = {H{\"a}llstr{\"o}m, J. and Bergman, A. and Nordlund, M. and Elg, A.P. and Meisner, J. and Passon, S.} } @Proceedings { BergmanN2017, subid = {467}, title = {Characterisation at low voltage of two reference lightning impulse generators}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {lightning impulse, reference measuring system, calibration}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_485-characterisation-at-low-voltage-of-two-reference-lightning-impulse-dividers}, author = {Bergman, A. and Nordlund, M.} } @Proceedings { BergmanNEHMH2017, subid = {461}, title = {Influence of coaxial cable on response of high voltage resistive dividers}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Lightning impulse, pulse response, front time}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_487-influence-of-coaxial-cable-on-response-of-high-voltage-resistive-dividers}, author = {Bergman, A. and Nordlund, M. and Elg, A.P. and Havunen, J. and Meisner, J. and H{\"a}llstr{\"o}m, J.} } @Proceedings { ElgHB2017, subid = {462}, title = {Evaluation of step response of transient recorders for lightning impulse}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Step response, lightning impulse, transient recorder}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_488-evaluation-of-step-response-of-transient-recorders-for-lightning-impulse}, author = {Elg, A.P. and H{\"a}llstr{\"o}m, J. and Bergman, A.} } @Proceedings { HavunenHBB2017, subid = {458}, title = {Using Deconvolution for Correction of Non-Ideal Step Response of Lightning Impulse Digitizers and Measurement Systems}, journal = {e-cigre}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Lightning impulse, Deconvolution}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_381-using-deconvolution-for-correction-of-non-ideal-step-response-of-lightning-impulse-digitizers-and-measurement-systems}, author = { Havunen, J. and H{\"a}llstr{\"o}m, J. and Bergman, A.E. and Bergman, A.} } @Article { DegiovanniAPRLVTGBCVG2017, subid = {334}, title = {Determining the quantum expectation value by measuring a single photon}, journal = {Nature Physics}, year = {2017}, month = {8}, day = {14}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {4}, keywords = {Protective Measurements, Weak Measurements}, web_url = {https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf;}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/nphys4223}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Rebufello, E. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { SuterSSPOMKHGFBAKLWS2017, title = {The CLARA/NORSAT-1 solar absolute radiometer: instrument design, characterization and calibration}, journal = {Metrologia}, year = {2017}, month = {8}, day = {10}, volume = {54}, number = {5}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {674-682}, keywords = {solar irradiance, satellite measurements, electrical substitution radiometer, cavity detector, sun}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa7a63}, stag_bib_extends_levelofaccess = {NA}, author = {Suter, M. and Spescha, M. and Soder, R. and Pfiffner, D, and Oliva, A.R. and Mingard, N. and Koller, S. and Heuerman, K. and Gyo, M. and Finsterle, W. and Beck, I. and Andersen, B. and Kopp, G. and Levesque, P.L. and Walter, B. and Schmutz, W.} } @Article { LodewyckTBEBV2017, subid = {400}, title = {A noise-immune cavity-assisted non-destructive detection for an optical lattice clock in the quantum regime}, journal = {New Journal of Physics}, year = {2017}, month = {8}, volume = {19}, number = {8}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {083002}, keywords = {optical clock, frequency stability, optical lattice clock, non-destructive detection, spin squeezing}, web_url = {http://iopscience.iop.org/1367-2630/19/8/083002}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/aa7c84}, stag_bib_extends_levelofaccess = {NA}, author = {Lodewyck, J. and Targat, R.L. and Bilicki, S. and Eismann, U. and Bookjans, E. and Vallet, G.} } @Article { StangaSBG2017, title = {Determination of the neutron activation profile of core drill samples by gamma-ray spectrometry}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Gamma spectrometry, Activity profile, Core sample, Concrete activation}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.004}, stag_bib_extends_levelofaccess = {NA}, author = {Stanga, D. and Sima, O. and Boden, S. and Gurau, D.} } @Article { GreilichKBKBSSP2017, subid = {601}, title = {Radiation dosimetry in magnetic fields with Farmer-type ionization chambers: determination of magnetic field correction factors for different magnetic field strengths and field orientations}, journal = {Physics in Medicine \& Biology}, year = {2017}, month = {8}, volume = {62}, number = {16}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {6708-6728}, keywords = {Dosimetry, MRgRT, Radiotherapy, Magnetic fields}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aa7ae4}, stag_bib_extends_levelofaccess = {NA}, author = {Spindeldreier, C K and Schrenk, O and Bakenecker, A and Kawrakow, I and Burigo, L and Karger, C P and Greilich, S and Pfaffenberger, A} } @Article { KeightleyBPVPBGW2017, title = {Compact radioactive aerosol monitoring device for early warning networks}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, volume = {126}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {219-224}, keywords = {Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.12.036}, stag_bib_extends_levelofaccess = {NA}, author = {Keightley, L. and Bell, S.J. and Ponikvar, D. and Vencelj, M. and Petrovič, T. and Brodnik, D. and Glavič-Cindro, D. and Woods, S.} } @Article { VandervorstMAFDKBV2017, subid = {565}, title = {Atom probe tomography analysis of SiGe fins embedded in SiO 2 : Facts and artefacts}, journal = {Ultramicroscopy}, year = {2017}, month = {8}, volume = {179}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {100-107}, keywords = {Atom probe tomography, Tip shape, FinFET, Local magnification, Trajectory overlaps}, web_url = {https://lirias2repo.kuleuven.be/rest/bitstreams/515063/retrieve}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2017.04.006}, stag_bib_extends_levelofaccess = {NA}, author = {Melkonyan, D. and Fleischmann, C. and Arnoldi, L. and Demeulemeester, J. and Kumar, A. and Bogdanowicz, J. and Vurpillot, F. and Vandervorst, W.} } @Article { LecuelleMLDMFOFB2017, subid = {897}, title = {In vivo XCT bone characterization of lattice structured implants fabricated by additive manufacturing}, journal = {Heliyon}, year = {2017}, month = {8}, volume = {3}, number = {8}, number2 = {15HLT09: MetAMMI: Metrology for additively manufactured medical implants}, pages = {e00374}, keywords = {Bioengineering; Biomedical engineering; Dentistry; Materials science; Medical imaging}, web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5669606/}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2405-8440}, DOI = {10.1016/j.heliyon.2017.e00374}, stag_bib_extends_levelofaccess = {NA}, author = {Obaton, A.F. and Fain, J. and Djema{\"i}, M. and Meinel, D. and L{\'e}onard, F. and Mah{\'e}, E. and L{\'e}cuelle, B. and Fouchet, J.J. and Bruno, G.} } @Article { DuaneFSBGSBR2017, subid = {429}, title = {Reply to Comment on ‘Development of a primary standard for absorbed dose from unsealed radionuclide solutions’}, journal = {Metrologia}, year = {2017}, month = {7}, day = {27}, volume = {54}, number = {4}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {615-616}, keywords = {dosimetry, radionuclide solution, extrapolation chamber, primary standard,validation of dose calculation}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa78ff/meta}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa78ff}, stag_bib_extends_levelofaccess = {NA}, author = {Billas, I and Shipley, D and Galer, S and Bass, G and Sander, T and Fenwick, A and Duane, S and Smyth, V.} } @Article { BoudotdYTCBA2017, title = {High-contrast sub-Doppler absorption spikes in a hot atomic vapor cell exposed to a dual-frequency laser field}, journal = {New Journal of Physics}, year = {2017}, month = {7}, day = {25}, volume = {19}, number = {7}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {073028}, keywords = {Counterpropagating light waves, saturation spectroscopy, dark resonances, diode-lasers; d-1 line, d1 line, d2 line}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/aa7258}, stag_bib_extends_levelofaccess = {NA}, author = {Boudot, R. and de Clercq, E. and Yudin, V. and Taichenachev, A. and Coget, G. and Brazhnikov, D. and Abdel Hafiz, M.} } @Article { MasowskiLCCBAPMNNlLKBKMZCPBT2017, subid = {402}, title = {Fibre-optic delivery of time and frequency to VLBI station}, journal = {Astronomy \& Astrophysics}, year = {2017}, month = {7}, volume = {603}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {A48}, keywords = {high angular resolution instrumentation, interferometers}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {EDP Sciences}, language = {30}, ISSN = {0004-6361, 1432-0746}, DOI = {10.1051/0004-6361/201730615}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Buczek, L. and Kołodziej, J. and Lipiński, M. and Śliwczyński, Ł. and Nawrocki, J. and Nogaś, P. and Marecki, A. and Pazderski, E. and Ablewski, P. and Bober, M. and Ciuryło, R. and Cygan, A. and Lisak, D. and Masłowski, P. and Morzyński, P. and Zawada, M. and Campbell, R. M. and Pieczerak, J. and Binczewski, A. and Turza, K.} } @Proceedings { SliwczynskiKBBT2017, subid = {443}, title = {Time and frequency transfer in modern DWDM telecommunication networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/fcs.2017.8088894}, stag_bib_extends_levelofaccess = {NA}, author = {Turza, K. and Binczewski, A. and Bogacki, W. and Krehlik, P. and Śliwczyński, L.} } @Proceedings { SliwczynskiKKIPESB2017, subid = {444}, title = {Fiber optic time transfer between PTB and Deutsche Telekom using multi-link redundant topology}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/FCS.2017.8088999}, stag_bib_extends_levelofaccess = {NA}, author = {Śliwczyński, L. and Krehlik, P. and Kolodziej, J. and Imlau, H. and Ender, H. and Schnatz, H. and Piester, D. and Bauch, A.} } @Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017, subid = {477}, title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fibre, network, clock, time, dissemination, service}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/FCS.2017.8089004}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Dostal, J. and Radil, J. and Smotlacha, V. and Velc, R. and Vojtech, J. and Campanella, M. and Calonico, D. and Clivati, C. and Levi, F. and Č{\'i}p, O. and Rerucha, S. and Holzwarth, R. and Lessing, M. and Camargo, F. and Desruelle, B. and Lautier-Gaud, J. and English, E.L. and Kronj{\"a}ger, J. and Whibberley, P. and Pottie, P.E. and Tavares, R. and Tuckey, P. and John, F. and Snajder, M. and Stefl, J. and Nogaś, P. and Urbaniak, R. and Binczewski, A. and Bogacki, W. and Turza, K. and Grosche, G. and Schnatz, H. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.} } @Article { RuhlBTRFUPKHKHU2017, subid = {848}, title = {Enhancing the sensitivity of nano-FTIR spectroscopy}, journal = {Optics Express}, year = {2017}, month = {7}, volume = {25}, number = {14}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {16574}, keywords = {Instrumentation, measurement, and metrology; Near-field microscopy}, web_url = {https://www.osapublishing.org/DirectPDFAccess/158D237A-A0E8-5960-84426107CE1CBCF4_369006/oe-25-14-16574.pdf?da=1\&id=369006\&seq=0\&mobile=no}, misc2 = {EMPIR 2015: Health}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.25.016574}, stag_bib_extends_levelofaccess = {NA}, author = {Hermann, P. and K{\"a}stner, B. and Hoehl, A. and Kashcheyevs, V. and Patoka, P. and Ulrich, G. and Feikes, J. and Ries, M. and Tydecks, T. and Beckhoff, B. and Ruhl, E. and Ulm, G.} } @Article { HudlickaSBFH2017, subid = {769}, title = {Optical and RF metrology for 5G}, journal = {2017 IEEE Photonics Society Summer Topical Meeting Series (SUM)}, year = {2017}, month = {7}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Optical variables measurement, 5G mobile communication, Transmission line measurements, Photodiodes, Adaptive optics, Optical fiber communication, Oscilloscopes}, web_url = {https://arxiv.org/abs/1809.08934}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/PHOSST.2017.8012717}, stag_bib_extends_levelofaccess = {NA}, author = {Humphreys, D.A. and Fatadin, I. and Bieler, M. and Struszewski, P. and Hudlicka, M.} } @Article { UnterumsbergerPLKHHWB2017, title = {Determination of SiO2 and C layers on a monocrystalline silicon sphere by reference-free x-ray fluorescence analysis}, journal = {Metrologia}, year = {2017}, month = {6}, day = {28}, volume = {54}, number = {4}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {481-486}, keywords = {Avogadro project, X-ray fluorescence, quantification}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa765f}, stag_bib_extends_levelofaccess = {NA}, author = {Unterumsberger, R. and Pollakowski-Herrmann, B. and Lubeck, J. and Kolbe, M. and Holfelder, I. and H{\"o}nicke, P and Weser, J. and Beckhoff, B.} } @Article { MasowskiCZDBCAMWBL2017, subid = {387}, title = {Absolute frequency determination of molecular transition in the Doppler regime at kHz level of accuracy}, journal = {Journal of Quantitative Spectroscopy and Radiative Transfer}, year = {2017}, month = {6}, day = {11}, volume = {201}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {156-160}, keywords = {Transition frequency, Absolute frequency measurement, Optical atomic clock, Oxygen B band, Cavity ring-down spectroscopy}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0022-4073}, DOI = {10.1016/j.jqsrt.2017.07.010}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/pdf/1705.06639.pdf}, author = {Bielska, K. and W{\'o}jtewicz, S. and Morzyński, P. and Ablewski, P. and Cygan, A. and Bober, M. and Domysławska, J. and Zawada, M. and Ciuryło, R. and Masłowski, P. and Lisak, D.} } @Article { HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017, subid = {141}, title = {Test of Special Relativity Using a Fiber Network of Optical Clocks}, journal = {Physical Review Letters}, year = {2017}, month = {6}, volume = {118}, number = {22}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, web_url = {https://arxiv.org/abs/1703.04426}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.118.221102}, stag_bib_extends_levelofaccess = {NA}, author = {Delva, P. and Lodewyck, J. and Bilicki, S. and Bookjans, E. and Vallet, G. and Le Targat, R. and Pottie, P.-E. and Guerlin, C. and Meynadier, F. and Le Poncin-Lafitte, C. and Lopez, O. and Amy-Klein, A. and Lee, W.-K. and Quintin, N. and Lisdat, C. and Al-Masoudi, A. and D{\"o}rscher, S. and Grebing, C. and Grosche, G. and Kuhl, A. and Raupach, S. and Sterr, U. and Hill, I. R. and Hobson, R. and Bowden, W. and Kronj{\"a}ger, J. and Marra, G. and Rolland, A. and Baynes, F. N. and Margolis, H. S. and Gill, P.} } @Article { MonteALBGRRKMAG2017, title = {Defect characterisation of tensile loaded CFRP and GFRP laminates used in energy applications by means of infrared thermography}, journal = {Quantitative InfraRed Thermography Journal}, year = {2017}, month = {6}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-20}, keywords = {Defect characterisation CFRP and GFRP laminates energy applications infrared thermography}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1768-6733, 2116-7176}, DOI = {10.1080/17686733.2017.1334312}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Aktas, A. and Lodeiro, M. and Baker, G. and Gower, M. and Rehmer, B. and R{\"o}llig, M. and Krankenhagen, R. and Maierhofer, C. and Adibekyan, A. and Gutschwager, B.} } @Article { BoothGOVNNFDT2017, title = {Single-Ended Differential Protection in MTDC Networks Using Optical Sensors}, journal = {IEEE Transactions on Power Delivery}, year = {2017}, month = {6}, volume = {32}, number = {3}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {1605-1615}, keywords = {HVDC protection, multi-terminal direct current, modular multi-level converters, optical sensors.}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-8977, 1937-4208}, DOI = {10.1109/TPWRD.2016.2645231}, stag_bib_extends_levelofaccess = {NA}, author = {Booth, C.D. and Gordon, N. and Orr, P. and Vozikis, D. and Niewczas, P. and Nelson, J. and Fusiek, G. and Dysko, A. and Tzelepis, D.} } @Proceedings { SchutzeKSGRSBL2017, title = {Highly sensitive benzene detection with MOS gas sensors}, journal = {Proceedings Sensor 2017}, year = {2017}, month = {6}, volume = {A4 - Gas S}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {92-97}, keywords = {metal oxide semiconductor, MOS, temperature-cycled operation, TCO, benzene}, web_url = {https://www.ama-science.org/proceedings/details/2498}, misc2 = {EMRP A169: Call 2013 Environment II}, event_place = {Nurember}, event_name = {AMA Conferences 2017 – SENSOR 2017}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, ISBN = {978-3-9816876-4-4}, DOI = {10.5162/sensor2017/A4.3}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}tze, Andreas and Kok, Gertjan and Spinelle, Laurent and Gerboles, Michel and Reimringer, Wolfhard and Sauerwald, Tilman and Baur, Tobias and Leidinger, Martin} } @Article { HoutzagerBKv2017, title = {AC–DC Calibrations With a Pulse-Driven AC Josephson Voltage Standard Operated in a Small Cryostat}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {6}, volume = {66}, number = {6}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1391-1396}, keywords = {AC–DC difference, Josephson voltage standard, measurement standards, measurement techniques, voltagemeasurement.}, web_url = {http://ieeexplore.ieee.org/document/7898429/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2662381}, stag_bib_extends_levelofaccess = {NA}, author = {Houtzager, E. and Bauer, S. and Kieler, O.F.O. and van den Brom, H.E.} } @Article { ManderEBCB2017, title = {A methodology for study of in-service drift of meteorological humidity sensors}, journal = {Metrologia}, year = {2017}, month = {5}, day = {26}, volume = {54}, number = {3}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {S63-S73}, keywords = {humidty, meteorology, sensor drift}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa6dd0/meta;jsessionid=69E0689027FB9B75F14F77239651C49F.ip-10-40-1-105}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa6dd0}, stag_bib_extends_levelofaccess = {NA}, author = {Mander, N and England, C and Beardmore, S L and Carroll, P A and Bell, S A} } @Article { ClivatiLIDCSDCBI2017, subid = {140}, title = {Measuring molecular frequencies in the 1-10 µm range at 11-digits accuracy}, journal = {Atomic Physics (physics.atom-ph)}, year = {2017}, month = {5}, day = {18}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {molecular frequencies}, misc2 = {EMPIR 2015: SI Broader Scope}, language = {30}, DOI = {10.1038/s41598-017-12891-6}, stag_bib_extends_levelofaccess = {NA}, author = {Insero, G. and Borri, S. and Calonico, D. and Cancio Pastor, P. and Clivati, C. and D’Ambrosio, D. and De Natale, P. and Inguscio, M. and Levi, F. and Santambrogio, G.} } @Proceedings { BurgerTMC2017, subid = {851}, title = {Modelling of standard and specialty fibre-based systems using finite element methods}, journal = {Proc. SPIE}, year = {2017}, month = {5}, day = {17}, volume = {10683}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1068336}, keywords = {Finite element modelling, modal distribution, specialty fibres}, web_url = {http://arxiv.org/abs/1807.10811}, misc2 = {EMPIR 2014: Industry}, event_place = {Strasbourg}, event_name = {Fiber Lasers and Glass Photonics: Materials through Applications}, event_date = {22-04-2018 to 26-04-2018}, language = {30}, DOI = {10.1117/12.2307372}, stag_bib_extends_levelofaccess = {NA}, author = {Castagna, N. and Morel, J. and Testa, L. and Burger, S.} } @Article { CaldersBADNMOB2017, title = {Evaluation of the Range Accuracy and the Radiometric Calibration of Multiple Terrestrial Laser Scanning Instruments for Data Interoperability}, journal = {IEEE Transactions on Geoscience and Remote Sensing}, year = {2017}, month = {5}, volume = {55}, number = {5}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {2716-2724}, keywords = {Data interoperability, radiometric calibration, RIEGL VZ-400, terrestrial light detection and ranging (LiDAR).}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, USA}, language = {30}, ISSN = {0196-2892, 1558-0644}, DOI = {10.1109/TGRS.2017.2652721}, stag_bib_extends_levelofaccess = {NA}, author = {Calders, Kim and Burt, Andrew and Armston, John and Disney, Mathias I. and Nightingale, Joanne and Muir, Jasmine and Origo, Niall and Brede, Benjamin} } @Article { LopezAPBSL2017, subid = {139}, title = {Hybrid fiber links for accurate optical frequency comparison}, journal = {Applied Physics B}, year = {2017}, month = {5}, volume = {123}, number = {5}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {Hybrid fiber links, accurate optical frequency comparison,}, web_url = {https://link.springer.com/article/10.1007/s00340-017-6736-5}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-017-6736-5}, stag_bib_extends_levelofaccess = {NA}, author = {Lee, W.K. and Stefani, F. and Bercy, A. and Lopez, O. and Amy-Klein, A. and Pottie, P.E.} } @Article { SantarelliLLCCMWKKCSNRQDLBRGGAWGALLPG2017, subid = {138}, title = {First international comparison of fountain primary frequency standards via a long distance optical fiber link}, journal = {Metrologia}, year = {2017}, month = {5}, volume = {54}, number = {3}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {348-354}, keywords = {optical fiber frequency transfer, atomic fountain clocks, international fountain, clock comparison}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa65fe}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa65fe}, stag_bib_extends_levelofaccess = {NA}, author = {Guena, J and Weyers, S and Abgrall, M and Grebing, C and Gerginov, V and Rosenbusch, P and Bize, S and Lipphardt, B and Denker, H and Quintin, N and Raupach, S M F and Nicolodi, D and Stefani, F and Chiodo, N and Koke, S and Kuhl, A and Wiotte, F and Meynadier, F and Camisard, E and Chardonnet, C and Le Coq, Y and Lours, M and Santarelli, G and Amy-Klein, A and Le Targat, R and Lopez, O and Pottie, P E and Grosche, G} } @Article { BhattacharyaUPRH2017, title = {Temperature measurement using frequency comb absorption spectroscopy of CO2}, journal = {Review of Scientific Instruments}, year = {2017}, month = {5}, volume = {88}, number = {5}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {053113}, keywords = {spectroscopy, frequency comb laser}, web_url = {http://aip.scitation.org/doi/10.1063/1.4984252}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4984252}, stag_bib_extends_levelofaccess = {NA}, author = {Bhattacharya, N. and Urbach, H. P. and Persijn, S. T. and Reyes-Reyes, A. and H{\"a}nsel, A.} } @Article { KochGIIGHKBWK2017, subid = {174}, title = {Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI}, journal = {PLOS ONE}, year = {2017}, month = {4}, day = {12}, volume = {12}, number = {4}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {1-19}, keywords = {Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI}, misc2 = {EMPIR 2015: Health}, address = {San Francisco, California, and Cambridge, United Kingdom.}, language = {30}, DOI = {10.1371/journal.pone.0174420}, stag_bib_extends_levelofaccess = {NA}, author = {Weichenberger, Markus and Bauer, Martin and K{\"u}hler, Robert and Hensel, Johannes and Forlim, C. G. and Ihlenfeld, Albrecht and Ittermann, Bernd and Gallinat, J{\"u}rgen and Koch, Christian and K{\"u}hn, Simone} } @Article { BialekH2017, title = {Cause, Effect, and Correction of Field Spectroradiometer Interchannel Radiometric Steps}, journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing}, year = {2017}, month = {4}, volume = {10}, number = {4}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {1542-1551}, keywords = {Fieldspectroscopy, radiometry, sensor model, temperature dependence}, web_url = {http://ieeexplore.ieee.org/document/7819458/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New Jersey}, language = {30}, ISSN = {1939-1404, 2151-1535}, DOI = {10.1109/JSTARS.2016.2625043}, stag_bib_extends_levelofaccess = {NA}, author = {Bialek, A. and Hueni, A.} } @Article { CarmeleRBSSSGSSvTHKR2017, subid = {234}, title = {A bright triggered twin-photon source in the solid state}, journal = {Nature Communications}, year = {2017}, month = {4}, volume = {8}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {14870}, keywords = {Quantum dots, Quantum optics, Single photons and quantum effects .}, web_url = {https://www.nature.com/articles/ncomms14870}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms14870}, stag_bib_extends_levelofaccess = {NA}, author = {Heindel, T. and Thoma, A. and von Helversen, M. and Schmidt, M. and Schlehahn, A. and Gschrey, M. and Schnauber, P. and Schulze, J. -H. and Strittmatter, A. and Beyer, J. and Rodt, S. and Carmele, A. and Knorr, A. and Reitzenstein, S.} } @Article { KataokaAKBG2017, subid = {313}, title = {Robust operation of a GaAs tunable barrier electron pump}, journal = {Metrologia}, year = {2017}, month = {4}, volume = {54}, number = {3}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {299-306}, keywords = {single-electron pumps, primary electrical metrology, current standards}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/54/1/S1/meta;jsessionid=4918445C3978B8F392DE6A658FA21463.ip-10-40-1-105}, web_url2 = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa634c}, stag_bib_extends_levelofaccess = {NA}, author = {Giblin, S P and Bae, M-H and Kim, N and Ahn, Ye-Hwan and Kataoka, M} } @Article { JehlBKCVSHLBKC2017, subid = {369}, title = {Design and Operation of CMOS-Compatible Electron Pumps Fabricated With Optical Lithography}, journal = {IEEE Electron Device Letters}, year = {2017}, month = {4}, volume = {38}, number = {4}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {414-417}, keywords = {Quantum dots, Quantum effect semiconductor devices, Quantization, Current control}, web_url = {https://arxiv.org/abs/1612.09547}, web_url2 = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0741-3106, 1558-0563}, DOI = {10.1109/LED.2017.2670680}, stag_bib_extends_levelofaccess = {NA}, author = {Clapera, P. and Klochan, J. and Lavieville, R. and Barraud, S. and Hutin, L. and Sanquer, M. and Vinet, M. and Cinins, A. and Barinovs, G. and Kashcheyevs, V. and Jehl, X.} } @Article { PrancePPJHHGGBPB2017, subid = {504}, title = {On-chip magnetic cooling of a nanoelectronic device}, journal = {Scientific Reports}, year = {2017}, month = {4}, volume = {7}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {45566}, keywords = {Electronic devices, Electronic properties and materials}, web_url = {https://www.nature.com/articles/srep45566}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep45566}, stag_bib_extends_levelofaccess = {NA}, author = {Bradley, D. I. and Gu{\'e}nault, A. M. and Gunnarsson, D. and Haley, R. P. and Holt, S. and Jones, A. T. and Pashkin, Y. A. and Penttil{\"a}, J. and Prance, J. R. and Prunnila, M. and Roschier, L.} } @Thesis { Boles2017, subid = {312}, title = {Development of Traceable Capabilities in Non-Contact Thermal Metrology}, year = {2017}, month = {3}, day = {31}, number2 = {14RPT05: Eura-Thermal: Developing traceable capabilities in thermal metrology}, keywords = {Blackbody cavity, Radiation thermometer, Blackbody orientation, Infrared thermometer, Calibration}, web_url = {http://arrow.dit.ie/engmas/53/}, misc2 = {EMPIR 2014: Research Potential}, publisher = {DIT, Dublin, Ireland}, school = {Dublin Institute of Technology}, language = {30}, ISBN = {10.21427/D7B90D}, ISSN = {10.21427/D7B90D}, DOI = {10.21427/D7B90D}, stag_bib_extends_levelofaccess = {NA}, author = {Boles, S.} } @Article { LassilaHPBH2017, title = {Interferometric 2D small angle generator for autocollimator calibration}, journal = {Metrologia}, year = {2017}, month = {3}, day = {30}, volume = {54}, number = {3}, number2 = {SIB58: Angles: Angle metrology}, pages = {253-261}, keywords = {autocollimator, interferometry, metrology, angle measurement}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa648d}, stag_bib_extends_levelofaccess = {NA}, author = {Lassila, A. and Hemming, B. and Palosuo, I. and Byman, V. and Heikkinen, V.} } @Article { HusainLTYBSSTKFH2017, subid = {30}, title = {Single Carrier Trapping and De-trapping in Scaled Silicon Complementary Metal-Oxide-Semiconductor Field-Effect Transistors at Low Temperatures}, journal = {Semiconductor Science and Technology}, year = {2017}, month = {3}, day = {24}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Coulomb blockade, MOSFETs, Carrier Trapping and De-trapping, quantum dots}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0268-1242, 1361-6641}, DOI = {10.1088/1361-6641/aa6910}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Zuo and Husain, Muhammad and Yoshimoto, Hiroyuki and Tani, Kazuki and Sasago, Yoshitaka and Hisamoto, Digh and Fletcher, Jonathan and Kataoka, Masaya and Tsuchiya, Yoshishige and Saito, Shinichi} } @Article { GotzingerVPCLSMIBS2017, title = {Experimental demonstration of a predictable single photon source with variable photon flux}, journal = {Metrologia}, year = {2017}, month = {3}, day = {21}, volume = {54}, number = {2}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {218-223}, keywords = {single photon sources, single photon metrology, silicon vacancy center, low optical flux detector, photon on demand}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa5ba2}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}tzinger, S. and Vaigu, A. and Porrovecchio, G. and Chu, X.L. and Lindner, S. and Smid, M. and Manninen, A. and Ikonen, E. and Becher, C. and Sandoghdar, V.} } @Miscellaneous { RoscoeB, title = {Real-time measurement of Phasor Measurement Unit (PMU) reporting latency}, journal = {Github}, year = {2017}, month = {3}, day = {20}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, keywords = {Communications, IEC 61850, IEEE 1588, IEEE C37.118, phasor measurement units (PMUs), Sampled Values, time synchronisation}, misc2 = {EMRP A169: Call 2013 Energy II}, language = {30}, DOI = {10.5281/zenodo.400934}, stag_bib_extends_levelofaccess = {NA}, author = {Roscoe, Andrew and Blair, Steven} } @Article { BrunzendorfWSLEW2017, title = {High-resolution Fourier transform measurements of line strengths in the 00\verb=^=02-00\verb=^=00 main isotopologue band of nitrous oxide}, journal = {Applied Optics}, year = {2017}, month = {3}, day = {17}, volume = {56}, number = {11}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {E99-E105}, keywords = {Nitrous oxide, Fourier transform infrared spectroscopy, spectral line parameters, line strengths, gas metrology}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW Washington, DC 20036-1023, USA}, language = {30}, ISSN = {0003-6935, 1539-4522}, DOI = {10.1364/ao.56.000e99}, stag_bib_extends_levelofaccess = {NA}, author = {Brunzendorf, Jens and Werwein, Viktor and Serdyukov, Anton and Li, Gang and Ebert, Volker and Werhahn, Olav} } @Article { deClercqGYCAB2017, title = {A high-performance Raman-Ramsey Cs vapor cell atomic clock}, journal = {Journal of Applied Physics}, year = {2017}, month = {3}, day = {14}, volume = {121}, number = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {104903}, keywords = {Frequency standard, laser, resonances, stability, shift}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979, 1089-7550}, DOI = {10.1063/1.4977955}, stag_bib_extends_levelofaccess = {NA}, author = {de Clercq, E. and Gu{\'e}randel, S. and Yun, P. and Coget, G. and Abdel Hafiz, M. and Boudot, R.} } @Article { ZoladekLemanczykBNKCS2017, title = {Fabrication of air-stable, large-area, PCDTBT:PC70BM polymer solar cell modules using a custom built slot-die coater}, journal = {Solar Energy Materials and Solar Cells}, year = {2017}, month = {3}, volume = {161}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {388-396}, keywords = {Slot-die coating; Polymer Solar Cells (PSC); Large-area; Ambient stability; PCDTBT:PC70BM; Light beam induced current (LBIC); Photoluminescence (PL)}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York, United States}, language = {30}, ISSN = {0927-0248}, DOI = {10.1016/j.solmat.2016.12.019}, stag_bib_extends_levelofaccess = {NA}, author = {Zoladek-Lemanczyk, Alina and Bausi, Francesco and New, Edward and Kutsarov, Dimitar I. and Castro, Fernando A. and Silva, S. Ravi P.} } @Article { BettsBHCKG2017, title = {Compressed Sensing Current Mapping Spatial Characterization of Photovoltaic Devices}, journal = {IEEE Journal of Photovoltaics}, year = {2017}, month = {3}, volume = {7}, number = {2}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {486-492}, keywords = {Compressed sensing (CS), light beam induced current (LBIC)measurements, solar cells, spatial characterization}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {Piscataway, New Jersey}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2646900}, stag_bib_extends_levelofaccess = {NA}, author = {Betts, TR and Bliss, M and Hall, SRG and Cashmore, M and Koutsourakis, G and Gottschalg, R} } @Article { WollschlagerHBGLP2017, title = {Note: Nanomechanical characterization of soft materials using a micro-machined nanoforce transducer with an FIB-made pyramidal tip}, journal = {Review of Scientific Instruments}, year = {2017}, month = {3}, volume = {88}, number = {3}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {036104}, keywords = {MEMS, nanoindentation, soft materials}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4977474}, stag_bib_extends_levelofaccess = {NA}, author = {Wollschl{\"a}ger, N. and Hiller, K. and Brand, U. and Gao, S. and Li, Z. and Pohlenz, F.} } @Proceedings { LiSBFKHTLS2017, subid = {1124}, title = {Transport properties in silicon nanowire transistors with atomically flat interfaces}, journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, year = {2017}, month = {2}, day = {28}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {narrow channel effect, silicon nanowire, SOI, TMAH, self-limiting oxidation}, web_url = {https://eprints.soton.ac.uk/402316/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Toyama}, event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, event_date = {28-02-2017 to 02-03-2017}, language = {30}, DOI = {10.1109/EDTM.2017.7947561}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, F. and Husain, M.K. and Li, Z. and Sotto, M.S.H. and Burt, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.} } @Article { deLauretoBPSSFD2017, subid = {453}, title = {\(\alpha\)-Synuclein structural features inhibit harmful polyunsaturated fatty acid oxidation, suggesting roles in neuroprotection}, journal = {Journal of Biological Chemistry}, year = {2017}, month = {2}, day = {23}, volume = {292}, number = {17}, number2 = {15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases}, pages = {6927-6937}, keywords = {\(\alpha\)-synuclein (\(\alpha\)-synuclein), lipid oxidation, mass spectrometry, (MS) polyunsaturated fatty acid (PUFA), protein chemical modification}, web_url = {http://www.jbc.org/content/292/17/6927}, misc2 = {EMPIR 2015: Health}, publisher = {American Society for Biochemistry \& Molecular Biology (ASBMB)}, language = {30}, ISSN = {0021-9258, 1083-351X}, DOI = {10.1074/jbc.M116.765149}, stag_bib_extends_levelofaccess = {NA}, author = {De Franceschi, G. and Fecchio, C. and Sharon, R. and Schapira, A.H.V. and Proukakis, C. and Bellotti, V. and de Laureto, P.P.} } @Article { PalafoxBH2017, title = {A Josephson Impedance Bridge Based on Programmable Josephson Voltage Standards}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {2}, day = {16}, volume = {66}, number = {6}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {1539 - 1545}, keywords = {mpedance, Josephson array, programmable Josephson system, Bridge circuits, Impedance, Uncertainty, Transient analysis, Standards, Measurement uncertainty, Frequency measurement}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane Piscataway NJ 08855-1331}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2659898}, stag_bib_extends_levelofaccess = {NA}, author = {Palafox, L. and Behr, R. and Hagen, T.} } @Article { VilloingMGB2017, subid = {92}, title = {Internal dosimetry with the Monte Carlo code GATE: validation using the ICRP/ICRU female reference computational model}, journal = {Physics in Medicine and Biology}, year = {2017}, month = {2}, volume = {62}, number = {5}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {1885-1904}, keywords = {Monte Carlo modelling, internal dosimetry, GATE, MCNPX, voxelized models}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/62/5/1885}, stag_bib_extends_levelofaccess = {NA}, author = {Villoing, D and Marcatili, S and Garcia, M-P and Bardi{\`e}s, M} } @Article { StagniRPNNMMLFBBAACZC2017, subid = {134}, title = {A VLBI experiment using a remote atomic clock via a coherent fibre link}, journal = {Scientific Reports}, year = {2017}, month = {2}, volume = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {40992}, keywords = {VLBI experiment, remote atomic clock}, web_url = {https://www.nature.com/articles/srep40992}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep40992}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Ambrosini, R. and Artz, T. and Bertarini, A. and Bortolotti, C. and Frittelli, M. and Levi, F. and Mura, A. and Maccaferri, G. and Nanni, M. and Negusini, M. and Perini, F. and Roma, M. and Stagni, M. and Zucco, M. and Calonico, D.} } @Article { PavsiDBFVJSeHRKMAAM2017, subid = {2144}, title = {Inter-laboratory assessment of different digital PCR platforms for quantification of human cytomegalovirus DNA}, journal = {Analytical and Bioanalytical Chemistry}, year = {2017}, month = {1}, day = {26}, volume = {409}, number = {10}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {2601-2614}, keywords = {Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-017-0206-0}, stag_bib_extends_levelofaccess = {NA}, author = {Pavšič, J. and Devonshire, A. and Blejec, A. and Foy, C.A. and Van Heuverswyn, F. and Jones, G.M. and Schimmel, H. and Zel, J. and Huggett, J.F. and Redshaw, N. and Karczmarczyk, M. and Mozioglu, E. and Aky{\"u}rek, S. and Akg{\"o}z, M. and Milavec, M.} } @Article { FinlaysonGUBd2017, title = {An improved non-contact thermometer and hygrometer with rapid response}, journal = {Metrologia}, year = {2017}, month = {1}, day = {25}, volume = {54}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {S9-S15}, keywords = {temperature, humidity, non-contact, rapid response, thermometer, hygrometer, TDLAS}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa54c6}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa54c6}, stag_bib_extends_levelofaccess = {NA}, author = {Finlayson, A and Gardiner, T and Underwood, R and Bell, S and De Podesta, M} } @Article { deClercqGBFMCTY2017, title = {High-Performance Coherent Population Trapping Clock with Polarization Modulation}, journal = {Physical Review Applied}, year = {2017}, month = {1}, day = {25}, volume = {7}, number = {1}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, keywords = {Frequency standards, atomic clock, ramsey fringes, dark-line, vapor, laser spectroscopy}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.7.014018}, stag_bib_extends_levelofaccess = {NA}, author = {de Clercq, E. and Gu{\'e}randel, S. and Boudot, R. and Fran\c{c}ois, B. and Micalizio, S. and Calosso, C.E. and Tricot, F. and Yun, P.} } @Article { DucourtieuxCBAFF2017, title = {Modelling of the X,Y,Z positioning errors and uncertainty evaluation for the LNE's mAFM using the Monte Carlo method}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {23}, volume = {28}, number = {3}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {034007}, keywords = {atomic force microscope, metrology, virtual instrument, measurement uncertainty, Monte Carlo method, Morris design, Sobol indices}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, address = {Temple Circus, Temple, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/28/3/034007}, stag_bib_extends_levelofaccess = {NA}, author = {Ducourtieux, Sebastien and Ceria, Paul and Boukellal, Younes and Allard, Alexandre and Fischer, Nicolas and Feltin, Nicolas} } @Article { MillesSSEGBNL2017, title = {Comparing AFM cantilever stiffness measured using the thermal vibration and the improved thermal vibration methods with that of an SI traceable method based on MEMS}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {23}, volume = {28}, number = {3}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {034010}, keywords = {cantilever stiffness calibration, active reference spring, micro-electro-mechanical system}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034010/pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/28/3/034010}, stag_bib_extends_levelofaccess = {NA}, author = {Milles, L.F. and Stahl, S.W. and Sulzbach, T. and Engl, W. and Gao, S. and Brand, U. and Nesterov, V. and Li, Z.} } @Article { CalonicoLCCMBRTP2017, subid = {111}, title = {Absolute frequency measurement of the 1S0 – 3P0 transition of 171Yb}, journal = {Metrologia}, year = {2017}, month = {1}, day = {20}, volume = {54}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {102-112}, keywords = {optical lattice clock, SI second, frequency metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa4e62}, stag_bib_extends_levelofaccess = {NA}, author = {Pizzocaro, M and Thoumany, P and Rauf, B and Bregolin, F and Milani, G and Clivati, C and Costanzo, G.A. and Levi, F and Calonico, D} } @Article { NovikovaKGBWLRBMNL2017, title = {CASTOR, a new instrument for combined XRR-GIXRF analysis at SOLEIL}, journal = {X-Ray Spectrometry}, year = {2017}, month = {1}, day = {13}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, keywords = {x-ray}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Wiley-Blackwell}, address = {111 River Street Hoboken, NJ 07030, USA}, language = {30}, ISSN = {0049-8246}, DOI = {10.1002/xrs.2742}, stag_bib_extends_levelofaccess = {NA}, author = {Novikova, A. and Kanngie{\ss}er, B. and Gr{\"o}tzsch, D. and Beckhoff, B. and Weser, J. and Lubeck, J. and Rotella, H. and Boyer, B. and M{\'e}nesguen, Y. and Nolot, E. and L{\'e}py, M.-C.} } @Article { MihailescuBKC2017, subid = {497}, title = {Key comparison BIPM.RI(I)-K1 of the air-kerma standards of the SCK·CEN, Belgium and the BIPM in 60Co gamma radiation}, journal = {Metrologia}, year = {2017}, month = {1}, volume = {54}, number = {1A}, number2 = {14RPT04: Absorb: Absorbed dose in water and air}, pages = {06004-06004}, keywords = {cavity chamber, air kerma reference, comparison}, misc2 = {EMPIR 2014: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/54/1a/06004}, stag_bib_extends_levelofaccess = {NA}, author = {Kessler, C and Burns, D and Mihailescu, L C and Chiriotti, S} } @Article { BecherLSGCSPHLRK2017_2, title = {Experimental realization of an absolute single-photon source based on a single nitrogen vacancy center in a nanodiamond}, journal = {Optica}, year = {2017}, month = {1}, volume = {4}, number = {1}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {71}, keywords = {Metrology, Radiometry, Sources, Photon statistics}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.4.000071}, stag_bib_extends_levelofaccess = {NA}, author = {Becher, C. and Lindner, S. and Sandoghdar, V. and G{\"o}tzinger, S. and Chu, X.L. and Smid, M. and Porrovecchio, G. and Hofer, H. and L{\'o}pez, M. and Rodiek, B. and K{\"u}ck, S.} } @Article { BuermannR2017, subid = {1320}, title = {Dynamic determination of equivalent CT source models for personalized dosimetry}, journal = {Current Directions in Biomedical Engineering}, year = {2017}, month = {1}, volume = {3}, number = {2}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, keywords = {dosimetry, personalised medicine, CT source models}, misc2 = {EMPIR 2015: Health}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2364-5504}, DOI = {10.1515/cdbme-2017-0167}, stag_bib_extends_levelofaccess = {NA}, author = {Rosendahl, S. and B{\"u}ermann, L.} } @Inbook { , title = {Total Ozone Data Retrieval from the Phaethon DOAS System}, year = {2017}, volume = {2}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {989-994/141}, keywords = {total ozone, DOAS, Phaethon, Langley}, web_url = {http://link.springer.com/chapter/10.1007\%2F978-3-319-35095-0_141}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer International Publishing}, address = {Switzerland}, booktitle = {Perspectives on Atmospheric Sciences}, language = {30}, ISBN = {978-3-319-35094-3}, DOI = {10.1007/978-3-319-35095-0_141}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-12-31}, author = {Gkertsi, F. and Bais, A.F. and Drosoglou, Th. and Fragkos, K. and Fountoulakis, I. and Kouremeti, N.} } @Proceedings { WeidingerBJK2017, subid = {243}, title = {Torque measurement uncertainty in multi-MW nacelle test benches = Messunsicherheit des Drehmomentes in multi-MW Windenergieanlagen Pr{\"u}fst{\"a}nden}, journal = {3rd Conference for Wind Power Drives}, year = {2017}, volume = {1}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, pages = {1-14}, keywords = {nacelle test bench, FEM simulation, measurement uncertainty}, misc2 = {EMPIR 2014: Industry}, publisher = {Books on Demand}, address = {Norderstedt}, event_place = {Aachen, Germany}, event_name = {3rd Conference for Wind Power Drives , Aachen , Germany}, event_date = {07-03-2017 to 08-03-2017}, language = {30}, ISBN = {978-3-7431-3456-0}, DOI = {10.18154/RWTH-2017-02946}, stag_bib_extends_levelofaccess = {NA}, author = {Kock, S. and Jacobs, G. and Bosse, D. and Weidinger, P.} } @Proceedings { ZschiedrichGWHBB2017, subid = {423}, title = {Quantifying parameter uncertainties in optical scatterometry using Bayesian inversion}, journal = {Proc. SPIE}, year = {2017}, volume = {10330}, number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1033004}, keywords = {computational metrology, optical metrology, computational lithography, nanolithography, finite-element methods, nanooptics}, web_url = {https://arxiv.org/pdf/1707.08467}, misc2 = {EMPIR 2014: Industry}, event_place = {Munich}, event_name = {Modeling Aspects in Optical Metrology VI}, event_date = {25-06-2017 to 29-06-2017}, language = {30}, DOI = {10.1117/12.2270596}, stag_bib_extends_levelofaccess = {NA}, author = {Hammerschmidt, M and Weiser, M and Garcia Santiago, X and Zschiedrich, L and Bodermann, B and Burger, S} } @Proceedings { VenceljPGB2017, title = {MetroERM - Metrology for Radiological Early Warning Networks in Europe}, journal = {Proceedings of the eleventh symposium of the Croatian radiation protection association}, year = {2017}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {175-181}, keywords = {MetroERM, dose rate equivalent rate, radioactivity concentrations in air and ground}, misc2 = {EMRP A169: Call 2013 Environment II}, event_place = {Osijek, Croatia}, event_name = {11th Symposium Of The Croatian Radiation Protection Association}, event_date = {05-04-2017 to 07-04-2017}, language = {30}, ISSN = {1849 - 5060}, stag_bib_extends_levelofaccess = {NA}, author = {Vencelj, M. and Petrovič, T. and Glavič - Cindro, D. and Brodnik, D.} } @Article { PlimmerOHB2017, subid = {809}, title = {A high-accuracy working standard for absolute pressure from 5 kPa to 130 kPa}, journal = {International Journal of Metrology and Quality Engineering}, year = {2017}, volume = {8}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {26}, keywords = {absolute pressure, calibration, working standard, capacitance diaphragm gauge, resonantsilicon gauge}, misc2 = {EMPIR 2014: Industry}, publisher = {EDP Sciences}, language = {30}, ISSN = {2107-6847}, DOI = {10.1051/ijmqe/2017020}, stag_bib_extends_levelofaccess = {NA}, author = {Boineau, F. and Huret, S. and Otal, P. and Plimmer, M.} } @Article { BuismanTGF2017_2, subid = {813}, title = {Vector-corrected nonlinear multi-port IQ-mixer characterization using modulated signals}, journal = {IEEE}, year = {2017}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Microwave measurement, Nonlinear distortion, Mixers, Frequency-domain analysis, Time-domain analysis}, web_url = {https://research.chalmers.se/publication/248288/file/248288_Fulltext.pdf}, misc2 = {EMPIR 2014: Industry}, language = {30}, DOI = {10.1109/MWSYM.2017.8058888}, stag_bib_extends_levelofaccess = {NA}, author = {Gustafsson, S. and Thorsell, M. and Buisman, K. and Fager, C.} } @Article { CoppolaCGMBGOS2017, subid = {931}, title = {Measurement of macro-scale indentation modulus using the primary hardness standard machines at INRIM}, journal = {IMEKO}, year = {2017}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, keywords = {Hardness, indentation modulus, macro-scale.}, misc2 = {EMPIR 2014: Industry}, publisher = {Imeko}, address = {.}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc5-2017/IMEKO-TC5-2017-001.pdf}, author = {Coppola, G. and Cagliefo, R. and Genta, G. and Maizza, G. and Barbato, G. and Germak, A. and Origlia, C. and Schiavi, A.} } @Article { BojkovskiOKMSISFZSSJoHHPV2017, subid = {1095}, title = {Expansion of European research capabilities in humidity measurement}, journal = {18th International Congress of Metrology}, year = {2017}, number = {2017 18th}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {4/06006}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html}, misc2 = {EMPIR 2015: Research Potential}, publisher = {EDP Sciences}, language = {30}, DOI = {10.1051/metrology/201706006}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Sestan, D. and Zvizdić, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Article { NeumaierKBD2016, title = {Characterization of detector-systems based on CeBr3, LaBr3, SrI2 and CdZnTe for the use as dosemeters}, journal = {Radiation Physics and Chemistry}, year = {2016}, month = {12}, day = {31}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, keywords = {Environmental monitoring, Scintillation detectors, Monte-Carlo simulations}, misc2 = {EMRP A169: Call 2013 Environment II}, language = {30}, DOI = {10.1016/j.radphyschem.2016.12.015}, stag_bib_extends_levelofaccess = {NA}, author = {Neumaier, S. and Kessler, P. and Behnke, B. and Dombrowski, H.} } @Article { MaringerWKSB2016, title = {Study of particular problems appearing in NORM samples and recommendations for best practice gamma-ray spectrometry}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {12}, day = {28}, volume = {126}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {285-288}, keywords = {Gamma-ray spectrometry; NORM; Spectral interference; Radon tightness}, web_url = {https://www.sciencedirect.com/science/article/pii/S0969804316304961}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2016.12.035}, stag_bib_extends_levelofaccess = {NA}, author = {Maringer, F.J. and Wiedner, H. and Kabrt, F. and Stietka, M. and Baumgartner, A.} } @Article { GersterSSPGBWULHSP2016, subid = {11}, title = {Robustness of single-electron pumps at sub-ppm current accuracy level}, journal = {Metrologia}, year = {2016}, month = {12}, day = {20}, volume = {54}, number = {1}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {S1-S8}, keywords = {single-electron pumps, small-current measurement,}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/54/1/S1}, stag_bib_extends_levelofaccess = {NA}, author = {Stein, F and Scherer, H and Gerster, T and Behr, R and G{\"o}tz, M and Pesel, E and Leicht, C and Ubbelohde, N and Weimann, T and Pierz, K and Schumacher, H W and Hohls, F} } @Article { LepratDBSP2016, subid = {66}, title = {Practical Quantum Realization of the Ampere from the Elementary Charge}, journal = {Physical Review X}, year = {2016}, month = {12}, day = {12}, volume = {6}, number = {4}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {041051}, keywords = {Quantum current source, realization of the ampere, programmable Josephson voltage standard, quantum Hall resistance standard, cryogenic current comparator, SI}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {New York, USA}, language = {30}, ISSN = {2160-3308}, DOI = {10.1103/PhysRevX.6.041051}, stag_bib_extends_levelofaccess = {NA}, author = {Brun-Picard, J. and Djordjevic, S. and Leprat, D. and Schopfer, F. and Poirier, W.} } @Article { , title = {Transient photocurrent and photovoltage mapping for characterisation of defects in organic photovoltaics}, journal = {Solar Energy Materials and Solar Cells}, year = {2016}, month = {12}, day = {2}, volume = {161}, number = {November 2016}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {89-95}, keywords = {Printed solar cells, Organic photovoltaics, Defects, Transient photovoltage, Transient photocurrent, Characterisation}, web_url = {http://www.sciencedirect.com/science/article/pii/S0927024816304974}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0927-0248}, DOI = {10.1016/j.solmat.2016.11.029}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wood, S and O’Connor, D and Jones, C W and Claverley, J D and Blakesley, J C and Giusca, C and Castro, F A} } @Article { VandervorstDPFLTHVBTFCS2016, subid = {158}, title = {Understanding Physico-Chemical Aspects in the Depth Profiling of Polymer:Fullerene Layers}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {12}, volume = {120}, number = {49}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {28074-28082}, keywords = {ToF-SIMS, GCIB, Ar cluster, quantification, depth profiling, organics, solar cells, polymer, fullerenes}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b09911}, stag_bib_extends_levelofaccess = {NA}, author = {Surana, S. and Conard, T. and Fleischmann, C. and Tait, J.G. and Bastos, J.P. and Voroshazi, E. and Havelund, R. and Turbiez, M. and Louette, P. and Felten, A. and Poleunis, C. and Delcorte, A. and Vandervorst, W.} } @Article { GenoveseBYTDM2016, subid = {233}, title = {Quantifying backflash radiation to prevent zero-error attacks in quantum key distribution}, journal = {Light: Science \& Applications}, year = {2016}, month = {12}, volume = {6}, number = {6}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {e16261}, keywords = {Backflash, Quantum Key Distribution, Single-photon avalanche diode, Zero-error attack}, web_url = {http://www.nature.com/lsa/journal/v6/n6/full/lsa2016261a.html}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/lsa.2016.261}, stag_bib_extends_levelofaccess = {NA}, author = {Meda, A. and Degiovanni, I.P. and Tosi, A. and Yuan, Z. and Brida, G. and Genovese, M.} } @Article { HenaultBRPDBFBH2016, title = {Development of facilities and methods for the metrological characterization of distributed temperature sensing systems based on optical fibres}, journal = {Measurement Science and Technology}, year = {2016}, month = {12}, volume = {28}, number = {1}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {015009}, keywords = {Distributed sensing, Temperature, Metrology, Raman}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/1/015009}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/28/1/015009}, stag_bib_extends_levelofaccess = {NA}, author = {H{\'e}nault, J M and Beck, Y L and Razouk, R and Plumeri, S and Delepine-Lesoille, S and Beaumont, O and Failleau, G and Bertrand, J and Hay, B} } @Article { BrownZQ2016, title = {Temperature dependence of Hg vapour mass concentration at saturation in air: New SI traceable results between 15 and 30\(^{\circ}\)C}, journal = {TrAC Trends in Analytical Chemistry}, year = {2016}, month = {12}, volume = {85}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {81-88}, keywords = {Hg vapour mass concentrationIsotope dilution mass spectrometryTemperature dependent evolutionSI traceable resultsMeasurement procedure validationCombined uncertainty estimationISO/IEC 17025Internationally recommended reference datasets}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0165-9936}, DOI = {10.1016/j.trac.2015.12.010}, stag_bib_extends_levelofaccess = {NA}, author = {Brown, R.J.C. and Zampella, M. and Qu{\'e}tel, C.R.} } @Article { RietveldZOBCL2016, title = {Traceable measurements of the electrical parameters of solid-state lighting products}, journal = {Metrologia}, year = {2016}, month = {11}, day = {21}, volume = {53}, number = {6}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {1384-1394}, keywords = {uncertainty analysis, electrical measurement, solid-state lighting}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/6/1384}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, G and Zhao, D and Overney, F and Braun, J-P and Christensen, A and Lippert, T} } @Proceedings { , title = {New radiometric calibration site located at Gobabeb, Namib desert.}, journal = {Geoscience and Remote Sensing Symposium (IGARSS)}, year = {2016}, month = {11}, day = {3}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {6094 - 6097}, keywords = {vicarious calibration, RadCalNet, site characterisation, HDRF}, web_url = {http://ieeexplore.ieee.org/abstract/document/7730592/?reload=true}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Electrical and Electronics Engineers International}, event_place = {Beijing, China.}, event_name = {Geoscience and Remote Sensing Symposium (IGARSS)}, event_date = {10th-15th July 2016}, language = {30}, ISSN = {2153-7003}, DOI = {10.1109/IGARSS.2016.7730592}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/abstract/document/7730592/?reload=true}, author = {Bialek, AB and Greenwell, CG and Lamare, ML and Meygret, AM and Marcq, SM and Lacherade, SL and Woolliams, EW and Berthelot, BB and Bouvet, MB and King, MK and Underwood, CU and Fox, NF} } @Article { GorenBTZSMPRFAF2016, title = {Towards tributyltin quantification in natural water at the Environmental Quality Standard level required by the Water Framework Directive}, journal = {Talanta}, year = {2016}, month = {11}, volume = {160}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {499-511}, keywords = {ICP-MS, Isotope Dilution, Limit of quantification, Metrological traceability, Tributyltin, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0039-9140}, DOI = {10.1016/j.talanta.2016.07.056}, stag_bib_extends_levelofaccess = {NA}, author = {Goren, A.C. and B{\'i}lsel, M. and Tun\c{c}, M. and Zuliani, T. and Sčančar, J. and Milačič, R. and Philipp, R. and Richter, J. and Fettig, I. and Alasonati, E. and Fisicaro, P.} } @Article { YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016, subid = {321}, title = {Versailles Project on Advanced Materials and Standards Interlaboratory Study on Measuring the Thickness and Chemistry of Nanoparticle Coatings Using XPS and LEIS}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {10}, day = {27}, volume = {120}, number = {42}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {24070-24079}, keywords = {VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory}, web_url = {https://spiral.imperial.ac.uk/handle/10044/1/40824}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b06713}, stag_bib_extends_levelofaccess = {NA}, author = {Belsey, N.A. and Cant, D. and Cant, D.J.H. and Minelli, C. and Araujo, J.R. and Bock, B. and Br{\"u}ner, P. and Castner, D.G. and Ceccone, G. and Counsell, J.D.P. and Dietrich, P.M. and Engelhard, M.H. and Fearn, S. and Galhardo, C.E. and Kalbe, H. and Kim, J.W. and Lartundo-Rojas, L. and Luftman, H.S. and Nunney, T.S. and Pseiner, J. and Smith, E.F. and Spampinato, V. and Sturm, J.M. and Thomas, A.G. and Treacy, J.P.W. and Veith, L. and Wagstaffe, M. and Wang, H. and Wang, M. and Wang, Y.C. and Werner, W. and Yang, L.} } @Article { VilllaLCDBGLAPTZG2016, subid = {231}, title = {Measuring Incompatible Observables by Exploiting Sequential Weak Values}, journal = {Physical Review Letters}, year = {2016}, month = {10}, day = {20}, volume = {117}, number = {17}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {170402}, keywords = {Weak Measurements, Optical tests of quantum theory, Weak Values}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.170402}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.117.170402}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Levi, M. P. and Gramegna, M. and Brida, G. and Degiovanni, I. P. and Cohen, E. and Lussana, R. and Villa, F. and Tosi, A. and Zappa, F. and Genovese, M.} } @Article { YoshidaWDKLSGIHTGMB2016, title = {Reassessment of the NH4NO3thermal decomposition technique for calibration of the N2O isotopic composition}, journal = {Rapid Communications in Mass Spectrometry}, year = {2016}, month = {10}, day = {20}, volume = {30}, number = {23}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2487-2496}, keywords = {thermal decomposition, isotopic composition}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0951-4198}, DOI = {10.1002/rcm.7736}, stag_bib_extends_levelofaccess = {NA}, author = {Yoshida, N. and Werner, R.A. and Decock, C. and Kuhn, T. and Lehmann, M.F. and Schleppi, P. and Geilmann, H. and Ibraim, E. and Harris, E. and Toyoda, S. and Gutjahr, W. and Mohn, J. and Brand, W.A.} } @Article { BillasSGBSFS2016, subid = {91}, title = {Development of a primary standard for absorbed dose from unsealed radionuclide solutions}, journal = {Metrologia}, year = {2016}, month = {10}, day = {19}, volume = {53}, number = {6}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {1259-1271}, keywords = {dosimetry, radionuclide solution, extrapolation chamber, primary standard,validation of dose calculation}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/6/1259}, stag_bib_extends_levelofaccess = {NA}, author = {Billas, I and Shipley, D and Galer, S and Bass, G and Sander, T and Fenwick, A and Smyth, V.} } @Article { BrabanCEFBLPHTPMPVWvTNP2016, title = {A metrological approach to improve accuracy and reliability of ammonia measurements in ambient air}, journal = {Measurement Science and Technology}, year = {2016}, month = {10}, volume = {27}, number = {11}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {115012}, keywords = {ammonia in ambient air, traceability, reference gas standards, optical transfer standard, validation and testing infrastructure}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, address = {Bristol, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/27/11/115012}, stag_bib_extends_levelofaccess = {NA}, author = {Braban, Christine F and Cassidy, Nathan and Ebert, Volker and Ferracci, Valerio and Balslev-Harder, David and Leuenberger, Daiana and Pascale, C{\'e}line and Hieta, Tuomas and Tiebe, Carlo and Peltola, Jari and Martin, Nicholas A and Persijn, Stefan and Vaittinen, Olavi and Wirtz, Klaus and van Wijk, Janneke and Twigg, Marsailidh M and Niederhauser, Bernhard and Pog{\'a}ny, Andrea} } @Article { ReganCBABS2016, title = {A comparison of emerging gamma detector technologies for airborne radiation monitoring}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {10}, volume = {763}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {012010}, keywords = {gamma detector, airborne radiation monitoring, radiation monitoring}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/763/1/012010}, stag_bib_extends_levelofaccess = {NA}, author = {Regan, P H and Collins, S M and Beeke, S and Aitken-Smith, P and Bell, S J and Shearman, R} } @Article { BecherCLB2016, title = {Highly efficient heralded single-photon source for telecom wavelengths based on a PPLN waveguide}, journal = {Optics Express}, year = {2016}, month = {10}, volume = {24}, number = {21}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {23992}, keywords = {Nonlinear wave mixing, Photon statistics}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.24.023992}, stag_bib_extends_levelofaccess = {NA}, author = {Becher, C. and Chunnilall, C. and Lenhard, A. and Bock, M.} } @Article { DeLeoCVSMTFB2016, subid = {161}, title = {4-Nitrobenzene Grafted in Porous Silicon: Application to Optical Lithography}, journal = {Nanoscale Research Letters}, year = {2016}, month = {9}, day = {29}, volume = {11}, number = {436}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {1-10}, keywords = {Porous silicon, Optical lithography, 4-Nitrobenzenediazonium, grafting, Improved chemical resistance}, web_url = {https://nanoscalereslett.springeropen.com/articles/10.1186/s11671-016-1654-8}, misc2 = {EMPIR 2014: Industry}, publisher = {SpringerOpen}, address = {London}, language = {30}, ISSN = {1556-276X}, DOI = {10.1186/s11671-016-1654-8}, stag_bib_extends_levelofaccess = {NA}, author = {Tiddia, M.V. and Mula, G. and Sechi, E. and Vacca, A. and Cara, E. and De Leo, N. and Fretto, M. and Boarino, L.} } @Article { RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016, title = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, journal = {Atmospheric Chemistry and Physics}, year = {2016}, month = {9}, day = {23}, volume = {16}, number = {18}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {11915-11935}, keywords = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7324}, DOI = {10.5194/acp-16-11915-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Ramachandran, R. and Fu, X. and Zhang, H. and Feng, X.B. and Wip, D. and Obolkin, V. and Mashyanov, N. and Sena, F. and Gawlik, B.M. and Neves, L.M. and Read, K.A. and Kotnik, J. and Horvat, M. and Skov, H. and Magand, O. and Angot, H. and Dommergue, A. and Garcia, P.E. and Di{\'e}guez, M.D.C and Barbante, C. and Cairns, W. and Brito, J. and Barbosa, H.D.M.J and Morais, F. and Artaxo, P. and W{\"a}ngberg, I. and Munthe, J. and Martin, L. and Labuschagne, C. and Brunke, E.G. and Weigelt, A. and Ebinghaus, R. and Landis, M. and Mannarino, V. and Cinnirella, S. and Carbone, F. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Cossa, D. and Knoery, J. and Marusczak, Nicolas and Nerentorp, M. and Fisicaro, P.} } @Article { , title = {Comb mode filtering silver mirror cavity for spectroscopic distance measurement}, journal = {Review of Scientific Instruments}, year = {2016}, month = {9}, day = {19}, volume = {87}, number = {2016}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {093107}, keywords = {Mirrors, frequency combs, silver, Fabry-Perot interfermoters, piezoelectric transducers}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/87/9/10.1063/1.4962681}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, DOI = {10.1063/1.4962681}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Šm{\'i}d, R. and H{\"a}nsel, A. and Pravdova, L. and Cip, O. and Bhattacharya, N.} } @Article { LegreKKJGCBMMS2016, subid = {751}, title = {Creation of backdoors in quantum communications via laser damage}, journal = {Physical Review A}, year = {2016}, month = {9}, day = {15}, volume = {94}, number = {3}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {030302(R)}, keywords = {Quantum Cryptography, Quantum Communication}, web_url = {https://link.aps.org/accepted/10.1103/PhysRevA.94.030302}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.94.030302}, stag_bib_extends_levelofaccess = {NA}, author = {Makarov, V. and Bourgoin, J.P. and Chaiwongkhot, P. and Gagn{\'e}, M. and Jennewein, T. and Kaiser, S. and Kashyap, R. and Legr{\'e}, M. and Minshull, C. and Sajeed, S.} } @Article { , title = {Color characterization of coatings with diffraction pigments}, journal = {Journal of the Optical Society of America A}, year = {2016}, month = {9}, day = {14}, volume = {33}, number = {10}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1978-1988}, keywords = {BSDF, BRDF, BTDF, Diffraction, Radiometry, Scattering measurements.}, web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-33-10-1978}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {OSA}, address = {Washington, DC, USA}, language = {30}, ISSN = {1084-7529 (print), 1520-8532 (online)}, DOI = {10.1364/JOSAA.33.001978}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, A and Bernad, B and Campos, J and Perales, E and Vel{\'a}zquez, J L and Mart{\'i}nez-Verd{\'u}, F M} } @Article { BennettBHWRBBRC2016, title = {Double differential cross sections for proton induced electron emission from molecular analogues of DNA constituents for energies in the Bragg peak region}, journal = {The Journal of Chemical Physics}, year = {2016}, month = {9}, day = {14}, volume = {145}, number = {10}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {104301}, keywords = {DNA, cross sections, proton impact, tetrahydrofuran, pyrimidine, trimethylphosphate, Bragg peak}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Publishing}, address = {2 Huntington Quadrangle, Ste 1 No 1 Suite 300, Melville 11747-4502 ,United States}, language = {30}, ISSN = {0021-9606, 1089-7690}, DOI = {10.1063/1.4962171}, stag_bib_extends_levelofaccess = {NA}, author = {Bennett, Daniel and Bug, Marion U. and Hilgers, Gerhard and Wang, Mingjie and Rudek, Benedikt and Baek, Woon Yong and Buhr, Ticia and Rabus, Hans and Champion, Christophe} } @Proceedings { , title = {Impact of Surface Curvature on Spectral BRDF of Effect Coatings}, journal = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance}, year = {2016}, month = {9}, day = {7}, volume = {N/A}, number = {N/A}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {295-302}, keywords = {BRDF, effect coatings, colour}, web_url = {http://div2.cie.co.at/?i_ca_id=985}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {CIE}, address = {Vienna, Austria}, event_place = {Prague}, event_name = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance}, event_date = {09-06-2016 to 09-07-2016}, language = {30}, ISBN = {978-3-902842-59-6}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {CIE x043:2016}, author = {Ferrero, A and Bernad, B and Campos, J and Perales, E and Mart{\'i}nez-Verd{\'u}, F M and Smid, M and Porrovecchio, G and Strothk{\"a}mper, C} } @Proceedings { , title = {Multi-Angle Colour Characterization of Coatings with Diffraction Pigments}, journal = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance}, year = {2016}, month = {9}, day = {7}, volume = {N/A}, number = {N/A}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {51-59}, keywords = {BRDF, gonio-spectrophotometry, effect coatings, diffraction}, web_url = {http://div2.cie.co.at/?i_ca_id=985}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {CIE}, address = {Vienna, Austria}, event_place = {Prague}, event_name = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance}, event_date = {09-06-2016 to 09-07-2016}, language = {30}, ISBN = {978-3-902842-59-6}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {CIE x043:2016}, author = {Ferrero, A and Bernad, B and Campos, J and Perales, E and Mart{\'i}nez-Verd{\'u}, F M} } @Proceedings { IrvineBR2016, title = {Real-time compression of IEC 61869-9 sampled value data}, journal = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2016}, month = {9}, volume = {1}, number = {1}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1-6}, keywords = {Communications, IEC 61850-9-2, IEC 61869-9, merging units, phasor measurement units, power system protection, time synchronization}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA}, event_place = {E.ON Energy Research Centre, RWTH Aachen University, Aachen, Germany}, event_name = {IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {28-09-2016 to 30-09-2016}, language = {30}, ISBN = {978-1-5090-2373-8}, ISSN = {978-1-5090-2374-5}, DOI = {10.1109/AMPS.2016.7602854}, stag_bib_extends_levelofaccess = {NA}, author = {Irvine, James and Blair, Steven M. and Roscoe, Andrew J.} } @Proceedings { BlairR2016, title = {Choice and properties of adaptive and tunable digital boxcar (moving average) filters for power systems and other signal processing applications}, journal = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2016}, month = {9}, volume = {1}, number = {1}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1-6}, keywords = {Adaptive filters, Array signal processing, Finite impulse response filters, Power system measurements, Fourier transforms, Frequency measurement, Phase estimation, Power system state estimation, Power system parameter estimation}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA}, event_place = {E.ON Energy Research Centre, RWTH Aachen University, Aachen, Germany}, event_name = {IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {28-09-2016 to 30-09-2016}, language = {30}, ISBN = {978-1-5090-2373-8}, ISSN = {978-1-5090-2374-5}, DOI = {10.1109/AMPS.2016.7602853}, stag_bib_extends_levelofaccess = {NA}, author = {Blair, Steven M. and Roscoe, Andrew J.} } @Article { , title = {Investigations on the suitability of an electroacoustic sound source as a secondary sound power standard}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {29}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, tonal components, secondary source, electroacoustics I-INCE Classification of Subjects Numbers: 10, 72.4}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bietz, H. and Wittstock, V. and Brezas, S.} } @Article { , title = {Automatic sound field sampling mechanisms to disseminate the unit watt in airborne sound}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, traceability; Calibration; Free-field over a reflecting plane (hemi-anechoic rooms)I-INCE Classification of Subjects Number(s): 72.4, 71.9 and 73.2}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Cellard, P. and Andersson, H. and Brezas, S. and Wittstock, V.} } @Article { , title = {Dissemination of the unit watt in airborne sound: aerodynamic reference sound sources as transfer standards}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, dissemination, directivity, correction, substitution I-INCE Classification of Subjects Number(s): 72.4}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Brezas, S. and Cellard, P. and Andersson, H. and Guglielmone, C. and Kirbas, C.} } @Article { , title = {Primary sound power sources for the realisation of the unit watt in airborne sound}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound Power, Primary Sound Power Source, Rayleigh’s Integral}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kirbas, C. and Andersson, H. and Guglielmone, C. and Bilgi\c{c}, E.} } @Article { QuinonesANSBM2016, title = {The Influence of Radon (Gas and Progeny) and Weather Conditions on Ambient Dose Equivalent Rate}, journal = {Radiation Protection Dosimetry}, year = {2016}, month = {8}, day = {13}, volume = {174}, number = {3}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {1-8}, keywords = {radon, radon progeny, ambient dose equivalent rate, dosimetry}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncw219}, stag_bib_extends_levelofaccess = {NA}, author = {Qui{\~n}ones, J. and Alvarez, A. and Navarro, N. and Saez, J. C. and Benito, G. and M{\'a}rquez, J. L.} } @Proceedings { , title = {Convenient Graphene-Based Quantum Hall Resistance Standards}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Graphene, materials science and technology, measurement standards, metrology, quantum Hall effect devices}, web_url = {http://ieeexplore.ieee.org/document/7540650/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540650}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Brun-Pcard, J. and Ribeiro-Palau, R. and Lafont, F. and Kazazis, D. and Michon, A. and Cheynis, F. and Couturaud, O. and Consejo, C. and Jouault, B. and Poirier, W. and Schopfer, F.} } @Proceedings { , title = {Comparison between time- and frequency-domain high-frequency device characterizations}, journal = {CPEM 2016, Conference on Precision Electromagnetic Measurements: conference digest: (2016)}, year = {2016}, month = {8}, day = {11}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {high-frequency devices, vector network analyzer, electro-optic sampling}, web_url = {http://dx.doi.org/10.1109/CPEM.2016.7540727}, web_url2 = {https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016, Conference on Precision Electromagnetic Measurements}, event_date = {10-15 July 2016}, language = {30}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540727}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E}, author = {Bieler, M. and Arz, U.} } @Proceedings { , title = {Stable arbitrary waveform generator as a transfer standard for ADC calibration}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016), Conference Digest}, year = {2016}, month = {8}, day = {11}, volume = {CPEM 2016 Conference Digest}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {ac voltage measurement, signal synthesis, digital-to-analog converter, analog-to-digital converter, comparison, sampling, ac-dc transfer.}, web_url = {http://ieeexplore.ieee.org/document/7540454/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York, USA}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {July 10-15, 2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540454}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Nissila, J. and Lee, J. and Sira, M. and {\"O}zt{\"u}rk, T. and Arifovic, M. and Diaz de Aguilar, J. and Lapuh, R. and Behr, R.} } @Article { , title = {Detector-device-independent QKD: security analysis and fast implementation}, journal = {Journal of Applied Physics}, year = {2016}, month = {8}, day = {9}, volume = {120}, number = {6}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {063101}, note = {Copyright was too long instead of that we will ise the link. (see copyright statment below) Subject to the rights herein granted to AIP Publishing, each Copyright Owner retains ownership of copyright and all other proprietary rights such as patent rights in the Work. Each Copyright Owner retains the following nonexclusive rights to use the Work, without obtaining permission from AIP Publishing, in keeping with professional publication ethics, and provided clear credit is given to its first publication in an AIP Publishing journal. Any reuse must include a full credit line acknowledging AIP Publishing’s publication and a link to the VOR on AIP Publishing’s site. Each Copyright Owner may: 1. Reprint portions of the Work (excerpts, figures, tables) in future works created by the Author, in keeping with professional publication ethics. 2. Post the Accepted Manuscript (AM) to their personal web page or their employer’s web page immediately after acceptance by AIP Publishing. 3. Deposit the AM in an institutional or funder-designated repository immediately after acceptance by AIP Publishing. 4. Use the AM for posting within scientific collaboration networks (SCNs). For a detailed description of our policy on posting to SCNs, please see our Web Posting Guidelines (https://publishing.aip.org/authors/web-posting-guidelines). 5. Reprint the Version of Record (VOR) in print collections written by the Author, or in the Author’s thesis or dissertation. It is understood and agreed that the thesis or dissertation may be made available electronically on the university’s site or in its repository and that copies may be offered for sale on demand. 6. Reproduce copies of the VOR for courses taught by the Author or offered at the institution where the Author is employed, provided no fee is charged for access to the Work. 7. Use the VOR for internal training and noncommercial business purposes by the Author’s employer. 8. Use the VOR in oral presentations made by the Author, such as at conferences, meetings, seminars, etc., provided those receiving copies are informed that they may not further copy or distribute the Work. 9. Distribute the VOR to colleagues for noncommercial scholarly use, provided those receiving copies are informed that they may not further copy or distribute the Work. 10. Post the VOR to their personal web page or their employer’s web page 12 months after publication by AIP Publishing. 11. Deposit the VOR in an institutional or funder-designated repository 12 months after publication by AIP Publishing. 12. Update a prior posting with the VOR on a noncommercial server such as arXiv, 12 months after publication by AIP Publishing.}, keywords = {Quantum cryptography, Polarization, Qubits, Photons, Modulators}, web_url = {https://arxiv.org/pdf/1607.05435.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {0021-8979}, DOI = {10.1063/1.4960093}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-8-10}, author = {Boaron, Alberto and Korzh, Boris and Houlmann, Raphael and Boso, Gianluca and Lim, Charles Ci Wen and Martin, Anthony and Zbinden, Hugo} } @Article { , title = {Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites}, journal = {International Journal of Remote Sensing}, year = {2016}, month = {8}, day = {9}, volume = {37}, number = {19}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {4665-4682}, keywords = {Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites}, web_url = {http://www.tandfonline.com/doi/full/10.1080/01431161.2016.1220030}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Taylor and Francis}, address = {Abingdon}, language = {30}, ISSN = {1366-5901}, DOI = {10.1080/01431161.2016.1220030}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gorrono, JG and Bialek, AB and Green, PDG and Harris, PH and Scanlon, TS and Fox, NPF and Underwood, CU} } @Article { , title = {The calibration of a prototype occluded ear simulator designed for neonatal hearing assessment applications}, journal = {AIP Citation}, year = {2016}, month = {8}, day = {5}, volume = {140 (2016)}, number = {2}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {806–813}, keywords = {occluded ear simulator, prototype, neonatal hearing assessment applications, Microphones, Ears, Calibration, Acoustic impedance measurement, Sound pressure}, web_url = {http://scitation.aip.org/content/asa/journal/jasa/140/2/10.1121/1.4960517}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {The Journal of the Acoustical Society of America}, address = {Melville, NY}, language = {30}, DOI = {10.1121/1.4960517}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barham, R. and Olsen, E.S. and Rodrigues, D. and Barrera-Figueroa, S. and Sadikoğlu, E. and Karab{\"o}ce, B.} } @Article { , title = {SI traceable determination of the spring constant of a soft cantilever using a nanonewton force facility based on electrostatic methods}, journal = {Metrologia}, year = {2016}, month = {8}, day = {1}, volume = {53 (2016)}, number = {4}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {1031-1044}, keywords = {Nanonewton force facility Spring constant Soft cantilever Contact potential SI-traceable determination}, web_url = {http://www.ingentaconnect.com/content/iop/met/2016/00000053/00000004/art01031}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing Ltd.}, address = {Bristol}, language = {30}, ISSN = {0026-1394 (print) ; 1681-7575 (online)}, DOI = {10.1088/0026-1394/53/4/1031}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Nesterov, V. and Belai, O. and Nies, D. and Buetefisch, S. and Muelelr, M. and Ahbe, T. and Neparty, D. and Popadic, R. and Wolff, H.} } @Article { , title = {Protection Against Common Mode Currents on Cables Exposed to HIRF or NEMP}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2016}, month = {8}, volume = {Submitted and accepted for publication in a future issue of this journal}, number = {Not known yet}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-9}, keywords = {Electromagnetic compatibility, electromagnetic coupling, electromagnetic fields, marine electrical equipment}, web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=16}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {not known yet}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {van Leersum, B.J.A.M. and van der Ven, C.C.J. and Bergsma, J.G. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Characterization of a Multi-Element Clinical HIFU System Using Acoustic Holography and Nonlinear Modeling}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2016}, month = {8}, volume = {60}, number = {8}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1683-98}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Institute of Electrical and Electronics Engineers}, language = {30}, ISSN = {0885–3010}, DOI = {10.1109/TUFFC.2013.2750}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Krieder, w and Yuldashev, P and Sapoznikov, OA and Farr, N and Partinen, A and Bailey, MR and Khokhlova, VA} } @Article { SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016, subid = {135}, title = {A clock network for geodesy and fundamental science}, journal = {Nature Communications}, year = {2016}, month = {8}, volume = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {12443}, keywords = {Clock network; geodesy;}, web_url = {https://www.nature.com/articles/ncomms12443}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms12443}, stag_bib_extends_levelofaccess = {NA}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and Doerscher, S. and Haefner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G. and Amy-Klein, A. and Le Targat, R. and Lodewyck, J. and Lopez, O and Pottie, P.-E.} } @Article { SvecSSRPNMLKJGFFDMAHBTTVW2016_2, title = {60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {8}, volume = {114}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {167-172}, keywords = {Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.05.014}, stag_bib_extends_levelofaccess = {NA}, author = {Svec, A. and Solc, J. and Silva, L. and Reis, M. and Peyres, V. and Nečemer, M. and Moser, H. and Luca, A. and Klemola, S. and Javornik, A. and Garc{\'i}a-Tora{\~n}o, E. and Ferreux, L.. and Fazio, A. and Dry{\'a}k, P. and Marroyo, B.C. and Arnold, D. and Hult, M. and Burda, O. and Tzika, F. and Tyminski, Z. and Vodenik, B. and W{\"a}tjen, U.} } @Article { ShortisRKMB2016_2, title = {Optimised multi-camera systems for dimensional control in factory environments}, journal = {Proceedings of the Institution of Mechanical Engineers, Part B: Journal of Engineering Manufacture}, year = {2016}, month = {8}, volume = {232}, number = {10}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {1707-1718}, keywords = {Industrial photogrammetry, camera calibration, refraction correction, manufacturing, part assembly}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SAGE Publications}, language = {30}, ISSN = {0954-4054, 2041-2975}, DOI = {10.1177/0954405416654936}, stag_bib_extends_levelofaccess = {NA}, author = {Shortis, M. and Robson, S. and Kyle, S. and MacDonald, L. and Boehm, J.} } @Article { , title = {Experimental determination of the oxygen K-shell fluorescence yield using thin SiO2 and Al2O3 foils}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2016}, month = {7}, day = {28}, volume = {124}, number = {1 Oct 2016}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {94-98}, keywords = {fundamental parameter, fluorescence yield, oxygen, XRS}, web_url = {http://www.sciencedirect.com/science/article/pii/S0584854716301732}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier B.V.}, address = {Amsterdam}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2016.08.024}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}nicke, P. and Kolbe, M. and Krumrey, M. and Unterumsberger, R. and Beckhoff, B.} } @Article { , title = {Conception of a mobile climate simulation chamber for the investigation of the influences of harsh shop floor conditions on in-process measurement systems in machine tools}, journal = {Measurement}, year = {2016}, month = {7}, day = {26}, volume = {74}, number = {October 2015}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {233-237}, keywords = {Traceable in-process measurement Machine tools Climate simulation Computational fluid dynamics}, web_url = {http://www.journals.elsevier.com/measurement}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2015.07.010}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S0263224115003450}, author = {Berger, Dietrich and Brabandt, Daniel and Lanza, Gisela} } @Article { WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016, title = {Five-year records of Total Mercury Deposition flux at GMOS sites in the Northern and Southern Hemispheres}, journal = {Atmospheric Chemistry and Physics Discussions}, year = {2016}, month = {7}, day = {20}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {1-33}, keywords = {mercury, wet deposition flux,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7375}, DOI = {10.5194/acp-2016-517}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}ngberg, I. and Walters, C. and Vard{\`e}, M. and Spandow, P. and Somerset, V. and Sena, F. and Islas, M.R. and Obolkin, V. and Munthe, J. and Mkololo, T. and Mashyanov, N. and Martin, L. and Magand, O. and Labuschagne, C. and Kotnik, J. and Horvat, M. and Hansson, K. and Hagestr{\"o}m, U. and Gawlik, B. and Garcia, P.E. and Fu, X. and Feng, X.B. and Ebinghaus, R. and Dommergue, A. and Di{\'e}guez, M.D.C. and Comero, S. and Cairns, W. and Arcega-Cabrera, F. and Brunke, E.G. and Barbante, C. and Angot, H. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Weigelt, A. and Yang, X. and Fisicaro, P.} } @Proceedings { , title = {Josephson-Based Characterization of Analog-to-Digital Converters Using an Equivalent Time Sampling Method}, journal = {Proceedings CPEM 2016}, year = {2016}, month = {7}, day = {18}, volume = {54}, number = {12}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Analog to Digital Converter, Josephson Voltage Standards, Sampling, Waveform}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=4126881}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Unknown}, address = {Unknown}, event_place = {Ottawa}, event_name = {Conference on Precision Elexctromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {0018-9456}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2007.891162}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Blaise Jeanneret, Blaise Jeanneret and Fr´ed´eric Overney, Fr´ed´eric Overney and Christophe Scherly, Christophe Scherly and G´erald Schaller, G´erald Schaller} } @Proceedings { , title = {Receiver Algorithm for Decoding Constellation Modulation}, journal = {Advanced Photonics 2016 SPPCom}, year = {2016}, month = {7}, day = {18}, number = {2016}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {SpTu1F.3}, keywords = {Coherent communications Fiber optics communications Modulation}, web_url = {https://www.osapublishing.org/abstract.cfm?uri=SPPCom-2016-SpTu1F.3}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Optical Society of America}, address = {Washington, D.C.}, event_place = {Vancouver, Canada}, event_name = {Advanced Photonics}, event_date = {18-07-2016}, language = {30}, ISBN = {978-1-943580-14-9}, ISSN = {N/A}, DOI = {10.1364/SPPCOM.2016.SpTu1F.3}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dash, S. S. and Pythoud, F and B, B and Josten, A and Leuchtmann, P and Hillerkuss, D and Leuthold, J} } @Proceedings { BeckhoffPMHK2016, title = {Fundamental parameter determination to improve spectroscopical methods}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, month = {7}, day = {10}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, keywords = {X-ray fluorescence, atomic fundamental parameters, fluorescence yields, optical constants, spectroscopy}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Ottawa}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, DOI = {10.1109/CPEM.2016.7540520}, stag_bib_extends_levelofaccess = {NA}, author = {Beckhoff, B. and Pollakowski, B. and Muller, M. and Honicke, P. and Kolbe, M.} } @Article { , title = {Optical to microwave clock frequency ratios with a nearly continuous strontium optical lattice clock}, journal = {Metrologia}, year = {2016}, month = {7}, day = {8}, volume = {53}, number = {4}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {1123}, keywords = {atomic clocks, high precision spectrocopy, frequency ratios, optical lattice clocks}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1123/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1123}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lodewyck, J and Bilicki, S and Bookjans, E and Robyr, J-L and Shi, C and Vallet, G and Le Targat, R and Nicolodi, D and Le Coq, Y and Gu{\'e}na, J and Abgrall, M and Rosenbusch, P and Bize, S} } @Proceedings { , title = {Characterization and Optimization of Ultrasonic Tests for Inspection of Fiber-Reinforced Plastic Composites in Energy Related Applications, 19th World Conference on Non-Destructive Testing 13-17 June 2016, Munich}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Energy Generation}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-8}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we4d5.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hosseini, SH and Segur, DS and Boehm, RB and Gohlke, DG and Heckel, TH and Riemer, SR and Brackrock, DB and Gaal, MG} } @Proceedings { , title = {Characterisation of Artificial and Natural Defects in Fibre Reinforced Plastics Designed for Energy Applications Using Active Thermography}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Composite Materials}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-9}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we2i4.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Maierhofer, CM and Krankenhagen, RK and R{\"o}llig, MR and Riemer, SR and Gower, MG and Baker, GB and Lodeiro, ML and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Adibekyan, AA and Gutschwager, BG} } @Proceedings { , title = {Design and manufacture of reference and natural defect artefacts for the evaluation of NDE techniques for fibre reinforced plastic (FRP) composites in energy applications}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Composite Materials}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-10}, keywords = {Infrared Testing (IRT), Ultrasonic Testing (UT), Visual and Optical Testing (VT/OT), Other Methods, delamination, validation, carbon fiber reinforced plastic (CFRP), Glass Fiber Reinforced Plastic (GFRP), tensile load, flat bottom hole}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we1e4.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gower, MG and Lodeiro, ML and Aktas, AA and Shaw, RS and Maierhofer, CM and Krankenhagen, RK and Augustin, SA and R{\"o}llig, MR and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Judaschke, RJ and Segur, DS} } @Article { vandenBromRWCB2016, title = {Smart grid power quality and stability measurements in Europe}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, keywords = {instrument transformers, smart grids, metrology, phasor measurement units, synchrophasors, power quality,impedance measurement}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, DOI = {10.1109/CPEM.2016.7540462}, stag_bib_extends_levelofaccess = {NA}, author = {van den Brom, H. E. and Rietveld, G. and Wright, P. S. and Crotti, G. and Braun, J. P.} } @Article { KielerMNBO2016, title = {Packaging of fiber-coupled module for Josephson junction array voltage standards}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, keywords = {Optical fibers, Photodiodes, Silicon, Cryogenics, Bonding, Stress, Flip-chip devices}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, DOI = {10.1109/CPEM.2016.7540561}, stag_bib_extends_levelofaccess = {NA}, author = {Kieler, O. and Malmbekk, H. and Tuan Nguyen, T.A. and Bardalen, E. and Ohlckers, P.} } @Article { PottieALB2016, subid = {133}, title = {Ultrastable optical frequency dissemination on a multi-access fibre network}, journal = {Applied Physics B}, year = {2016}, month = {6}, day = {25}, volume = {122}, number = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, web_url = {https://link.springer.com/article/10.1007/s00340-016-6463-3}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-016-6463-3}, stag_bib_extends_levelofaccess = {NA}, author = {Bercy, A. and Lopez, O. and Pottie, P.E. and Amy-Klein, A.} } @Article { , title = {Consistency analysis of multidimensional gonio-spectrophotometric measurements in interlaboratory comparisons}, journal = {Metrologia}, year = {2016}, month = {6}, day = {14}, volume = {53}, number = {4}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1024-1030}, keywords = {BRDF, goniospectrophotometry, interlaboratory comparison}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1024/meta}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {Online ISSN: 1681-7575, Print ISSN: 0026-1394}, DOI = {10.1088/0026-1394/53/4/1024}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, A and Campos, J and Bernad, B and Pons, A and Hernanz, M L and Mart{\'i}nez-Verd{\'u}, F M and H{\"o}pe, A} } @Article { , title = {High-performance near- and mid-infrared crystalline coatings}, journal = {Optica}, year = {2016}, month = {6}, day = {13}, volume = {3}, number = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {647}, keywords = {(300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings; (310.1860) Deposition and fabrication; (140.4780) Optical resonators.}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington, D.C. 20036-1012 USA}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.3.000647}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {COLE, G D and ZHANG, W and BJORK, B J and FOLLMAN, D and HEU, P and DEUTSCH, C and SONDERHOUSE, L and ROBINSON, J and FRANZ, C and ALEXANDROVSKI, A and NOTCUTT, M and HECKL, O H and YE, J and ASPELMEYER, M} } @Article { DauresRODB2016, title = {Accuracy of a dose-area product compared to an absorbed dose to water at a point in a 2 cm diameter field}, journal = {Medical Physics}, year = {2016}, month = {6}, day = {10}, volume = {43}, number = {7}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {4085-4092}, keywords = {small fields, dose-area product, EBT3, dosimetric references}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4953207}, stag_bib_extends_levelofaccess = {NA}, author = {Daures, J. and Rapp, B. and Ostrowsky, A. and Dufreneix, S. and Bordy, J. M.} } @Article { , title = {Uncertainty propagation in computationally expensive models: A survey of sampling methods and application to scatterometry}, journal = {Measurement}, year = {2016}, month = {6}, day = {8}, volume = {in press, corrected proof}, number = {in press, corrected proof}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {smart sampling, statistical inverse problem, scatterometry}, tags = {MAT}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116302901}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {-}, DOI = {10.1016/j.measurement.2016.06.009}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Heidenreich, S and Gross, H and B{\"a}r, M and Wright, L} } @Article { , title = {Atomic fountains and optical clocks at SYRTE: Status and perspectives}, journal = {Comptes Rendus Physique}, year = {2016}, month = {6}, day = {1}, volume = {16}, number = {5}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {461 - 470}, keywords = {Atomic fountain clocks, Optical lattice clocks, Optical frequency combs, Stability of natural constants, Timekeeping}, web_url = {http://www.sciencedirect.com/science/article/pii/S1631070515000614}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {n/a}, DOI = {10.1016/j.crhy.2015.03.010}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-6-1}, author = {Abgrall, M and Chupin, B and De Sarlo, L and Guena, J and Laurent, P and Le Coq, Y and Le Targat, R and Lodewyck, J and Lours, M and Rosenbuch, P and Rovera, G. D. and Bize, S} } @Proceedings { , title = {Assessing fringe projector volumetric error sources}, journal = {Proceedings of the 16th international conference of the european society for precision engineering and nanotechnology}, year = {2016}, month = {5}, day = {30}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, keywords = {3D optical scanner, characterisation, verification, tetrahedron}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Euspen}, address = {Cranfield}, event_place = {Nottingham}, event_name = {16th international conference of the european society for precision engineering and nanotechnology}, event_date = {30-05-2016 to 05-06-2016}, language = {30}, ISBN = {978-0-9566790-8-6}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dury, M R and Brown, S B and McCarthy, M B and Woodward, S D} } @Proceedings { , title = {Maximizing the Benefit of Existing Equipment for Nonlinear and Communication Measurements}, journal = {N/A}, year = {2016}, month = {5}, day = {27}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Nonlinear measurements, oscilloscope, sampling, analogue to digital conversion}, web_url = {http://www.arftg.org/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {San Francisco, CA, USA}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30}, stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART}, author = {Humphreys, D. A. and Raffo, A. and Bosi, G. and Vannini, G. and Schreurs, D. and Gebremicael, K. N. and Morris, K.} } @Proceedings { , title = {Impact of Microwave Measurement Uncertainty on the Nonlinear Embedding Procedure}, journal = {N/A}, year = {2016}, month = {5}, day = {27}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Microwave measurements uncertainty, microwave transistors, nonlinear embedding, power amplifiers, vector-calibrated nonlinear measurements.}, web_url = {http://www.arftg.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {San Francisco, CA, USA}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30}, stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART}, author = {Bosi, G. and Raffo, A. and Avolio, G. and Schreurs, D. and Humphreys, D. A.} } @Article { , title = {Aperture alignment in autocollimator-based deflectometric profilometers}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2016}, month = {5}, day = {24}, volume = {87}, number = {051906 (2016)}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-9}, keywords = {Apertures, Calibration Charge coupled devices, Ray tracing, Optical aberrations}, web_url = {http://aip.scitation.org/doi/10.1063/1.4950734}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Institute of Physics}, address = {Melville, NY 11747-4300 USA}, language = {30}, ISSN = {Print: 0034-6748, Online: 1089-7623}, DOI = {10.1063/1.4950734}, extern = {1}, stag_bib_extends_fe_group = {55,59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Geckeler, R. D. and Artemiev, N. A. and Barber, S. K. and Just, A and Lacey, I. and Kranz, O and Smith, B. V. and Yaschckuk, V. V.} } @Article { WangBRdBBRBH2016, title = {Cross sections for ionization of tetrahydrofuran by protons at energies between 300 and 3000 keV}, journal = {Physical Review A}, year = {2016}, month = {5}, day = {20}, volume = {93}, number = {5}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {DNA cross sections, proton impact, tetrahydrofuran, Bragg peak}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {1 Research Road,Ridge, NY 11961-2701, (631) 591-4000, United States}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.93.052711}, stag_bib_extends_levelofaccess = {NA}, author = {Wang, Mingjie and Bennett, Daniel and Rudek, Benedikt and de Vera, Pablo and Bug, Marion and Buhr, Ticia and Rabus, Hans and Baek, Woon Yong and Hilgers, Gerhard} } @Article { , title = {Nonequilibrium thermodynamics of the spin Seebeck and spin Peltier effects}, journal = {Physical Review B}, year = {2016}, month = {5}, day = {18}, volume = {93}, number = {184421}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {184421-1-11}, keywords = {spincaloritronics, Spin-Seebeck, Spin-Peltier}, web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.93.184421}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {2469-9969 (online), 2469-9950 (print)}, DOI = {10.1103/PhysRevB.93.184421}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Basso, V. and Ferraro, E. and Magni, A. and Sola, A. and Kuepferling, M. and Pasquale, M.} } @Proceedings { , title = {Characterization of high-frequency interconnects: Comparison between time- and frequency-domain methods}, journal = {2016 IEEE 20th Workshop on Signal and Power Integrity (SPI) Conference Proceedings}, year = {2016}, month = {5}, day = {12}, volume = {N/A}, number = {N/A}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1-4}, keywords = {coplanar waveguides, frequency-domain analysis, microwave measurement, time-domain analysis}, web_url = {http://dx.doi.org/10.1109/SaPIW.2016.7496271}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Torino, Italy}, event_name = {2016 IEEE 20th Workshop on Signal and Power Integrity}, event_date = {08-05-2016 to 11-05-2016}, language = {30}, ISBN = {978-1-5090-0349-5}, DOI = {10.7795/EMPIR.14IND02.CA.20190403D}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bieler, M. and Arz, U.} } @Article { ZappaTVLLAPGBDG2016, subid = {232}, title = {Experiment Investigating the Connection between Weak Values and Contextuality}, journal = {Physical Review Letters}, year = {2016}, month = {5}, volume = {116}, number = {18}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {180401}, keywords = {Quantum Foundations, Quantum Nonlocality, Weak Values, Weak Measurements}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.116.180401}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Levi, M. P. and Lussana, R. and Villa, F. and Tosi, A. and Zappa, F. and Gramegna, M. and Brida, G. and Degiovanni, I. P. and Genovese, M.} } @Article { ProfrockGBBNGEPGSG2016, title = {Potential reference measurement procedures for PBDE in surface water at levels required by the EU Water Frame Directive}, journal = {Talanta}, year = {2016}, month = {5}, volume = {152}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {251-258}, keywords = {IDMS, Method Validation, PBDE, Water, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0039-9140}, DOI = {10.1016/j.talanta.2016.01.066}, stag_bib_extends_levelofaccess = {NA}, author = {Pr{\"o}frock, D. and Gonz{\'a}lez-Gago, A. and Binici, B. and B{\'i}lsel, M. and Nousiainen, M. and Goenaga-Infante, H. and Entwisle, J. and Petrov, P. and Gantois, F. and Swart, C. and Goren, A.C.} } @Proceedings { , title = {High-accuracy absolute distance measurement with a mode-resolved optical frequency comb}, journal = {Proceedings of SPIE}, year = {2016}, month = {4}, day = {29}, volume = {9899}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {989906}, keywords = {Distance measurement, frequency combs, homodyne detection, intererometry}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {SPIE}, address = {Bellingham}, event_place = {Brussels, Belgium}, event_name = {SPIE Photonics Europe 2016, Optical Sensing and Detection IV}, event_date = {04-04-2016 to 07-04-2016}, language = {30}, ISSN = {1996-756X}, DOI = {10.1117/12.2227360}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Voigt, D. and van den Berg, S.A. and Lešund{\'a}k, A. and van Eldik, S. and Bhattacharya, N.} } @Article { , title = {Towards joint reconstruction of noise and losses in quantum channels}, journal = {Quantum Measurements and Quantum Metrology}, year = {2016}, month = {4}, day = {21}, volume = {3}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {27–31}, keywords = {Quantum Communication, Quantum Metrology, Calibration}, web_url = {https://www.degruyter.com/view/j/qmetro}, misc2 = {EMPIR 2014: Industry}, publisher = {DE GRUYTER OPEN}, address = {Warsaw (Poland)}, language = {30}, ISSN = {2299-114X}, DOI = {10.1515/qmetro-2016-0005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.degruyter.com/downloadpdf/j/qmetro.2016.3.issue-1/qmetro-2016-0005/qmetro-2016-0005.pdf}, author = {Piacentini, F. and Avella, A. and Traina, P. and Lolli, L. and Taralli, E. and Monticone, E. and Rajteri, M. and Fukuda, D. and Degiovanni, I. P. and Brida, G.} } @Article { DesogusMGPB2016, title = {Design and metrological evaluation of the new 5 MN hexapod-shaped multicomponent build-up system}, journal = {Metrologia}, year = {2016}, month = {4}, day = {15}, volume = {53}, number = {3}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {956-964}, keywords = {hexapod, load simulation, build-up system, force transducer, uncertainty budget}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/3/956}, stag_bib_extends_levelofaccess = {NA}, author = {Desogus, S. and Mazzoleni, F. and Germak, A. and Palumbo, S. and Barbato, G.} } @Article { , title = {Absolute calibration of an EMCCD camera by quantum correlation, linking photon counting to the analog regime}, journal = {Optics Letters}, year = {2016}, month = {4}, day = {14}, volume = {41}, number = {8}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1841-1844}, keywords = {CCD, charge-coupled device; Quantum detectors; Calibration.}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-8-1841}, misc2 = {EMPIR 2014: Industry}, publisher = {OSA Publishing}, address = {Washington, D.C. 20036-1012 USA}, language = {30}, ISSN = {0146-9592/16/081841-04}, DOI = {10.1364/OL.41.001841}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-14}, author = {Avella, A. and Ruo-Berchera, I. and Degiovanni, I. P. and Brida, G. and Genovese, M.} } @Article { , title = {Inertial quantum sensors using light and matter}, journal = {Physica Scripta}, year = {2016}, month = {4}, day = {13}, volume = {91}, number = {5}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {053006}, keywords = {quantum sensors, atom interferometry, cold atoms}, web_url = {http://iopscience.iop.org/article/10.1088/0031-8949/91/5/053006/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0031-8949}, DOI = {10.1088/0031-8949/91/5/053006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barrett, B and Bertoldi, A and Bouyer, P} } @Article { , title = {Diffusion-induced grain boundary migration as mechanism for grain growth and defect annihilation in chalcopyrite thin films}, journal = {Acta Materialia}, year = {2016}, month = {4}, day = {10}, volume = {111}, number = {-}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {377-384}, keywords = {X-ray diffraction, Physical vapor deposition (PVD), Stacking faults, Grain boundary migration, CuInSe2}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier Ltd.}, address = {Amsterdam}, language = {30}, ISSN = {1359-6454}, DOI = {10.1016/j.actamat.2016.03.073}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Stange, H. and Brunken, S. and Greiner, D. and Heinemann, M. D. and Kaufmann, C. A. and Schmidt, S. S. and B{\"a}cker, J.-P. and Klaus, M. and Genzel, C. and Mainz, R.} } @Proceedings { , title = {JRP SIB60 “Metrology for Long Distance Surveying”-a concise survey on major project results}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {March 30-April 1, 2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pollinger, F. and Bauch, A. and Leute, J. and Meiners-Hagen, K. and Mildner, J. and Guillory, J. and Wallerand, J.-P. and Jokela, J. and Kallio, U. and Koivula, H. and Lahtinen, S. and Poutanen, M. and Astrua, M. and Francese, C. and Zucco, M. and Eusebio, L. and Marques, F. and Pires, C. and Saraiva, F. and Pelligrino, O. and Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M. and Kupko, V. and Neyezhmakov, P. and Bergstrand, S. and van den Berg, S.A. and Kersten, T. and Krawinkel, T.} } @Proceedings { , title = {SI-Traceable High-Accuracy EDM based on Multi-Wavelength Interferometry}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {Submission 15}, keywords = {EDM, multi-wavelength interferometry, index of refraction, EMRP JRP SIB60 Surveying}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {30-03-2016 to 01-04-2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf}, author = {Pollinger, F. and Mildner, J. and K{\"o}chert, P. and Yang, R. and Bosnjakovic, A. and Meyer, T. and Wedde, M. and Meiners-Hagen, K.} } @Article { , title = {Potential of GPS Common Clock Single-differences for Deformation Monitoring}, journal = {Journal of Applied Geodesy}, year = {2016}, month = {3}, day = {31}, volume = {10}, number = {1}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {pages 45.52}, keywords = {GPS; Monitoring; Clock Modeling; Common Clock; EMRP JRP SIB60}, web_url = {https://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/reviewed/JISDM_2016_submission_101.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {De Gruyter}, language = {30}, ISSN = {(Online) 1862-9024, (Print) 1862-9016}, DOI = {10.1515/jag-2015-0029}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Sch{\"o}n, S. and Pham, H.K. and Kersten, T. and Leute, J. and Bauch, A.} } @Article { , title = {Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150044}, keywords = {high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150044}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0044}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wooliams, E.R and Anhalt, K and Ballico, M and Bloembergen, P and Bourson, F and Briaudeau, S and Campos, J and Cox, M.G and del Campo, D and Dong, W and Dury, M.R and Gavrilov, V and Grigoryeva, I and Hernanz, M.L and Jahan, F and Khlevnoy, B and Khromchenko, V and Lowe, D.H and Lu, X and Machin, G and Mantilla, J.M and Martin, M.J and McEvoy, H.C and Rougie, B and Saldi, M and Salim, S.G.R and Sasajima, N and Taubert, D.R and Todd, A.D.W and Van den Bossche, R} } @Article { , title = {DABAM: an open-source database of x-ray mirrors metrology}, journal = {Journal of Synchrotron Radiation}, year = {2016}, month = {3}, day = {24}, volume = {23}, number = {23}, number2 = {SIB58: Angles: Angle metrology}, pages = {665-678}, keywords = {X-ray mirror; metrology; database; Python; statistics.}, web_url = {http://scripts.iucr.org/cgi-bin/paper?S1600577516005014}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IUCr Journals}, address = {Chester CH1 2HU, England}, language = {30}, ISSN = {1600-5775}, DOI = {10.1107/S1600577516005014}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sanchez del Rio, M and Bianchi, D and Cocco, D and Glass, M and Idir, M and Metz, J and Raimondi, L and Rebuffi, L and Reininger, R and Shi, X and Siewert, F and Spielmann-Jaeggi, S and Takacs, P and Tomasset, M and Tonnessen, T and Tonnessenivo, A and Yashchuk, VV} } @Proceedings { , title = {Approaching the Shannon Limit Through Constellation Modulation}, journal = {Optical Fiber Communication Conference}, year = {2016}, month = {3}, day = {20}, volume = {N/A}, number = {2016}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {Th2A.46}, keywords = {Coherent communications Fiber optics communications Modulation}, web_url = {https://www.osapublishing.org/abstract.cfm?uri=OFC-2016-Th2A.46}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Optical Society of America}, address = {Washington, D.C.}, event_place = {Anaheim, California}, event_name = {Optical Fiber Communication Conference}, event_date = {20-03-2016}, language = {30}, ISBN = {978-1-943580-07-1}, ISSN = {N/A}, DOI = {10.1364/OFC.2016.Th2A.46}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dash, S. S. and Pythoud, F and Baeuerle, B and Josten, A and Hillerkuss, D and Leuchtmann, P and Leuthold, J} } @Article { , title = {What are the correct L-subshell photoionization cross sections for quantitative X-ray spectroscopy?}, journal = {X-ray Spectrometry}, year = {2016}, month = {3}, day = {16}, volume = {45}, number = {4}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {207–211}, keywords = {photoionization cross sections, xrs, fundamental parameters}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/xrs.2691/full}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {John Wiley \& Sons, Ltd}, language = {30}, ISSN = {1097-4539}, DOI = {10.1002/xrs.2691}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}nicke, P and Kolbe, M and Beckhoff, B} } @Article { , title = {Preparation and characterisation of an 57Fe enriched haemoglobin spike material for speciesspecific isotope dilution mass spectrometry}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, month = {3}, day = {10}, volume = {31}, number = {9}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1846 - 1857}, keywords = {isotope dilution mass spectrometry (IDMS), MonoQ® ion exchange chromatography, size exclusion column (SEC),high-performance liquid chromatography (HPLC) system}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00028B\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {0267-9477 (print) ; 1364-5544 (online)}, DOI = {10.1039/c6ja00028b}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brauckmann, C. and Frank, C. and Schulze, D. and Kaiser, P. and Stosch, R. and Swart, C.} } @Article { PacynaHJDCBBBPHBGEPF2016, title = {Importance of Integration and Implementation of Emerging and Future Mercury Research into the Minamata Convention}, journal = {Environmental Science \& Technology}, year = {2016}, month = {3}, volume = {50}, number = {6}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {2767-2770}, keywords = {Mercury, Minamata Convention,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0013-936X, 1520-5851}, DOI = {10.1021/acs.est.6b00573}, stag_bib_extends_levelofaccess = {NA}, author = {Pacyna, J. and Horvat, M. and Jaffe, D. and Driscoll, C.T. and Chen, C. and Bustamante, P. and Blum, J. and Basu, N. and Pierce, A. and Hammerschmidt, C.R. and Bank, M.S. and Gustin, M.S. and Evers, D.C. and Pirrone, N. and Fisicaro, P.} } @Article { , title = {Detection of Rare Drug Resistance Mutations by Digital PCR in a Human Influenza A Virus Model System and Clinical Samples}, journal = {Journal Of Clinical Microbiology}, year = {2016}, month = {2}, day = {28}, volume = {54}, number = {2}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {392-400.}, keywords = {Digital PCR, dPCR, Droplet, Influenza, Antimicrobial Resistance, AMR, Rare, Mutation, Trace, qPCR, Quantitative PCR, SNP, Single Nucleotide Polymorphism, H275Y, Oseltamivir, Tamiflu}, web_url = {http://jcm.asm.org/content/54/2/392.long}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {American Society for Microbiology}, address = {Washington DC}, language = {30}, ISSN = {0095-1137}, DOI = {10.1128/JCM.02611-15}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Whale, A. S. and Bushell, C. and Grant, P.R. and Cowen, S. and Gutierrez-Aguirre, I. and O'Sullivan, D. M. and Zel, J. and Milavec, M. and Foy, C. A. and Nastouli, E. and Garson, J. A. and Huggett, H. F.} } @Article { , title = {Dissemination of thermodynamic temperature above the freezing point of silver}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {2}, day = {22}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150043}, keywords = {high-temperature fixed points, thermodynamic temperature, filter radiometer, radiation thermometer}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150043}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0043}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sadli, M and Machin, G and Anhalt, K and Bourson, F and Biraudeau, S and del Campo, D and Diril, A and Kozlova, O and Lowe, D.H and Mantilla Amor, J.M and Martin, M.J and McEvoy, H.C and Ojanen-Saloranta, M and Pehlivan, {\"O} and Rougi{\'e}, B and Salim, S.G.R} } @Article { , title = {Traceable quantitative Raman spectrometry and x-ray fluorescence analysis as non-destructive methods for spatially resolved chemical characterization of Cu(In,Ga)Se2 absorber films}, journal = {Applied Spectroscopy}, year = {2016}, month = {2}, volume = {70}, number = {2}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {279-288}, keywords = {Calibration, Cu(In; Ga)Se2, International System of Units, Measurement uncertainty, Raman mapping, Raman spectrometry, SI, Solar cell, Traceability, X-ray spectrometry}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/26903563}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {SAGE Publications }, language = {30}, ISSN = {0003-7028}, DOI = {10.1177/0003702815620131.}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-1}, author = {Zakel, SZ and Pollakowski, BP and Streeck, CS and Wundrack, SW and Weber, AW and Brunken, SB and Mainz, RM and Beckhoff, BB and Stosch, RS} } @Article { PoletaeffBPOKZA2016, title = {Improvement of LISN Measurement Accuracy Based on Calculable Adapters}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2016}, month = {2}, volume = {65}, number = {2}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {365-377}, keywords = {Improvement of LISN Measurement Accuracy Based on Calculable Adapters}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2479107}, stag_bib_extends_levelofaccess = {NA}, author = {Poletaeff, Andr{\'e} and B{\'e}li{\`e}res, Denis and Pinter, Borut and Ouameur, Mohamed and Kokalj, Miha and Ziade, Francois and Allal, Djamel} } @Article { MonteyneVPRFEBE2016, title = {Preparation and evaluation of sufficiently homogeneous and stable reference materials for priority hazardous substances in whole water}, journal = {Accreditation and Quality Assurance}, year = {2016}, month = {2}, volume = {21}, number = {2}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {113-120}, keywords = {Homogeneity, Stability, Uncertainty, Whole water, Reference materials, PAHs, PBDEs, TBT, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-1775, 1432-0517}, DOI = {10.1007/s00769-015-1189-1}, stag_bib_extends_levelofaccess = {NA}, author = {Monteyne, E. and Vanermen, G. and Philipp, R. and Richter, J. and Fettig, I. and Elordui-Zapatarietxe, S. and Boom, G. and Emteborg, H.} } @Article { , title = {A folded‑sandwich polarization‑entangled two‑color photon pair source with large tuning capability for applications in hybrid quantum systems}, journal = {Applied Physics B}, year = {2016}, month = {1}, day = {30}, volume = {122}, number = {February 2016}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {33}, keywords = {Entangled Photons Source, Quantum Hybrid Systems}, web_url = {https://link.springer.com/article/10.1007/s00340-015-6275-x}, web_url2 = {http://link.springer.com/journal/340}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer-Verlag}, address = {Berlin Heidelberg}, language = {30}, ISSN = {1432-0649}, DOI = {10.1007/s00340-015-6275-x}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dietz, O. and M{\"u}ller, C. and Krei{\ss}l, T. and Herzog, U. and Kroh, T. and Ahlrichs, A. and Benson, O.} } @Article { SawalNPGZRBTGSGACFEERBP2016, title = {An interlaboratory comparison on whole water samples}, journal = {Accreditation and Quality Assurance}, year = {2016}, month = {1}, day = {29}, volume = {21}, number = {2}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {121-129}, keywords = {Water Framework Directive, Interlaboratory comparison, Whole water sample, Suspended particulate matter, Polycyclic aromatic hydrocarbons, Polybrominated diphenyl ethers, Tributlyltin}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-1775, 1432-0517}, DOI = {10.1007/s00769-015-1190-8}, stag_bib_extends_levelofaccess = {NA}, author = {Sawal, G. and Nousiainen, M. and Pr{\"o}frock, D. and Gago, A.G. and Zuliani, T. and Rodr{\'i}guez-Cea, A. and Binici, B. and Tun\c{c}, M. and Gokcen, T. and Swart, C. and Gantois, F. and Alasonati, E. and Cabillic, J. and Fettig, I. and Emteborg, H. and Elordui-Zapatarietxe, S. and Richter, J. and Buzoianu, M. and Philipp, R.} } @Article { , title = {First measurements of nitrous oxide self-broadening and self-shift coefficients in the 0002-0000 band at 2.26 \(\mu\)m using high resolution Fourier transform spectroscopy}, journal = {Journal of Molecular Spectroscopy}, year = {2016}, month = {1}, day = {23}, volume = {323}, number = {Atmospheric Spectroscopy}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {28-42}, keywords = {Nitrous oxide, Fourier transform infrared spectroscopy, Line parameters; Self-broadening, Self-shift, Gas metrology}, web_url = {http://www.sciencedirect.com/science/article/pii/S002228521630011X}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier B. V.}, address = {Kidlington (Oxford)}, language = {30}, ISSN = {0022-2852}, DOI = {10.1016/j.jms.2016.01.010}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S002228521630011X}, author = {Werwein, Viktor and Brunzendorf, Jens and Serdyukov, Anton and Werhahn, Olav and Ebert, Volker} } @Proceedings { MonteBKALBGRRKMAG2016, title = {Characterisation of artificial defects in CFRP and GFRP sheets designed for energy applications using active thermography}, journal = {Proceedings of the 2016 International Conference on Quantitative InfraRed Thermography}, year = {2016}, month = {1}, day = {16}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, keywords = {Characterisation artificial defects CFRP and GFRP active thermography}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {QIRT Council}, address = {1065 ave. de la Medecine Quebec City Quebec G1V 0A6 Canada}, event_place = {Gdansk}, event_name = {QIRT 16}, event_date = {04-07-2016 to 08-07-2016}, language = {30}, DOI = {10.21611/qirt.2016.076}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Blahut, A. and Knazovicka, L. and Aktas, A. and Lodeiro, M. and Baker, G. and Gower, M. and Rehmer, B. and R{\"o}llig, M. and Krankenhagen, R. and Maierhofer, C. and Adibekyan, A. and Gutschwager, B.} } @Article { , title = {A fiber-coupled quantum-dot on a photonic tip}, journal = {APPLIED PHYSICS LETTERS}, year = {2016}, month = {1}, day = {8}, volume = {108}, number = {1}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {011112-5}, keywords = {quantum-dot, fiber-coupling}, web_url = {http://scitation.aip.org/content/aip/journal/apl}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publishing LLC}, address = {Melville, NY}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4939264}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Cadeddu, D. and Teissier, J. and Braakman, F. and Gregersen, N. and Stepanov, P. and G{\'e}rard, J.M. and Claudon, J. and Warburton, R. J. and Poggio, M. and Munsch, M.} } @Article { , title = {Alignment-free characterization of 2D gratings}, journal = {Applied Optics}, year = {2016}, month = {1}, day = {7}, volume = {55}, number = {2}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {317-322}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-2-317}, misc2 = {EMPIR 2014: Industry}, publisher = {OSA Publishing}, address = {Washington}, language = {30}, DOI = {10.1364/AO.55.000317}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-1-7}, stag_bib_extends_persistent_identifier = {https://arxiv.org/ftp/arxiv/papers/1509/1509.07623.pdf}, author = {Madsen, M.H and Boher, P and Hansen, P.E and J{\o}rgensen, J.F} } @Article { , title = {Electron beam controlled covalent attachment of small organic molecules to graphene}, journal = {Nanoscale}, year = {2016}, month = {1}, day = {4}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {2711-2719}, keywords = {graphene, polyaromatic molecules, measurement}, web_url = {http://pubs.rsc.org/en/content/articlehtml/2016/nr/c5nr07539d}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {The Royal Society of Chemistry}, language = {30}, DOI = {10.1039/C5NR07539D}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Markevich, A. and Kurasch, S. and Lehtinen, O. and Reimer, O. and Feng, X. and M{\"u}llen, K. and Turchanin, A. and Khlobystov, A. N. and Kaiser, U. and Besley, E.} } @Article { , title = {Calibrated detectors for broad-band terahertz power measurements}, journal = {Laser+PHOTONICS}, year = {2016}, month = {1}, day = {1}, volume = {11}, number = {Trade Journal (international issue of the German magazine PHOTONIK)}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {2}, keywords = {Terahertz, THz power, THz detector}, web_url = {http://www.photonik.de/calibrated-detectors-for-broad-band-terahertz-power-measurements/150/21404/320987}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AT-Fachverlag GmbH}, address = {Fellbach}, language = {30}, ISSN = {1865-6633}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bohmeyer, W. and Lange, K. and M{\"u}ller, R. and Steiger, A.} } @Proceedings { , title = {A mercury optical lattice clock at LNE-SYRTE}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {1}, day = {1}, volume = {723}, number = {n/a}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {012017}, keywords = {optical lattice clock}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012017/meta}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Bristol}, event_place = {Potsdam, Germany}, event_name = {8th Symposium on Frequency Standards and Metrology}, event_date = {12 - 16 October 2015}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1088/1742-6596/723/1/012017}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {De Sarlo, L and Favier, M and Tyumenev, R and Bize, S} } @Article { vanderVeenBA2016, title = {Suitability of different containers for the sampling and storage of biogas and biomethane for the determination of the trace-level impurities – A review}, journal = {Analytica Chimica Acta}, year = {2016}, month = {1}, volume = {902}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {22-32}, keywords = {Sampling; Containers; Suitability; Biogas; Biomethane; Impurities; VOCs; Siloxanes}, tags = {EnG}, web_url = {https://www.ncbi.nlm.nih.gov/pubmed/26703250}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York}, language = {30}, ISSN = {0003-2670}, DOI = {10.1016/j.aca.2015.10.039}, stag_bib_extends_levelofaccess = {NA}, author = {van der Veen, A.M.H. and Brown, A.S. and Arrhenius, K.} } @Article { DenoziereJPPPPGBR2016, title = {First international comparison of primary absorbed dose to water standards in the medium-energy X-ray range}, journal = {Metrologia}, year = {2016}, month = {1}, volume = {53}, number = {1A}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {06007-06007}, keywords = {absorbed dose to water, medium energy x ray, comparison}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/1A/06007}, stag_bib_extends_levelofaccess = {NA}, author = {Denoziere, M. and Jansen, B and Prez, L.d and Pooter, J.d. and Pinto, M. and Pimpinella, M. and Guerra, A.S. and B{\"u}ermann, L. and Rapp, B.} } @Techreport { TerauchiKSBWWADGAAHUWSJKKFSBSS2016, subid = {415}, title = {Final report of CCQM-K129 'Measurement of Mole Fractions of Cu, In, Ga and Se in Cu(In,Ga)Se2 Films}, journal = {Metrologia}, year = {2016}, month = {1}, volume = {53}, number = {1A}, number2 = {14SIP05: TF-STANDARD: Developing a Standard for Valid Methodology for the Characterisation of Functional Alloy Thin Films}, pages = {08011-08011}, keywords = {CIGS, Cu(In,Ga)Se2, mole fractions, key comparison CCQM-K129}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1A/08011\&\#10;https://www.bipm.org/utils/common/pdf/final_reports/QM/K129/CCQM-K129.pdf}, misc2 = {EMPIR 2014: Support for Impact}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/1A/08011}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, A.S. and Kim, K.J. and Jang, J.S. and Suh, J.K. and Wirth, T. and Unger, W. and Hodoroaba, V.D. and Araujo, J.R. and Archanjo, B.S. and Galhardo, C.E. and Damasceno, J. and Achete, C.A. and Wang, H. and Wang, M. and Bennett, J. and Simon, D. and Kurokawa, A. and Terauchi, S. and Fujimoto, T. and Streeck, C. and Beckhoff, B. and Spencer, S. and Shard, A.} } @Article { , title = {Quantum and Classical Characterization of Single/Few Photon Detectors}, journal = {Quantum Matter}, year = {2016}, volume = {4}, number = {3}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {1-13}, keywords = {Quantum Tomography, Quantum Information, Single Photon Detectors, POVM}, web_url = {http://www.aspbs.com/qm.html}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {2164-7615}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mingolla, M. G. and Piacentini, F. and Avella, A. and Gramegna, M. and Lolli, L. and Meda, A. and Ruo Berchera, I. and Taralli, E. and Traina, P. and Rajteri, M. and Brida, G. and Degiovanni, I. P. and Genovese, M.} } @Article { , title = {The minimum number of measurements for colour, sparkle, and graininess characterisation in gonio-apparent panels}, journal = {Coloration Technology}, year = {2016}, volume = {131}, number = {4}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {303-309}, keywords = {gonio-apparent colours, sparkle, graininess, measurements}, web_url = {http://onlinelibrary.wiley.com/doi/10.1111/cote.12157/citedby}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Society of Dyers and Colourists. John Wiley \& Sons}, address = {New York}, language = {30}, ISSN = {1478-4408}, DOI = {10.1111/cote.12157}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Chorro, E. and Perales, E. and Burgos, F.J. and G{\'o}mez, O. and Vilaseca, M. and Pujol, J. and Mart{\'i}nez-Verd{\'u}, F.M.} } @Article { , title = {New Avogadro spheres for the redefinition of the kilogram}, journal = {Key Engineering Materials}, year = {2016}, volume = {617}, number = {1}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {11-16}, keywords = {Measurement, SI unit, precision sphere, interferometry, manufacturing}, web_url = {http://www.scientific.net/KEM/}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Trans Tech Publications Inc.}, address = {CH-8808 Pfaffikon}, language = {30}, ISSN = {ISSN: 1662-9795}, DOI = {10.4028/www.scientific.net/KEM.613.17}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.scientific.net/KEM/details}, author = {Nicolaus, A. and Mee{\ss}, R. and Bartl, G.} } @Article { , title = {Time-Domain Optoelectronic Vector Network Analysis on Coplanar Waveguides}, journal = {IEEE Transactions on Microwave Theory and Techniques}, year = {2016}, volume = {63}, number = {11}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {3775-3784}, keywords = {Ultrashort voltage pulses, electro-optic sampling, vector network analysis, time-domain reflectometry}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, language = {30}, ISSN = {0018-9480}, DOI = {10.1109/TMTT.2015.2481426}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bieler, Mark and F{\"u}ser, Heiko and Pierz, Klaus} } @Proceedings { , title = {Measurement of goniofluorescence in photoluminiscent materials}, journal = {CIE Proceeding}, year = {2016}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, keywords = {Goniofluorescence, fluorescence, photoluminescence, spectrophotometry}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {International Comission on Illumination}, address = {Serrano 144}, event_place = {Manchester/UK}, event_name = {28th Session CIE}, event_date = {June 28 - July 4, 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, A and Bernad, B and Velazquez, J L and Pons, A and Hernanz, M L and Jaanson, P and Martinez-Verdu, F M and Chorro, E and Perales, E and Campos, J} } @Proceedings { , title = {MEASURING SPARKLE OF EFFECT COATINGS}, journal = {CIE Proceeding}, year = {2016}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, keywords = {Sparkle, Glint, Glitter, Effect coatings, Spectrophotometry, Texture}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {International Comission on Illumination}, address = {Serrano 144}, event_place = {Manchester/UK}, event_name = {28th Session CIE}, event_date = {June 28 - July 4, 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, A and Bayon, S and Ferrero, Alejandro} } @Article { , title = {Comparison of Two Potassium-Filled Gas-Controlled Heat Pipes}, journal = {International Journal of Thermophysics}, year = {2016}, volume = {36}, number = {12}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {3393}, keywords = {Gas-controlled heat pipe · Pressure control · Thermocouple calibration · Thermometer calibration}, web_url = {http://link.springer.com/article/10.1007\%2Fs10765-015-2002-4}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Torino}, language = {30}, ISSN = {0195-928X}, DOI = {10.1007/s10765-015-2002-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Bertiglia, F and Iacomini, L and Moro, F and Merlone, A} } @Proceedings { , title = {The calibration of static and dynamic performances of PMUs}, journal = {Proceedings of the International Congress of Metrology}, year = {2016}, volume = {17}, number = {n/a}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {n/a}, keywords = {Phasor measurement units,}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_12002.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {EDP Sciences}, address = {London}, event_place = {Paris}, event_name = {17th International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1051/metrology/201512002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Braun, J. P. and Siegenthaler, S} } @Article { , title = {Experimental assessment of the speed of light perturbation in free-fall absolute gravimeters}, journal = {Metrologia}, year = {2016}, volume = {52}, number = {Oct}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {635–645}, keywords = {speed of light perturbation, absolute gravimeters, gravimetry, watt balance, SI}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/635}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institute of Physics}, address = {Bristol (UK)}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/52/5/635}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Baumann, H and Pythoud, F and Blas, D and Sibiryakov, S and Eichenberger, A and Klingel{\'e}, E E} } @Article { , title = {Depth Profiling and Melting of Nanoparticles in Secondary Ion Mass Spectrometry (SIMS)}, journal = {J. Phys. Chem. C}, year = {2016}, volume = {117}, number = {31}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {16042-16052}, keywords = {cluster ion beams, core-shell, melting, SEM, St{\"o}ber silica, SiO2}, web_url = {http://pubs.acs.org/doi/abs/10.1021/jp4048538}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {American chemical society}, address = {Washington DC}, language = {30}, ISSN = {1932-7447}, DOI = {10.1021/jp4048538}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-7-13}, author = {Yang, L and Seah, M and Gilmore, I .S and Morris, R.J.H and Dowsett, M.G and Boarino, L and Sparnacci, K and Laus, M} } @Article { , title = {Modelling of interband transitions in GaAs tunnel diode}, journal = {Semiconductor Science and Technology}, year = {2016}, volume = {31}, number = {06LT01}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {1-5}, keywords = {tunnel junction, multi-junction solar cells, band-to-band tunneling, Flietner’s relation}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, address = {UK}, language = {30}, DOI = {10.1088/0268-1242/31/6/06LT01}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Louarn, KL and Fontain, CF and Arnoult, AA and Olivi{\'e}, FO and Lacoste, GL and Piquemal, FP and Bounouh, AB and Almuneau, GA} } @Article { , title = {METROLOGICALLY TRACEABLE DETERMINATION OF THE WATER CONTENT IN BIOPOLYMERS: INRIM ACTIVITY}, journal = {International Journal of Thermophysics}, year = {2016}, volume = {-}, number = {Special Issue Tempmeko 2016}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {-}, keywords = {Water content, metrological traceability, coulometric Karl Fischer titration, Evolved Water Vapour analysis, biopolymers}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer}, address = {Berlin}, language = {30}, ISSN = {ISSN: 0195-928X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rolle, F. and Beltramino, G. and Fernicola, V. and Sega, M. and Verdoja, A.} } @Article { , title = {Characterization of a series of absolute isotope reference materials for magnesium: ab initio calibration of the mass spectrometers, and determination of isotopic compositions and relative atomic weights}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, DOI = {10.1039/c6ja00013d}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogl, Jochen and Brandt, Bj¨orn and Noordmann, Janine and Rienitz, Olaf and Malinovskiy, Dmitriy} } @Proceedings { , title = {Study on the dissemination of unit Watt in airborne sound}, journal = {InterNoise 2015}, year = {2016}, volume = {44.}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, pages = {12}, web_url = {http://internoise2015.com/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {INTERNOISE}, address = {San Francisco}, event_place = {San Francisco}, event_name = {44th Inter-Noise Congress \& Exposition on Noise Control Engineering}, event_date = {9.-12. August 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brezas, S. and Wittstock, V.} } @Article { , title = {Qualifying label components for effective biosensing by advanced high-throughput SEIRA methodology}, journal = {Physical Chemistry Chemical Physics}, year = {2016}, volume = {17}, number = {14}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {9471-9}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-22-15-17948}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Royal Society of Chemistry}, address = {Piccadilly London}, language = {30}, ISSN = {1463-9076}, DOI = {10.1039/c4cp05944a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Hornemann, A and Eichert, D and Flemig, S and Ulm, G and Beckhoff, B} } @Article { , title = {Annihilation of structural defects in chalcogenide absorber films for high-efficiency solar cells}, journal = {Energy \& Environmental Science}, year = {2016}, volume = {9}, number = {5}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1818-1827}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, XRD, XRF, in-situ, planar defects, TEM}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {1754-5692}, DOI = {10.1039/c6ee00402d}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-18}, author = {Mainz, R. and Simsek Sanli, E. and Stange, H. and Azulay, D. and Brunken, S. and Greiner, D. and Hajaj, S. and Heinemann, M. D. and Kaufmann, C. A. and Klaus, M. and Ramasse, Q. M. and Rodriguez-Alvarez, H. and Weber, A. and Balberg, I. and Millo, O. and van Aken, P. A. and Abou-Ras, D.} } @Article { , title = {Generation of Whole-Body Scintigraphic Images with New GATE Output Capacities}, journal = {IEEE Nuclear Science Symposium and Medical Imaging Conference}, year = {2016}, volume = {(2013 NSS/MIC), Seoul, 2013}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {pp. 1-3.}, keywords = {Index Terms—Nuclear Medicine, Monte Carlo Modelling, Gamma-Camera, Whole-Body Planar Imaging, Anthropomorphic Model.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6829150\&isnumber=6829008}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IEEE}, address = {Seoul}, language = {30}, ISSN = {1082-3654}, DOI = {10.1109/NSSMIC.2013.6829150}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Garcia, MP and Villoing, D and McKay, E and Ferrer, L and Der Sarkissian, H and Poirot, M and Bardi{\`e}s, M} } @Article { , title = {Experimental Extreme Field Strength Investigation in Reverberant Enclosures}, journal = {Proceedings of the 2014 International Symposium on EMC (EMC Europe) Gothenburg, Sweden}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {332 - 336}, keywords = {reverberation chambers, reverberant environments, in-situ measurements, electric field strength, Q-factor}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6930927}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {2325-0356}, DOI = {10.1109/EMCEurope.2014.6930927}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogt-Ardatjew, R.A. and van de Beek, S. and Leferink, F.B.J. and Buesink, Frits} } @Article { , title = {Validation of a Fully Anechoic Chamber}, journal = {Proceedings of the 2016 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Shenzhen, China}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {865-868}, keywords = {anechoic chamber, antenna, S-parameter, s-VSWR, reflection coefficient, time domain reflectometry}, web_url = {http://ieeexplore.ieee.org/document/7522892/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, DOI = {10.1109/APEMC.2016.7522892}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mandaris, D. and Moonen, D.J.G. and van de Beek, G.S. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Time-Frequency Diversity for Solving the Deadlock in Defining Interference Levels in Power Lines}, journal = {Proceedings of the 2016 International Symposium on EMC (EMC Europe) Wroclaw, Poland}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-6}, keywords = {electromagnetic interference; power line telecommunication; narrow-band frequency; cyclic short-time}, web_url = {http://www.emceurope.org/2016/program.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Not yet available}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Setiawan, I. and Keyer, C.H. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Drawbacks of a medium sized, grid coupled Photo Voltaic Array}, journal = {Proceedings of the 2016 International Conference on Renewable Energies and Power Quality (ICREPQ), Madrid, Spain, 2016}, year = {2016}, volume = {N.A.}, number = {14}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-4}, keywords = {Photo voltaic array, apparent power, real power, reactive power fine.}, web_url = {http://www.icrepq.com/re\&pqj/RE\&PQJ\%2714-Index.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Renewable Energy \& Power Quality Journal (RE\&PQJ) European Association for the Development of Renewable Energies, Environment and Power Quality, Reg.No. 169208}, address = {Vigo, Spain}, language = {30}, ISSN = {2172-038X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Keyer, C.H. and Setiawan, I. and Leferink, F.B.J. and Buesink, Frits} } @Article { , title = {Reliable Systems Design using Current Boundaries}, journal = {IEEE Electromagnetic Compatibility Magazine}, year = {2016}, volume = {2016-3 or 4}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-12}, keywords = {Regions, Zoning, Current Boundary, Current Barrier, Electromagnetic Separation,}, web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=5962381}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Not known yet}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Buesink, F.J.K. and van Leersum, B.J.A.M. and Leferink, F.B.J.} } @Article { , title = {Mains Power Synchronous Conducted Noise Measurement in the 2 to 150 kHz band}, journal = {Proceedings of the 2016 International Symposium on EMC (EMC Europe) Wroclaw, Poland}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-5}, keywords = {Live measurement, mains, education, common mode, differential mode, wave form}, web_url = {http://www.emceurope.org/2016/program.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Not yet available}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {978-1-5090-1416-3/16/$31.00 ©2016 IEEE}, author = {Keyer, C.H. and Buesink, F.J.K. and Leferink, F.B.J.} } @Proceedings { , title = {Series arrays of NbSi barrier Josephson junctions for AC voltage standards}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest}, year = {2016}, volume = {n / a}, number = {n / a}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {7540562 (2 pp.)}, keywords = {AC Josephson voltage standards, binary-divided Josephson series arrays, NbSi barrier Josephson junctions, pulse-driven Josephson series arrays, SNS Josephson junctions}, web_url = {http://ieeexplore.ieee.org/document/7540562/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {Electronic ISSN: 2160-0171}, DOI = {10.1109/CPEM.2016.7540562}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540562/}, author = {Kohlmann, J. and Kieler, O. and Scheller, T. and Egeling, B. and Wendisch, R. and Behr, R.} } @Proceedings { , title = {Comparison Between GaAs and Graphene QHR Standards for Resistance Realisation at SP}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Calibration, graphene, quantum Hall effect, resistance standard}, web_url = {http://ieeexplore.ieee.org/document/7540514/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540514}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bergsten, T. and Eklund, G.} } @Article { , title = {Doppler-free spectroscopy on Cs D 1 line with a dual-frequency laser}, journal = {Optics letters}, year = {2016}, volume = {41}, number = {13}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {2982-2985}, keywords = {CPT, vapor cell,frequency stability}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-13-2982}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {OSA}, address = {Washington}, language = {30}, ISSN = {0146-9592}, DOI = {10.1364/OL.41.002982}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-13-2982}, author = {Hafiz, M A and Coget, G and de Clercq, E and Boudot, R} } @Proceedings { , title = {A Low Frequency Josephson Impedance Bridge}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest}, year = {2016}, volume = {n / a}, number = {n / a}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {7540509 (2 pp.)}, keywords = {Impedance bridge, Josephson array, Josephson impedance bridge, Josephson voltage standard.}, web_url = {http://ieeexplore.ieee.org/document/7540509/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {Electronic ISSN: 2160-0171}, DOI = {10.1109/CPEM.2016.7540509}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540509/}, author = {Eklund, G and Bergsten, T and Rydler, K-E} } @Proceedings { , title = {A Comparison of the Josephson Impedance Bridges of PTB and SP}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest}, year = {2016}, volume = {n / a}, number = {n / a}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {7540584 (2 pp.)}, keywords = {Impedance bridge, Josephson array, Josephson impedance bridge, Josephson voltage standard.}, web_url = {http://ieeexplore.ieee.org/document/7540584/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {Electronic ISSN: 2160-0171}, DOI = {10.1109/CPEM.2016.7540584}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540584/}, author = {Eklund, G and Bergsten, T and Hagen, T and Palafox, L and Behr, R} } @Proceedings { , title = {New Approach for Measuring Moisture in Solids Using Radio Frequency and Microwave}, journal = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances}, year = {2016}, volume = {11th}, number = {2016}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {297}, keywords = {dielectric permittivity, capacitive cell, coaxial cell, moisture measurement}, web_url = {http://www.isema2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Edifir-Edizioni}, address = {Firenze}, event_place = {Firenze (Italy)}, event_name = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances}, event_date = {23-05-2016 to 27-05-2016}, language = {30}, ISBN = {978-88-7970-800-5}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ben Ayoub, MW and Georgin, E and Rochas, J F and Hubert, S and Achard, P and Neves, L and Sabouroux, P} } @Proceedings { , title = {First metrological applications of the PTB 1 V Josephson Arbitrary Waveform Synthesizer}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {153}, keywords = {Josephson arbitrary waveform synthesizer comparison thermal converter ac-dc transfer difference}, web_url = {http://ieeexplore.ieee.org/document/7540602/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, DOI = {10.1109/CPEM.2016.7540602}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Palafox, L and Behr, R and Kieler, O and Lee, J and Budovsky, I and Bauer, S and Hagen, T} } @Proceedings { , title = {Tests on waveform synthesis in a new cryocooler setup}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, volume = {10.1109/CPEM.2016.7540563}, number = {10.1109/CPEM.2016.7540563}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {voltage measurement, coaxial cables, cooling, cryogenics, Josephson effect, measurement standards}, web_url = {http://ieeexplore.ieee.org/abstract/document/7540563/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa}, event_name = {CPEM16}, event_date = {10-15 July 2016}, language = {30}, ISBN = {978-1-4673-9134-4, 978-1-4673-9135-1, 978-1-4673-9132-0}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540563}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SOSSO, A and Trinchera, B and Durandetto, P and Monticone, E and Kieler, O and Behr, R and Kohlmann, J} } @Article { , title = {Characterization of a Josephson array for pulse-driven voltage standard in a cryocooler}, journal = {Measurement}, year = {2016}, volume = {95}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {77–81}, keywords = {Josephson effect; Quantum voltage standard; Quantum waveform synthesis; Measurement techniques; Measurement uncertainty; Precision measurements; Uncertainty}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116305425}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {Amsterdam, The Netherlands}, language = {30}, ISSN = {http://dx.doi.org/10.1016/j.measurement.2016.09.039}, DOI = {10.1016/j.measurement.2016.09.039}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SOSSO, A and Durandetto, P and Trinchera, B and Kieler, O and Behr, R and Kohlmann, J} } @Proceedings { , title = {Systematic Error Analysis in a Josephson Impedance Bridges}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {179}, keywords = {impedance, Josephson array, programmable Josephson system, Bridge circuits, Impedance, Uncertainty, Transient analysis, Standards, Measurement uncertainty, Timing}, web_url = {http://ieeexplore.ieee.org/document/7540627/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540627}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540627/}, author = {Hagen, T and Palafox, L and Behr, R} } @Proceedings { , title = {Investigation of UV-Induced Degradation of Different Types of WPVS Reference Solar Cells}, journal = {Proceedings of the 32nd European PV Solar Energy Conference and Exhibition ( 32nd EU PVSEC)}, year = {2016}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {2277 - 2281}, keywords = {Calibration, Degradation, Encapsulation, Durability, Characterisation, Characterization}, web_url = {https://www.eupvsec-proceedings.com/proceedings?paper=37311}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Munich, Germany}, event_name = {32nd European Photovoltaic Solar Energy Conference and Exhibition (EU PVSEC 2016)}, event_date = {20-24 June 2016}, language = {30}, ISBN = {3-936338-41-8}, DOI = {10.4229/EUPVSEC20162016-5BV.4.34}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kroeger, I. and Hohl-Ebinger, J. and Brachmann, S. and Winter, S.} } @Proceedings { , title = {Comparison of the frequency dependence of capacitance ratios between LNE and PTB}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, keywords = {Impedance bridge, Josephson array, Josephson impedance bridge}, web_url = {http://ieeexplore.ieee.org/document/7540585/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540585}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Hagen, T and Th{\'e}venot, O and S{\'e}ron, O and Khan, S and Palafox, L and Behr, R} } @Proceedings { , title = {Implementation of an impedance bridge based on pulse-driven Josephson arrays for arbitrary impedance ratios and phase angles}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, keywords = {Bridge circuits, Impedance, Impedance measurement, Frequency measurement, Temperature measurement, Resistors, Standards}, web_url = {http://ieeexplore.ieee.org/document/7540626/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540626}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Bauer, S and Behr, R and Hagen, T and Kieler, O and Palafox, L and Schurr, J} } @Article { , title = {Metrological challenges for measurements of key climatological observables: oceanic salinity and pH, and atmospheric humidity. Part 1: overview}, journal = {Metrologia}, year = {2016}, volume = {53}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {R1-R11}, keywords = {seawater salinity, seawater pH, relative humidity, traceability}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1/R1}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Physics}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/1/R1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Feistel, R and Wielgosz, R and Bell, S A and Cam{\~o}es, M F and Cooper, J R and Dexter, P and Dickson, A G and Fisicaro, P and Harvey, A H and Heinonen, M and Hellmuth, O and Kretzschmar, H-J and Lovell-Smith, J W and McDougall, T J and Pawlowicz, R and Ridout, P and Seitz, S and Spitzer, P and Stoica, D and Wolf, H} } @Article { , title = {Metrological challenges for measurements of key climatological observables. Part 4: atmospheric relative humidity}, journal = {Metrologia}, year = {2016}, volume = {53}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {R40–R59}, keywords = {relative humidity, meteorology, metrology, IAPWS, BIPM, definitions, climate}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1/R40/meta}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Physics}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/1/R40}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lovell-Smith, J W and Feistel, R and Harvey, A H and Hellmuth, O and Bell, S A and Heinonen, M and Cooper, J R} } @Proceedings { , title = {Development and testing of optically-interrogated current sensors}, journal = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) Proceedings}, year = {2016}, volume = {N/A}, number = {N/A}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {167}, keywords = {Fiber Bragg grating, optical current sensor, power system instrumentation, electronic current transformer}, web_url = {http://ieeexplore.ieee.org/document/7602871/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, address = {New Jersey}, event_place = {Aachen}, event_name = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {28-09-2016}, language = {30}, ISBN = {978-1-5090-2373-8}, DOI = {10.1109/AMPS.2016.7602871}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=7585854}, author = {Nelson, J and Fusiek, G and Clayburn, L and Niewczas, P and Booth, C and Orr, P and Gordon, N} } @Article { WeichertBFKKWK2016, title = {Implementation of straightness measurements at the Nanometer Comparator}, journal = {CIRP Annals - Manufacturing Technology}, year = {2016}, volume = {65}, number = {1}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {507-510}, keywords = {Measurement, Straightness, Error Separation}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, address = {New York, USA}, language = {30}, ISSN = {0007-8506}, DOI = {10.1016/j.cirp.2016.04.070}, stag_bib_extends_levelofaccess = {NA}, author = {Weichert, Christoph and Bosse, Harald and Fl{\"u}gge, Jens and K{\"o}ning, Rainer and K{\"o}chert, Paul and Wiegmann, Axel and Kunzmann, Horst} } @Proceedings { LiEBWSW2016, title = {EUMETRISPEC: A Versatile, Metrological, High-resolution Fouriertransform-spectrometer- Infrastructure to Determine Accurate Spectral Data}, journal = {Imaging and Applied Optics 2016}, year = {2016}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {LM3G.1}, keywords = {infrared spectroscopy, Fourier transform spectroscopy, high-Resolution spectroscopy, spectral line data, gas metrology}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW Washington, DC 20036-1023, USA}, event_place = {Heidelberg}, event_name = {Laser Applications to Chemical, Security and Environmental Analysis 2016}, event_date = {25-07-2016 to 28-07-2016}, language = {30}, DOI = {10.1364/LACSEA.2016.LM3G.1}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Gang and Ebert, Volker and Brunzendorf, Jens and Werhahn, Olav and Serdyukov, Anton and Werwein, Viktor} } @Article { WerweinBESLW2016, title = {Nitrous oxide line positions in the 0002-0000 band at 2.26 µm as test case for high-resolution FTIR-spectrometer stability}, journal = {Imaging and Applied Optics 2016}, year = {2016}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {JT3A.14}, keywords = {infrared spectroscopy, Fourier transform spectroscopy, nitrous oxide, line position}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023, United States}, language = {30}, DOI = {10.1364/3D.2016.JT3A.14}, stag_bib_extends_levelofaccess = {NA}, author = {Werwein, Viktor and Brunzendorf, Jens and Ebert, Volker and Serdyukov, Anton and Li, Gang and Werhahn, Olav} } @Techreport { IlanderCBKP2016, subid = {106}, title = {Acceptance of the proposal for a new international standard for list-mode data used in nuclear instrumentation}, journal = {JRC Technical reports}, year = {2016}, volume = {JRC100968}, number = {JRC100968}, number2 = {14SIP07: Digital Standard: Standard for Digital Data Format for Nuclear Instrumentation}, pages = {14}, keywords = {Nuclear metrology, International standard, Nuclear safety and security}, misc2 = {EMPIR 2014: Support for Impact}, publisher = {Publications Office of the European Union}, address = {Brussels}, language = {30}, ISBN = {978-92-79-57550-1}, ISSN = {1831-9424}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://publications.jrc.ec.europa.eu/repository/handle/JRC100968}, author = {Ilander, Tarja and Capogni, Marco and Bobin, Christophe and Keightley, John and Paepen, Jan} } @Article { KarhaIVB2016, title = {Temperature invariant energy value in LED spectra}, journal = {Applied Physics Letters}, year = {2016}, volume = {109}, number = {23}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {231103}, keywords = {band gap, III-V optosemiconductors}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Institute of Physics}, language = {30}, DOI = {10.1063/1.4971831}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}rh{\"a}, P. and Ikonen, E. and Vaskuri, A. and Baumgartner, H.} } @Article { , title = {The linkup of mono-elemental solutions to the SI using INAA: a measurement procedure and the achievable uncertainty}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2015}, month = {12}, day = {30}, volume = {306}, number = {3}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {1-10}, keywords = {Neutron activation analysis Metrological traceability Reference solution Molybdenum}, web_url = {http://link.springer.com/article/10.1007\%2Fs10967-015-4676-2\#/page-1}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Berlib}, language = {30}, ISSN = {ISSN 0236-5731}, DOI = {10.1007/s10967-015-4676-2}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {D’Agostino, Giancarlo and Bergamaschi, Luigi and Di Luzio, Marco and Noordmann, Janine and Oddone, Massimo and Rienitz, Olaf} } @Article { RappDGSLODDB2015, title = {Using a dose-area product for absolute measurements in small fields: a feasibility study}, journal = {Physics in Medicine and Biology}, year = {2015}, month = {12}, day = {22}, volume = {61}, number = {2}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {650-662}, keywords = {small fields, dosimetric reference, dose-area product, absolute dosimetry}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/61/2/650}, stag_bib_extends_levelofaccess = {NA}, author = {Rapp, B and Delaunay, F and Gouriou, J and Sommier, L and Le Roy, M and Ostrowsky, A and Dufreneix, S and Daures, J and Bordy, J-M} } @Article { , title = {High accuracy experimental determination of copper and zinc mass attenuation coe cients in the 100 eV to 30 keV photon energy range}, journal = {Metrologia}, year = {2015}, month = {12}, day = {15}, volume = {53}, number = {1}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1-13}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1/7/meta}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/1/7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-15}, author = {M{\'e}nesguen, YM and Gerlach, MG and Pollakowski, BP and Unterumsberger, RU and Haschke, MH and Beckhoff, BB and L{\'e}py, MCL} } @Article { , title = {Piezoelectric materials for high temperature transducers and actuators}, journal = {Journal of Materials Science: Materials in Electronics}, year = {2015}, month = {12}, volume = {26}, number = {12}, number2 = {NEW09: METCO: Metrology of electro-thermal coupling for new functional materials technology}, pages = {9256-9267}, web_url = {http://link.springer.com/article/10.1007/s10854-015-3629-4}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer US}, language = {30}, ISSN = {0957-4522}, DOI = {10.1007/s10854-015-3629-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stevenson, TS and Martin, DM and Cowin, PC and Blumfield, AB and Bell, AB and Comyn, TC and Weaver, PMW} } @Article { KralikBAVSS2015, title = {Measurement of secondary neutrons generated during proton therapy}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {12}, volume = {172}, number = {4}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {341-345}, keywords = {Secondary neutrons, proton therapy, Bonner Sphere Spectrometer}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv504}, stag_bib_extends_levelofaccess = {NA}, author = {Kr{\'a}l{\'i}k, M. and B{\'a}rtov{\'a}, H. and Andrl{\'i}k, M. and Vykydal, Z. and Solc, J. and Solc, J.} } @Article { BallesterNebotAFRRG2015, title = {Determination of ultratrace levels of tributyltin in waters by isotope dilution and gas chromatography coupled to tandem mass spectrometry}, journal = {Journal of Chromatography A}, year = {2015}, month = {12}, volume = {1425}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {265-272}, keywords = {EU Water Framework Directive, GC–MS/MS, Isotope Dilution Mass Spectrometry, Tributyltin}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-9673}, DOI = {10.1016/j.chroma.2015.11.031}, stag_bib_extends_levelofaccess = {NA}, author = {Ballester Nebot, S. and Aranda Mares, J.L. and Font Cardona, N. and Rodr{\'i}guez-Gonz{\'a}lez, P. and Rodr{\'i}guez-Cea, A. and Garc{\'i}a Alonso, J.I.} } @Article { , title = {Ion beam analysis of Cu(In,Ga)Se2 thin film solar cells}, journal = {Applied Surface Science}, year = {2015}, month = {11}, day = {30}, volume = {356}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {631–638}, keywords = {Thin solar Cu(In,Ga)Se2 cells, Ion beam analysis, RBS/PIXE techniques, Synchrotron GIXRF analysis, Depth profiling}, web_url = {http://ac.els-cdn.com/S0169433215019467/1-s2.0-S0169433215019467-main.pdf?_tid=cba9d288-1c21-11e6-9bf0-00000aab0f26\&acdnat=1463484395_b9279df87868924a41b103cfe0aeacf7}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, ISSN = {0169-4332}, DOI = {10.1016/j.apsusc.2015.08.133}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Karydas, AGK and Streeck, CS and Bogdanovic Radovic, IBR and Kaufmann, CK and Rissom, TR and Beckhoff, BB and Jakšic, MJ and Barradas, NPB} } @Proceedings { SperlingPTRPJBR2015, title = {Multiple Transfer Standard for characterisation of sphere test setups}, journal = {Proceedings of the CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, year = {2015}, month = {11}, day = {26}, volume = {1}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {1-5}, keywords = {LED standard, multiple standard, characterisation sphere setup}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Commission Internationale de L'Eclairage}, address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A, 1010 Vienna, Austria}, event_place = {Braunschweig, Germany}, event_name = {CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, event_date = {26-11-2015 to 26-11-2015}, language = {30}, ISBN = {978-3-902842-28-2}, stag_bib_extends_levelofaccess = {NA}, author = {Sperling, A. and Penda, S. and Taddeo, M. and Revtova, E. and Poikonen, T. and Jordan, W. and Blattner, P. and Renoux, D.} } @Article { , title = {Silicon double spring for the simultaneous calibration of probing forces and deflections in the micro range}, journal = {Measurement Science and Technology}, year = {2015}, month = {11}, day = {24}, volume = {27}, number = {2016}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {015601 / 9 pp}, keywords = {double spring, probing force calibration, bending force, bending deflection, stiffness}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing Ltd.}, address = {UK}, language = {30}, DOI = {10.1088/0957-0233/27/1/015601}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brand, U. and Li, Z. and Gao, S. and Hahn, S. and Hiller, K.} } @Article { , title = {A clock network for geodesy and fundamental science}, journal = {Nature Communication}, year = {2015}, month = {11}, day = {24}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, web_url = {arxiv.org/abs/1511.07735}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and D{\"o}rscher, S. and H{\"a}fner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G.} } @Article { , title = {ELSTAB - fiber optic time and frequency distribution technology - a general characterization and fundamental limits}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2015}, month = {11}, day = {20}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, keywords = {fiber optics; time transfer; frequency transfer; delay stabilization}, misc2 = {EMRP A169: Call 2009 Energy}, language = {30}, DOI = {10.1109/TUFFC.2015.2502547}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Krehlik, P. and Śliwczyński, L. and Buczek, L. and Kolodziej, J. and Lipiński, M.} } @Article { SourgenCBDJSH2015, title = {Submillimetre thermistors for balloon-borne applications up to lower stratosphere: preliminary characterization with 0.02 K uncertainty}, journal = {Meteorological Applications}, year = {2015}, month = {11}, day = {18}, volume = {22}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {836-841}, keywords = {calibration; thermistors; uncertainty; stratosphere; metrological characterization}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Wiley}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1504}, stag_bib_extends_levelofaccess = {NA}, author = {Sourgen, D. and Coeur-Joly, G. and Bordereau, J. and Deuz{\'e}, T. and Jouin, D. and Sparasci, F. and Hertzog, A.} } @Article { , title = {Analysis of thermal radiation in ion traps for optical frequency standards}, journal = {Metrologia}, year = {2015}, month = {11}, day = {12}, volume = {52}, number = {6}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {842-856}, keywords = {blackbody radiation shift, ion traps, optical atomic clocks, ion clocks, thermal and high frequency finite element method modelling}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/6/842}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, BIPM}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/52/6/842}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Doležal, M and Balling, P and Nisbet-Jones, P B R and King, S A and Jones, J M and Klein, H A and Gill, P and Lindvall, T and Wallin, A E and Merimaa, M and Tamm, C and Sanner, C and Huntemann, N and Scharnhorst, N and Leroux, I D and Schmidt, P O and Burgermeister, T and Mehlst{\"a}ubler, T E and Peik, E} } @Article { , title = {Kalibrierte THz-Detektoren zur breitbandigen Leistungsmessung}, journal = {Photonik}, year = {2015}, month = {11}, day = {10}, volume = {47}, number = {6.2015}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {2}, keywords = {THz-Detektor, Kalibration, wellenl{\"a}ngenunabh{\"a}ngige Absorption}, web_url = {http://www.photonik.de/kalibrierte-thz-detektoren-zur-breitbandigen-leistungensmessung/150/21002/317549}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AT-Fachverlag GmbH}, address = {D-70736 Fellbach}, language = {43}, ISSN = {1432-9778}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bohmeyer, W. and Lange, K. and M{\"u}ller, R. and Steiger, A.} } @Article { , title = {An in-depth evaluation of accuracy and precision in Hg isotopic analysis via pneumatic nebulization and cold vapor generation multi-collector ICP-mass spectrometry}, journal = {Anal Bioanal Chem}, year = {2015}, month = {11}, day = {9}, volume = {408}, number = {2}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {417–429}, keywords = {Mass spectrometry . ICP-MS . Biological samples . Metals . Heavy metals . Reference materials . Geochemistry . Geology}, web_url = {http://link.springer.com/article/10.1007\%2Fs00216-015-9131-2}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Berlin}, language = {30}, DOI = {10.1007/s00216-015-9131-2}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rua-Ibarz, Ana and Bolea-Fernandez, Eduardo and Vanhaecke, Frank} } @Proceedings { , title = {Improvement of the microflow primary gravimetric standard}, year = {2015}, month = {11}, day = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Incerteza, Calibra\c{c}{\~a}o, Metrologia}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Troia/Portugal}, event_name = {4th meeting of Portuguese quality researchers}, event_date = {June 2013}, language = {92}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Batista, Elsa and Bandeira, Andre and Filipe, Eduarda and Navas, Helena} } @Proceedings { , title = {Uncertainty calculation in gravimetric microflow measurements}, year = {2015}, month = {11}, day = {4}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, keywords = {Microflow, uncertainty, drug delivery devices, calibration}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {St. Petersburg}, event_name = {AMCTM2014}, event_date = {September 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Batista, Elsa and Filipe, Eduarda and Almeida, Nelson and Godinho, Isabel} } @Proceedings { , title = {EUROPEAN RESEARCH PROJECT ON MICROFLOW MEASUREMENTS – MEDD}, year = {2015}, month = {11}, day = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {MEDD, microflow, measurements}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Washington/USA}, event_name = {ISSFM}, event_date = {April 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Batista, Elsa and Lucas, Peter and Bissing, Hugo and Petter, Harm Tido and Ogheard, Florestan and Koustrup Niemann, Anders} } @Proceedings { , title = {Assessment of Flow Meters and Drug Delivery Devices}, year = {2015}, month = {11}, day = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Infusion, measurements, flow}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Lubeck/Germany}, event_name = {8th Workshop Low Flows in Medical Technology}, event_date = {September 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Batista, Elsa} } @Article { , title = {Assessment of exposure to MRI motion-induced fields based on the International Commission on Non-Ionizing Radiation Protection (ICNIRP) guidelines}, journal = {Magnetic Resonance in Medicine}, year = {2015}, month = {11}, day = {3}, volume = {Early View (Online Version of Record published before inclusion in an issue)}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {motion-induced electric field;static magnetic field;workers’ safety}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley Periodicals, Inc.}, language = {30}, ISSN = {1522-2594}, DOI = {10.1002/mrm.26031}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, L and Bottauscio, O and Chiampi, M} } @Article { , title = {Visual and Instrumental Assessments of Color Differences in Automotive Coatings}, journal = {Color Research and Application}, year = {2015}, month = {11}, day = {3}, volume = {41}, number = {4}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {384-391}, keywords = {vision; color; color measurement; perception psychology; psychophysics; industrial inspection}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/col.21964/abstract}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wiley Periodicals, Inc.}, address = {Arlington VA}, language = {30}, ISSN = {1520-6378}, DOI = {10.1002/col.21964}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {G{\'o}mez, O and Perales, E and Chorro, E and Burgos, FJ and Vilaseca, M and Mart{\'i}nez-Verd{\'u}, FM and Pujol, J} } @Proceedings { , title = {Primary Standard in Micro Flow for Traceability in Steady and Pulsating Flow Regime}, year = {2015}, month = {11}, day = {2}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Micro-flow, liquid, dynamic gravimetric calibration, pulsating flow}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Arlington, Virginia, USA}, event_name = {International Symposium of Fluid Flow Measurement}, event_date = {April 14 to 17, 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bissig, H and Tschannen, M and de Huu, M} } @Proceedings { , title = {MICRO FLOW STANDARD FOR STEADY AND PULSATING FLOW}, year = {2015}, month = {11}, day = {2}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {micro flow, traceability, drug delivery}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {University of Freiburg, Germany}, event_name = {2nd International Conference on MicroFluidic Handling Systems}, event_date = {October 8 - 10, 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-1-1}, author = {Bissig, H and Tschannen, M and de Huu, M} } @Proceedings { , title = {MICRO FLOW FACILITY FOR TRACEABILITY IN STEADY AND PULSATING FLOW}, year = {2015}, month = {11}, day = {2}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Micro flow, liquid, dynamic gravimetric calibration, pulsating flow}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Paris, France}, event_name = {16th International Flow Measurement Conference, FLOMEKO 2013}, event_date = {September 24 - 26, 2013}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-1-1}, author = {Bissig, H and Tschannen, M and de Huu, M} } @Techreport { , title = {Global Geodetic Observing System (GGOS) Requirements for Core Sites}, journal = {CDDIS: NASA's Archive of Space Geodesy Data}, year = {2015}, month = {11}, day = {1}, volume = {Revision 2}, number = {Draft 3.4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {GNSS, SLR, DORIS, VLBI, global network}, web_url = {http://cddis.gsfc.nasa.gov/docs/2015/SiteRecDoc_Rev2_D3.4.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {NASA Goddard Space Flight Center}, address = {Greenbelt}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Appleby, G. and Behrend, D. and Bergstrand, S. and Donovan, H. and Emerson, C. and Esper, J. and Hase, H. and Long, J. and Ma, C. and McCormick, D. and Noll, C. and Pavlis, E. and Ferrage, P. and Pearlman, M. and Saunier, J. and Stowers, D. and Wetzel, S.} } @Article { , title = {Numerical prediction of the influence of uncertain inflow conditions in pipes by polynomial chaos}, journal = {International Journal of Computational Fluid Dynamics}, year = {2015}, month = {11}, day = {1}, volume = {29}, number = {6}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {1-12}, keywords = {non-intrusive generalized polynomial chaos, uncertainty quanti cation, computational uid dynamics (CFD), pipe ow, disturbed in ow pro le}, tags = {MAT}, web_url = {https://www.researchgate.net/publication/285383826_Numerical_prediction_of_the_influence_of_uncertain_inflow_conditions_in_pipes_by_polynomial_chaos}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Taylor \& Francis}, address = {Abingdon}, language = {30}, ISSN = {-}, DOI = {10.1080/10618562.2015.1112899}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schmelter, S and Fiebach, A and Model, R and B{\"a}r, M} } @Article { , title = {Impact of improved calibration of a NEO HySpex VNIR-1600 sensor on remote sensing of water depth.}, journal = {IEEE Transactions on Geoscience and Remote Sensing}, year = {2015}, month = {11}, volume = {53}, number = {11}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {6085-6098}, keywords = {Bathymetry, calibration, hyperspectral, imaging spectrometer, nonlinearity, remote sensing, stray light.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7115112\&isnumber=7185497}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {IEEE}, language = {30}, ISSN = {0196-2892}, DOI = {10.1109/TGRS.2015.2431743}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lenhard, KL and Baumgartner, AB and Gege, PG and Nevas, SN and Nowy, SN and Sperling, AS} } @Article { , title = {European research project for the Dynamic Measurement of Mechanical Quantities}, journal = {PTB-Mitteilungen}, year = {2015}, month = {11}, volume = {125}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {4-11}, keywords = {dynamic measurement, mechanical quantities, EMRP, dynamic calibration, primary calibration, force ; torque, pressure, conditioning amplifier, modeling, parameter identification}, web_url = {https://public.ptb.de/resource/310.20150202}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, language = {30}, ISSN = {ISSN 0030-834X}, DOI = {10.7795/310.20150202}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kobusch, M. and Bruns, T.} } @Article { , title = {Measuring dynamic pressure by laser Doppler vibrometry}, journal = {PTB-Mitteilungen}, year = {2015}, month = {11}, volume = {125}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {38-42}, keywords = {dynamic measurement, dynamic pressure calibration, primary calibration, laser interferometry, Clausius-ossotti elation, index of refraction, density change}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, language = {30}, ISSN = {ISSN 0030-834X}, DOI = {10.7795/310.20150206}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bruns, T. and Slanina, O.} } @Proceedings { , title = {TRUTHS Cross-calibration Uncertainty Tool}, journal = {IEEE Geoscience and Remote Sensing Symposium (IGARSS), 2015.}, year = {2015}, month = {11}, volume = {2015}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {2135-2138}, keywords = {Cross-calibration, Libya-4, radiometric uncertainty, TRUTHS}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7326225}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IEEE}, event_place = {Milan, Italy}, event_name = {IEEE Geoscience and Remote Sensing Symposium (IGARSS), 2015.}, event_date = {26-07-2015 to 31-07-2015}, language = {30}, ISBN = {978-1-4799-7929-5}, ISSN = {2153-7003}, DOI = {10.1109/IGARSS.2015.7326225}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gorro{\~n}o, JG and Fox, NPF and Bialek, AB and Green, PDG and Scanlon, TS} } @Article { OliveroGSGMEDBBAMTF2015, subid = {563}, title = {Electrical stimulation of non-classical photon emission from diamond color centers by means of sub-superficial graphitic electrodes}, journal = {Scientific Reports}, year = {2015}, month = {10}, day = {29}, volume = {5}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {15901}, keywords = {Single Photon Sources, NV centers}, web_url = {https://www.nature.com/articles/srep15901}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep15901}, stag_bib_extends_levelofaccess = {NA}, author = {Forneris, J. and Traina, P. and Monticone, D.G. and Amato, G. and Boarino, L. and Brida, G. and Degiovanni, I.P. and Enrico, E. and Moreva, E. and Grilj, V. and Skukan, N. and Jakšić, M. and Genovese, M. and Olivero, P.} } @Article { , title = {Effect of bushings in thermometric fixed-point cells}, journal = {Measurement}, year = {2015}, month = {10}, day = {23}, volume = {78}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {289-295}, keywords = {Bushing, standard platinum resistance thermometer, fixed-point cell, self-heating, immersion profile.}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224115005552}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2015.10.021}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Žužek, V. and Batagelj, V. and Drnovšek, J. and Bojkovski, J.} } @Article { , title = {Effect of Na presence during CuInSe2 growth on stacking fault annihilation and electronic properties}, journal = {Applied Physics Letters}, year = {2015}, month = {10}, day = {14}, volume = {107}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {152103}, keywords = {Stacking faults, Cu(In,Ga)Se2, thin films, solar cells, XRD, GIXRD, GDOES, grain growth, optical pump terahertz probe spectroscopy}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {AIP Publishing LLC}, address = {College Park}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4933305}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Stange, H. and Brunken, S. and Hempel, H. and Rodriguez-Alvarez, H. and Sch{\"a}fer, N. and Greiner, D. and Scheu, A. and Lauche, J. and Kaufmann, C. A. and Unold, T. and Abou-Ras, D. and Mainz, R.} } @Article { , title = {Sudden stress relaxation in compound semiconductor thin films triggered by secondary phase segregation}, journal = {Physical Review B}, year = {2015}, month = {10}, day = {12}, volume = {92}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {155310}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, stress relaxation, recrystallization, grain growth, in-situ, XRD, XRF}, web_url2 = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.155310}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Physical Society}, address = {College Park}, language = {30}, ISSN = {2469-9969}, DOI = {10.1103/PhysRevB.92.155310}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mainz, R. and Rodriguez-Alvarez, H. and Klaus, M. and Thomas, D. and Lauche, J. and Weber, A. and Heinemann, M. D. and Brunken, S. and Greiner, D. and Kaufmann, C. A. and Unold, T. and Schock, H.-W. and Genzel, C.} } @Proceedings { GreenwellBMWBMMBF2015, title = {Preparation of a new autonomous instrumented radiometric calibration site: Gobabeb, Namib Desert}, journal = {Sensors, Systems, and Next-Generation Satellites XIX}, year = {2015}, month = {10}, day = {12}, volume = {9639}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, keywords = {Calibration, Satellites, Networks, Reflectivity, Equipment and services, Sensors, Spectrometers}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2463184}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {SPIE}, address = {Washington}, event_place = {France}, event_name = {Sensors, Systems, and Next-Generation Satellites XIX}, event_date = {21-09-2015 to 21-09-2015}, language = {30}, DOI = {10.1117/12.2194885}, stag_bib_extends_levelofaccess = {NA}, author = {Greenwell, C. and Bialek, A. and Marks, A and Woolliams, E. and Berthelot, B. and Meygret, A. and Marcq, S. and Bouvet, M. and Fox, N.} } @Article { , title = {The European project on high temperature measurement solutions in industry (HiTeMS) – A summary of achievements}, journal = {Measurement}, year = {2015}, month = {10}, day = {9}, volume = {78}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {168-179}, keywords = {High temperature measurement High temperature fixed points (HTFPs) Industrial process control Radiation thermometry Thermocouples Reference functions}, web_url = {http://www.sciencedirect.com/science/article/pii/S026322411500500X}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2015.09.033}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Machiin, G and Anhalt, K and Battuello, M and Bourson, F and Dekker, P and Diril, A and Edler, F and Elliott, C.J. and Girard, F and Greenen, A and Knazovick{\'a}, L and Lowe, D and Pavlasek, P and Pearce, J.V. and Sadli, M and Strnad, R and Seifert, M and Vuelban, E.M.} } @Article { , title = {Thickness and Microdomain Orientation of Asymmetric PS‑b‑PMMA Block Copolymer Films Inside Periodic Gratings}, journal = {Applied Materials and Interfaces}, year = {2015}, month = {10}, day = {6}, volume = {7}, number = {42}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {23615-23622}, keywords = {PS-b-PMMA, self-assembly, trench, thin film, rapid thermal annealing, graphoepitaxy}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {ACS Publications}, address = {Washington}, language = {30}, DOI = {10.1021/acsami.5b07127}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lupi, F. and Aprile, G. and Giammaria, T. and Seguini, G. and Zuccheri, G. and De Leo, N. and Boarino, L. and Perego, M.} } @Article { , title = {Highly directive and Gaussian far-field emission from “giant” photonic trumpets}, journal = {APPLIED PHYSICS LETTERS}, year = {2015}, month = {10}, day = {6}, volume = {107}, number = {14}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {141106-4}, keywords = {photonic antennas; photonic wire; quantum dot}, web_url = {http://scitation.aip.org/content/aip/journal/apl}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publishing}, address = {Melville, NY}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4932574}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stepanov, P. and Delga, A. and Gregersen, N. and Peinke, E. and Munsch, M. and Teissier, J. and M{\o}rk, J. and Richard, M. and Bleuse, J. and G{\'e}rard, J.M. and Claudon, J.} } @Article { , title = {Simultaneous dynamic electrical and structural measurements of functional materials}, journal = {Review of Scientific Instruments}, year = {2015}, month = {10}, day = {5}, volume = {83}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {103901}, keywords = {Piezoelectric fields, Interferometers, Ferroelectric materials, Polarization, Diffractometers}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/86/10/10.1063/1.4931992}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {0034-6748}, DOI = {10.1063/1.4931992}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vecchini, CV and Thompson, PT and Stewart, MS and Muniz-Piniella, AMP and McMitchell, SRCM and Wooldridge, JW and Lepadatu, SL and Bouchenoire, LB and Brown, SB and Wermeille, DW and Bikondoa, OB and Lucas, CAL and Hase, TH and Lesourd, ML and Dontsov, DD and Cain, MGC} } @Article { , title = {Practical requirements for the successful implementation and subsequent dissemination of the redefined kilogram}, journal = {Vacuum}, year = {2015}, month = {10}, volume = {120}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {139-146}, keywords = {Kilogram; Mass; Standards; Cleaning; Storage; Transfer}, web_url = {http://www.sciencedirect.com/science/article/pii/S0042207X15300117}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {PERGAMON-ELSEVIER SCIENCE LTD}, address = {Oxford}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2015.07,007}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31}, author = {Davidson, S and Berry, J and Marti, K} } @Article { , title = {Ion induced fragmentation cross-sections of DNA constituents}, journal = {The European Physical Journal D}, year = {2015}, month = {10}, volume = {69}, number = {237}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {1-9}, keywords = {DNA, impact ionization, fragmentation, cross-sections}, web_url = {http://link.springer.com/article/10.1140\%2Fepjd\%2Fe2015-60204-7}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Berlin}, language = {30}, ISSN = {1434-6079 (print) ; 1434-6079 (online)}, DOI = {10.1140/epjd/e2015-60204-7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rudek, B. and Arndt, A. and Bennett, D. and Wang, M. and Rabus, H.} } @Article { , title = {Secondary ionisations in a wall-less ion-counting nanodosimeter: quantitative analysis and the effect on the comparison of measured and simulated track structure parameters in nanometric volumes.}, journal = {The European Physical Journal D}, year = {2015}, month = {10}, volume = {69}, number = {239}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {1-18}, keywords = {Nanodosimetry, track structure, Monte Carlo}, web_url = {http://link.springer.com/article/10.1140\%2Fepjd\%2Fe2015-60176-6}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {EDP Sciences}, address = {Orsay}, language = {30}, ISSN = {1434-6060 (print) ; 1434-6079 (online)}, DOI = {10.1140/epjd/e2015-60176-6}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hilgers, G. and Bug, M. and Gargioni, E. and Rabus, H.} } @Proceedings { , title = {Research inter-comparison for small liquid flow rates (2 g/h to 600 g/h)}, journal = {FLOMEKO CONFERENCE PROCEEDINGS}, year = {2015}, month = {9}, day = {26}, volume = {1}, number = {1}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {7-00314}, keywords = {Water flow, comparison}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IMEKO}, address = {Budapest}, event_place = {PARIS, FRANCE}, event_name = {FLOMEKO}, event_date = {24-26th September 2013}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {David, Christopher and Melvad, Claus and Bissig, Hugo and Batista, Elsa} } @Proceedings { , title = {Metrological assessment of micro flow-meters and drug delivery devices in the scope of the ''MeDD'' EMRP project}, journal = {Proceedings of the 17th International Congress of Metrology}, year = {2015}, month = {9}, day = {24}, volume = {1}, number = {2015}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {09004}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/contents/contents.html}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {EDP Sciences - Web of Conferences}, address = {Les Ulis, France}, event_place = {PARIS, FRANCE}, event_name = {17th International Congress of Metrology}, event_date = {21-24 September 2015}, language = {30}, DOI = {10.1051/metrology/20150009004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ogheard, Florestan and Batista, Elsa and Petter, Harm Tido and Lucas, Peter and Bissig, Hugo and Niemann, Anders Koustrup} } @Article { , title = {Wave front and phase correction for double-ended gauge block interferometry}, journal = {Metrologia}, year = {2015}, month = {9}, day = {24}, volume = {52}, number = {5}, number2 = {SIB08: subnano: Traceability of sub-nm length measurements}, pages = {708–716}, keywords = {gauge block, interferometer, phase stepping, wavefront error, phase correction, surface roughness, length}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/708/pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, Bureau International des Poids et Mesures}, address = {Bristol}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/52/5/708}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-25}, author = {Lassila, A. and Byman, V.} } @Proceedings { , title = {Measurements of traceable amount of substance fractions through infrared spectroscopy at PTB}, journal = {International Congress of Metrology (CIM) 2015, Proceedings}, year = {2015}, month = {9}, day = {23}, volume = {2015}, number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments}, pages = {07005}, keywords = {infrared laser spectroscopy, TILSAM, tunable diode laser absorption, cavity ring-down spectroscopy, photoacoustic spectroscopy, gas analysis}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07005/metrology_metr2015_07005.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {EDP Sciences - Web of Conferences}, address = {Les Ulis Cedex}, event_place = {Paris}, event_name = {17th International Congress of Metrology 2015}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/20150007005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\"u}ttschwager, Nils and Pog{\'a}ny, Andrea and Nwaboh, Javis and Klein, Alexander and Buchholz, Bernhard and Werhahn, Olav and Ebert, Volker} } @Proceedings { , title = {Metrology for MRI Safety}, year = {2015}, month = {9}, day = {21}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://cfmetrologie.edpsciences.org}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {EDP Sciences}, address = {Les Ulis}, event_place = {Paris, France}, event_name = {17th International Congress of Metrology}, event_date = {September 21-24, 2015}, language = {30}, DOI = {10.1051/metrology/20150009001}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ittermann, B and Bottauscio, O and Hand, J and de Pooter, J and de Prez, L and Rabus, H and Seifert, F and Szymanowski, H and Weidemann, G and Zilberti, L} } @Proceedings { , title = {Estimation of the measurement uncertainty of LNE's metrological Atomic Force Microscope using virtual instrument modeling and Monte Carlo Method}, journal = {Proceedings of 17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, number = {2015}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {14007}, keywords = {atomic force microscope, monte carlo method}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {EDP Sciences}, event_place = {Paris, France}, event_name = {17th International Congress of Metrology}, event_date = {September 21-24, 2015}, language = {30}, DOI = {10.1051/metrology/20150014007}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ceria, P. and Ducourtieux, S. and Boukellal, Y.} } @Article { , title = {METefnet: developments in metrology for moisture in materials}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15003}, keywords = {Development - Moisture in materials}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bell, S and Aro, A and Arpino, F and Aytekin, S and Cortellessa, G and Dell’Isola, M and Ferenč{\'i}kov{\'a}, Z and Fernicola, V and Gavioso, R and Georgin, E and Heinonen, M and Hudoklin, D and Jalukse, L and Karab{\"o}ce, N and Leito, I and M{\"a}kynen, A and Miao, P and Nielsen, J and Nicolescu, I and Rudolfov{\'a}, M and Ojanen-Saloranta, M and {\"O}sterberg, P and {\O}stergaard, P and Rujan, M and Sega, M and Strnad, R and Vachova, T} } @Proceedings { , title = {Metrology for ammonia in ambient air–concept and first results of the EMRP project MetNH3}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {2015}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {07003}, keywords = {ammonia, reference gas mixture, reference gas generator, dilution, absolute spectroscopic measurements, sampling, gas cylinders}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07003/metrology_metr2015_07003.html}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {EDP Sciences - Web of Conferences}, address = {Les Ulis Cedex}, event_place = {Paris, France}, event_name = {17th International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/201507003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pog{\'a}ny, A. and Balslev-Harder, D. and Braban, C. F. and Cassidy, N. and Ebert, V. and Ferracci, V. and Hieta, T. and Leuenberger, D. and L{\"u}ttschwager, N. and Martin, N. and Pascale, C. and Tiebe, C. and Twigg, M. M. and Vaittinen, O. and van Wijk, J. and Wirtz, K. and Niederhauser, B.} } @Proceedings { , title = {Experimental assessment of methods of dissemination of the thermodynamic temperature at the highest temperatures}, journal = {International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17}, number = {15001}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1-5}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15001/metrology_metr2015_15001.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {EDP Sciences}, address = {London/Parc d'Activit{\'e} de Courtabœuf}, event_place = {Paris}, event_name = {17th International Congress of Metrology}, event_date = {September 2015}, language = {30}, DOI = {10.1051/metrology/201515001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sadli, M and Anhalt, K and Bourson, F and Briaudeau, S and del Campo, D and Diril, A and Lowe, D and Machin, G and Manuel Mantilla Amor, J and Martin, M.J and McEvoy, H and Ojanen, M and Pehlivan, O and Rougie, B and Salim, S.G.R} } @Proceedings { , title = {Improved radiation thermometry measurement uncertainty through implementing a primary scale in an industrial laboratory}, journal = {International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {27}, number = {9}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {15004}, keywords = {high temperature, thermodynamic, temperature scale, Kelvin, mise en pratique}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15004/metrology_metr2015_15004.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, event_place = {Paris}, event_name = {17th International Congress of Metrology}, event_date = {September 21-24, 2015}, language = {30}, DOI = {10.1051/metrology/201515004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Willmott, J.R and Lowe, D and Broughton, M and White, B.S and Machin, G} } @Proceedings { , title = {Industrial implementation of the new NIR laser-based sensor for measuring surface moisture in poiymers}, journal = {Proceedings of the 17th International Congress of Metrology 2015}, year = {2015}, month = {9}, day = {21}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {11003}, keywords = {moisture, surcace moisture, NIR laser, polymer}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_11003/metrology_metr2015_11003.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences, 2015}, event_place = {Paris}, event_name = {17th International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/201511003}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hudoklin, D and Mu{\~n}oz Lopez, I and Begeš, G and Drnovšek, J and Beguš, S} } @Article { , title = {First steps in development of a new transfer standard, for moisture measurement, based on radio-frequency wave and micro-wave.}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15008}, keywords = {Moisture, high frequencies, micro-waves, metrology, transfer standard.}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15008/metrology_metr2015_15008.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Georgin, E and Rochas, JF and Achard, P and Hubert, S and Ben Ayoub, MW and Sabouroux, P} } @Proceedings { BettsBHCWKG2015, title = {Fast Current Mapping of Photovoltaic Devices Using Compressive Sampling}, journal = {Proceedings of the 31st European Photovoltaic Solar Energy Conference and Exhibition}, year = {2015}, month = {9}, day = {18}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {29-34}, keywords = {Simulation, Characterisation, Characterization, Compressed Sensing}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {WIP}, address = {Munich}, event_place = {Hamburg, Germany}, event_name = {31st European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {14-09-2015 to 18-09-2015}, language = {30}, ISBN = {3-936338-39-6}, ISSN = {2196-0992}, DOI = {10.4229/EUPVSEC20152015-1AO.2.3}, stag_bib_extends_levelofaccess = {NA}, author = {Betts, TR and Bliss, M and Hall, S and Cashmore, M and Wu, X and Koutsourakis, G and Gottschalg, G} } @Article { , title = {A Potential-based Formulation for Motion-Induced Electric Fields in MRI}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {9}, day = {15}, volume = {PP}, number = {99}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {1}, keywords = {Magnetic resonance imaging, Motion induced electric field, Human exposure, Finite element method}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2015.2474748}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, L. and Bottauscio, O. and Chiampi, M.} } @Article { , title = {Comprehensive Comparison of Various Techniques for the Analysis of Elemental Distributions in Thin Films: Additional Techniques}, journal = {Microscopy and Microanalysis}, year = {2015}, month = {9}, day = {14}, volume = {21}, number = {6}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1644-1648}, keywords = {elemental distributions, thin films, laser-induced breakdown spectroscopy, grazing-incidence X-ray fluorescence analysis, comparison}, web_url = {http://journals.cambridge.org/action/displayAbstract?fromPage=online\&aid=10063275\&fulltextType=RA\&fileId=S1431927615015093}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Cambridge University Press (CUP)}, language = {30}, ISSN = {1431-9276}, DOI = {10.1017/S1431927615015093}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Abou-Ras, DAR and Caballero, RC and Streeck, CS and Beckhoff, BB and In, JHI and Jeong, SJ} } @Article { , title = {Methodology of Designing an Occluded Ear Simulator}, journal = {ACTA ACUSTICA UNITED WITH ACUSTICA}, year = {2015}, month = {9}, day = {1}, volume = {101 (2015)}, number = {5}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {1007 – 1015}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {S. Hirzel Verlag}, address = {Stuttgart}, language = {30}, DOI = {10.3813/AAA.918895}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rodrigues, D and Lavergne, T and Sandermann Olsen, E and Fedtke, T and Barham, R and Durocher, J.-N.} } @Article { , title = {BAYESIAN APPROACH TO THE STATISTICAL INVERSE PROBLEM OF SCATTEROMETRY: COMPARISON OF THREE SURROGATE MODELS}, journal = {International Journal for Uncertainty Quantification}, year = {2015}, month = {9}, day = {1}, volume = {5}, number = {6}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {511–526}, keywords = {scatterometry, Bayesian inference, stochastic partial differential equations, collocation, inverse problem}, tags = {MAT}, web_url = {-}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Begell House}, address = {Danbury}, language = {30}, ISSN = {-}, DOI = {10.1615/Int.J.UncertaintyQuantification.2015013050}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heidenreich, S. and Gross, H. and B{\"a}r, M.} } @Proceedings { , title = {Moisture determination for food quality assessment}, journal = {Proceedings of CIM 2015 - 17th International Congress of Metrology}, year = {2015}, month = {9}, volume = {-}, number = {-}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {-}, keywords = {Moisture, Food, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis}, web_url = {www.metrologie2015.com}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {Paris}, event_place = {Paris}, event_name = {CIM 2015 - 17th International Congress of Metrology}, event_date = {21-24 September 2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/20150015006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rolle, F. and Beltramino, G. and Fernicola, V. and Sega, M. and Verdoja, A.} } @Proceedings { , title = {Metrological traceability for moisture content analysis in wood pellets}, journal = {Proceedings of CIM 2015 - 17th International Congress of Metrology}, year = {2015}, month = {9}, volume = {-}, number = {-}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {-}, keywords = {Moisture, Metrological Traceability, Wood Pellets, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis}, web_url = {www.metrologie2015.com}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {Paris}, event_place = {Paris}, event_name = {CIM 2015 - 17th International Congress of Metrology}, event_date = {21-24 September 2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/20150008002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sega, M. and Beltramino, G. and Fernicola, V. and Rolle, F. and Verdoja, A.} } @Article { , title = {Controlling nucleation in perpendicularly magnetized nanowires through in-plane shape}, journal = {Applied Physics Letters}, year = {2015}, month = {8}, day = {31}, volume = {107}, number = {9}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {092405}, keywords = {Nanowires, Nucleation, Coercive force, Domain walls, Anisotropy}, web_url = {http://scitation.aip.org/content/aip/journal/apl/107/9/10.1063/1.4930152}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publishing LLC}, address = {New York}, language = {30}, ISSN = {1077-3118}, DOI = {10.1063/1.4930152}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Mansell, R and Beguivin, A and Petit, DCMC and Fern{\'a}ndez-Pacheco, A and Lee, JH and Cowburn, RP} } @Article { PszonaPB2015, title = {Nanodosimetry of Carbon Ions at HIL - study of the wall effect in the Jet Counter}, journal = {HIL Annual Report 2014}, year = {2015}, month = {8}, day = {31}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {54-56}, keywords = {Nanodosimetry, BioQuaRT, Jet Counter}, web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5394745/}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {HIL}, address = {Otwock-Swierk}, language = {30}, ISSN = {1895-6726}, DOI = {10.1016/j.rpor.2014.04.017}, stag_bib_extends_levelofaccess = {NA}, author = {Pszona, S. and Pietrzak, M. and Bantsar, A.} } @Proceedings { , title = {Numerical Modeling of Hysteresis Applied on Force Transducer}, journal = {Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque (2015)}, year = {2015}, month = {8}, day = {30}, volume = {22}, number = {1}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {4}, keywords = {Hysteresis, Reversibility, Transducer, Maxwell-Slip, Calibration}, web_url = {http://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC3-073.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IMEKO}, address = {Budapest}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Rabault, T. and Averlant, P. and Boineau, F.} } @Proceedings { , title = {Numerical prediction of the flow rate through a flow meter with uncertain inflow profile}, journal = {XXI IMEKO World Congress ”Measurement in Research and Industry”}, year = {2015}, month = {8}, day = {30}, volume = {-}, number = {2015}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {CFD, non-intrusive gPC, uncertainty quantification, flow measurement, disturbed inflow profile}, tags = {MAT}, web_url = {https://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC21-389.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Czech Technical University in Prague}, address = {Prague}, event_place = {Prague}, event_name = {XXI IMEKO World Congress ”Measurement in Research and Industry”}, event_date = {30-08-2015 to 04-09-2015}, language = {30}, ISBN = {-}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Weissenbrunner, A and Fiebach, A and Schmelter, S and Straka, M and B{\"a}r, M and Lederer, T} } @Article { , title = {Comparison of extrapolated and interpolated temperature scales from 1000 C to 2500 C between a national measurement institute and an ISO17025 accredited calibration laboratory}, journal = {Measurement}, year = {2015}, month = {8}, day = {28}, volume = {76}, number = {2015}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {129-135}, keywords = {High temperature Thermodynamic Temperature scale Kelvin mise en pratique}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224115004145}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Science Direct}, address = {London}, language = {30}, DOI = {10.1016/j.measurement.2015.08.011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lowe, D and Broughton, M and Machin, G and Willmott, J.R} } @Article { QuetelKHFEBB2015, title = {Who should take responsibility for decisions on internationally recommended datasets? The case of the mass concentration of mercury in air at saturation}, journal = {Metrologia}, year = {2015}, month = {8}, day = {27}, volume = {52}, number = {5}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {L25-L30}, keywords = {Who should take responsibility for decisions on internationally recommended datasets? The case of the mass concentration of mercury in air at saturation}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/52/5/L25}, stag_bib_extends_levelofaccess = {NA}, author = {Qu{\'e}tel, C.R. and Kim, K.H. and Horvat, M. and Fisicaro, P. and Ent, H. and Brewer, P.J. and Brown, R.J.C.} } @Article { HolzwarthBHRMLGDG2015, title = {Characterization of a 450 km baseline GPS carrier-phase link using an optical fiber link}, journal = {New Journal of Physics}, year = {2015}, month = {8}, day = {26}, volume = {17}, number = {8}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {083044}, keywords = {frequency transfer, global positioning system, optical fiber link, atomic clock}, web_url = {http://iopscience.iop.org/article/10.1088/1367-2630/17/8/083044/pdf}, web_url2 = {http://arxiv.org/abs/1505.02144}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/17/8/083044}, stag_bib_extends_levelofaccess = {NA}, author = {Holzwarth, R. and Bauch, A. and H{\"a}nsch, T.W. and Raupach, S.M.F. and Matveev, A. and Leute, J. and Grebing, C. and Droste, S. and Grosche, G.} } @Article { KimNHLAHLHMLHJBCPYKSPPHK2015, title = {A Facile Route for Patterned Growth of Metal–Insulator Carbon Lateral Junction through One-Pot Synthesis}, journal = {ACS Nano}, year = {2015}, month = {8}, day = {25}, volume = {9}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {8352-8360}, keywords = {amorphous carbon, bottom-up growth, graphene, graphene growth from polymer, graphene-based heterostructure}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Chemical Society (ACS)}, address = {Washington, USA}, language = {30}, ISSN = {1936-0851, 1936-086X}, DOI = {10.1021/acsnano.5b03037}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, Kwang S. and Novoselov, Konstantin S. and Hwang, Chanyong and Lee, Zonghoon and Ahn, Jong-Hyun and Han, Sang Woo and Lee, Tae Geol and Hyun, Seung and Mishchenko, Artem and Lee, Seoung-Ki and Huh, Sung and Jeon, Gumhye and Byun, Jinseok and Chae, Dong-Hun and Park, Hyo Ju and Yu, Seong Uk and Kim, Yong-Jin and Son, Jin Gyeong and Park, Jaesung and Park, Beomjin and Hong, Byung Hee and Kim, Jin Kon} } @Proceedings { , title = {Measurement and Simulation of Heat Transfer into a Human Skin Phantom}, year = {2015}, month = {8}, day = {24}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, keywords = {THz, mm-wave, Skin Phantom, Thermal Imaging}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Hong Kong}, event_name = {40th International Conference on Infrared, Millimeter and Terahertz Waves (IRMMW-THz 2015)}, event_date = {2015-08-23 until 2015-08-28}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kazemipour, A. and Charles, M. and Allal, D. and Borsero, M. and Zilberti, L. and Bottauscio, O. and Chiampi, M.} } @Proceedings { , title = {Adapter and method for improving the LISN input impedance measurement accuracy}, journal = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, year = {2015}, month = {8}, day = {22}, volume = {2015}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1254-1259}, keywords = {3D electromagnetic simulations, LISN calibration, input impedance, conductive immunity}, web_url = {http://ieeexplore.ieee.org/document/7256350/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Dresden}, event_name = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, event_date = {16-08-2015 to 22-08-2015}, language = {30}, ISBN = {978-1-4799-6616-5}, ISSN = {2158-1118}, DOI = {10.1109/ISEMC.2015.7256350}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ziade, Francois and Ouameur, Mohamed and B{\'e}li{\`e}res, Denis and Poletaeff, Andr{\'e} and Allal, Djamel and Kokalj, Miha and Pinter, Borut} } @Article { , title = {Improved electronic measurement of the Boltzmann constant by Johnson noise Thermometry}, journal = {Metrologia}, year = {2015}, month = {8}, day = {19}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S242-S256}, keywords = {Boltzmann constant, Johnson noise, quantum voltage, noise thermometry}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S242/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/0026-1394/52/5/S242}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Qu, J and Benz, S P and Pollarolo, A and Roglla, H and Tew, W L and White, R and Zhou, K} } @Article { , title = {Preparation and characterization of primary magnesium mixtures for the ab initio calibration of absolute magnesium isotope ratio measurements}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2015}, month = {8}, day = {17}, volume = {31}, number = {1}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {179–196}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, DOI = {10.1039/C5JA00284B}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brandt, Bj¨orn and Vogl, Jochen and Noordmann, Janine and Kaltenbach, Angela and Rienitz, Olaf} } @Article { , title = {Investigation of Verification Artifacts in WR-03 Waveguides}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2015}, month = {8}, day = {15}, volume = {36}, number = {11}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1089-1100}, keywords = {Scattering parameters, Waveguide standards, Measurement uncertainty, Verification artifacts, Microwave measurements}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer}, address = {New York}, language = {30}, ISSN = {1866-6906}, DOI = {10.1007/s10762-015-0193-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shoaib, N. and Kuhlmann, K. and Judaschke, R. and Sellone, M. and Brunetti, L.} } @Article { , title = {Reference dosimetry in the presence of magnetic fields: conditions to validate Monte Carlo simulations}, journal = {Physics in Medicine \& Biology}, year = {2015}, month = {8}, day = {13}, volume = {60}, number = {17}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {6639–6654}, keywords = {reference dosimetry, MRI-guided radiotherapy, Fano theorem, Fano cavity test, Monte Carlo radiation transport, magnetic fields, ionisation, chamber response}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {Online ISSN: 1361-6560, Print ISSN: 0031-9155}, DOI = {10.1088/0031-9155/60/17/6639}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bouchard, H. and de Pooter, J. and Bielajew, A. and Duane, S.} } @Article { BaerSPSO2015, title = {Fast and Flexible Non-Null Testing of Aspheres and Free-Form Surfaces with the Tilted-Wave-Interferometer}, journal = {International Journal of Optomechatronics}, year = {2015}, month = {8}, day = {8}, volume = {8}, number = {4}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {242-250}, keywords = {Interferometry, Non-Null-Test, Asphere, Freeform}, web_url = {http://www.tandfonline.com/doi/full/10.1080/15599612.2014.942925}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1080/15599612.2014.942925}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Baer, Goran and Schindler, Johannes and Pruss, Christof and Siepmann, Jens and Osten, Wolfgang} } @Article { , title = {Brief bursts of infrasound may improve cognitive function - An fMRI study}, journal = {Hearing Research}, year = {2015}, month = {8}, day = {7}, volume = {328 (2015)}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {87-93}, keywords = {Auditory system; Cognitive processing; Infrasound; N-back; Working memory; fMRI}, web_url = {http://www.sciencedirect.com/science/article/pii/S0378595515001628}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, address = {Philadelphia}, language = {30}, DOI = {10.1016/j.heares.2015.08.001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-5-31}, author = {Weichenberger, Markus and Bauer, Martin and K{\"u}hler, Robert and Hensel, Johannes and Br{\"u}hl, R{\"u}diger and Ihlenfeld, Albrecht and Ittermann, Bernd and Gallinat, J{\"u}rgen and Koch, Christian and Sander, Tilmann and K{\"u}hn, Simone} } @Proceedings { , subid = {135}, title = {Metrology for long distance surveying - a joint attempt to improve traceability of long distance measurements}, journal = {IAG 150 Years - Proceedings of the 2013 IAG Scientific Assembly}, year = {2015}, month = {8}, day = {1}, volume = {143}, number = {2015}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {calibration · EDM · GNSS · local ties · reference baseline · long distance}, web_url = {http://link.springer.com/chapter/10.1007\%2F1345_2015_154}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer International Publishing}, address = {Berlin Heidelberg}, event_place = {Potsdam, Germany}, event_name = {International Association of Geodesy (IAG) Scientific Assembly 2013}, event_date = {September 1-6, 2013}, language = {30}, ISSN = {0939-9585}, DOI = {10.1007/1345_2015_154}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Pollinger, F. and Astru, M. and Bauch, A. and Bergstrand, S. and G{\"o}rres, B. and Jokela, J. and Kallio, U. and Koivula, H. and Kuhlmann, H. and Kupko, V. and Meiners-Hagen, K. and Merimaa, M. and Niemeier, W. and Neyezhmakov, P. and Poutanen, M. and Saraiva, F. and Sch{\"o}n, S. and van den Berg, S.A. and Wallerand, J.-P. and Zucco, M.} } @Proceedings { , title = {LED-based field radiometer for sensor web in-situ measurements}, journal = {IEEE International Workshop on Metrology for Aerospace, MetroAeroSpace 2015 - Proceedings 08/2015}, year = {2015}, month = {8}, volume = {2}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {radiometer, LED, vicarious calibration, sensor web, in-situ}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7180675}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {IEEE}, event_place = {Benevento, Italy}, event_name = {2nd IEEE International Workshop on Metrology for Aerospace, MetroAeroSpace 2015}, event_date = {04-06-2015 to 05-06-2015}, language = {30}, DOI = {10.1109/MetroAeroSpace.2015.7180675}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Taralli, ET and Filippo, RF and Brida, GB and Rajteri, MR and Hall, SRGH and Bialek, AB and Greenwell, CG and Fox, NF} } @Article { , title = {Measuring Compositions in Organic Depth Profiling: Results from a VAMAS Interlaboratory Study}, journal = {Journal of Physical Chemistry (B)}, year = {2015}, month = {7}, day = {23}, volume = {119}, number = {33}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {10784–10797}, web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b05625}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ACS}, address = {Washington DC}, language = {30}, DOI = {10.1021/acs.jpcb.5b05625}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-6}, author = {Shard, A. and Havelund, R. and Spencer, S. and Gilmore, I. and Alexander, M.R. and Angerer, T.B. and Aoyagi, S. and Barnes, J.P. and Benayad, A. and Bernasik, A. and Ceccone, G. and Counsell, J.D.P and Deeks, C. and Fletcher, J.S. and Graham, D.J. and Heuser, C. and Lee, T.G. and Marie, C. and Marzec, M.M. and Mishra, G. and Rading, D. and Renault, O. and Scurr, D.J and Shon, H.K. and Spampinato, V. and Tian, H. and Wang, F. and Winograd, N. and Wu, K. and Wucher, A.} } @Article { BergerudOMMPK2015, title = {Effect of changes in temperature scales on historical temperature data}, journal = {International Journal of Climatology}, year = {2015}, month = {7}, day = {19}, volume = {36}, number = {2}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {1005-1010}, keywords = {historical; temperature; data; climate change}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0899-8418}, DOI = {10.1002/joc.4404}, stag_bib_extends_levelofaccess = {NA}, author = {Bergerud, R. A. and Olsen, {\AA}. A. F. and Musacchio, C. and Merlone, A. and Pavlasek, P. and Knazovicka, L.} } @Proceedings { , title = {Investigation of perception at infrasound frequencies by functional magnetic resonance imaging (fMRI) and magnetoencephalography (MEG)}, journal = {Proceedings of International Conference on Sound and Vibration (ICSV22)}, year = {2015}, month = {7}, day = {16}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, keywords = {non-audible noise, functional magnetic resonance imaging, magnetoencephalography, infrasound}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Florence (Italy)}, event_name = {The 22nd International Congress on Sound and Vibration}, event_date = {12-16 July 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bauer, M and Sander-Th{\"o}mmes, T and Ihlenfeld, A and K{\"u}hn, S and K{\"u}hler, R and Koch, C} } @Article { , title = {On the relation between uncertainties of weighted frequency averages and the various types of Allan deviations}, journal = {Metrologia}, year = {2015}, month = {7}, day = {16}, volume = {52}, number = {n/a}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {565-574}, keywords = {frequency uncertainty, Allan deviation, clock comparison}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/4/565/meta}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {n/a}, DOI = {10.1088/0026-1394/52/4/565}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-7-16}, author = {Benkler, E and Lisdat, C and Sterr, U} } @Article { PimpinellaBFVVTPMGD2015, title = {A novel synthetic single crystal diamond device for in vivo dosimetry}, journal = {Medical Physics}, year = {2015}, month = {7}, day = {13}, volume = {42}, number = {8}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {4636-4644}, keywords = {synthetic diamond dosimeter, in vivo dosimetry, radiation therapy, semiconductor detector}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4926556}, stag_bib_extends_levelofaccess = {NA}, author = {Pimpinella, M. and Bagal{\`a}, P. and Falco, M. D. and Verona-Rinati, G. and Verona, C. and Tonnetti, A. and Prestopino, G. and Marinelli, M. and Guerra, A. S. and De Coste, V.} } @Article { , title = {Primary standards for measuring flow rates from 100 nl/min to 1 ml/min – gravimetric principle}, journal = {Biomed. Eng.-Biomed.}, year = {2015}, month = {7}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {301-316}, keywords = {dynamic gravimetric calibration; intercomparison; liquid; metrology for drug delivery; microflow; primary standard; validation.}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0145}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bissig, H. and Petter, H.T. and Lucas, P. and Batista, E. and Fillipe, E. and Almeida, N. and Ribeiro, L.F. and Gala, J. and Martins, R. and Savanier, B. and Ogheard, F. and Niemann, A.K. and L{\"o}tters, J. and Sparreboom, W.} } @Article { , title = {Improving traceability to the international prototype of the kilogram}, journal = {Metrologia}, year = {2015}, month = {7}, day = {9}, volume = {52}, number = {Number 4, August 2015}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {538-551}, keywords = {kilogram, prototype, traceability, mass, modelling, least squares adjustment, prediction}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/4/538}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/52/4/538}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Nielsen, L and Davis, R S and Barat, P} } @Article { , title = {Assessment of computational tools for MRI RF dosimetry by comparison with measurements on a laboratory phantom}, journal = {Physics in Medicine \& Biology}, year = {2015}, month = {7}, day = {6}, volume = {60}, number = {14}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {5655–5680}, keywords = {MRI, dosimetry, computational modelling, near field measurements}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {Online ISSN: 1361-6560 / Print ISSN: 0031-9155}, DOI = {10.1088/0031-9155/60/14/5655}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bottauscio, O. and Cassar{\`a}, A. M. and Hand, J. W. and Giordano, D. and Zilberti, L. and Borsero, M. and Chiampi, M. and Weidemann, G.} } @Article { , title = {Evaluation of HPGe spectrometric devices in monitoring the level of radioactive contamination in metallurgical industry}, journal = {Nuclear Instruments and Methods in Physics Research, Section A}, year = {2015}, month = {7}, day = {1}, volume = {797}, number = {not available}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {271-277}, keywords = {High Purity Germanium; Minimum detectable activity; Monte Carlo; Spectrometer; Standardisation; Steel factories}, web_url = {http://www.sciencedirect.com/science/article/pii/S0168900215008220}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2015.07.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Petrucci, Andrea and Arnold, Dirk and Burda, Oleksiy and De Felice, Pierino and Garc{\'i}a-Tora{\~n}o, Eduardo and Mejuto, Marco and Peyr{\'e}s, Virginia and Šolc, Jaroslav and Vodenik, Branko} } @Thesis { Bordonaro2015, title = {Exposure Assessment of Humans Moving Through MRI Static Fields}, year = {2015}, month = {7}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, school = {POLITECNICO DI TORINO, Dipartimento Energia, Laurea Magistrale in Ingegneria Elettrica, Torino, Italy}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bordonaro, Gianfranco} } @Article { , title = {Air index compensated interferometer as aprospective novel primary standard for baselinecalibrations}, journal = {Meas. Sci. Technol.}, year = {2015}, month = {7}, volume = {26 (8)}, number = {084002}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {absolute distance measurement, refractive index compensation, interferometry, geodesy}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1088/0957-0233/26/8/084002}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Meiners–Hagen, Karl and Bosnjakovic, Alen and K{\"o}chert, Paul and Pollinger, Florian} } @Proceedings { BlattnerKJSHB2015, title = {Measurement uncertainty of photometric measurements considering the requirements of the new international standard CIE S 025 / E:2015 ''Test Method for LED Lamps, LED Luminaires and LED Modules}, journal = {Proceedings of the 28th Session of the CIE Manchester, United Kingdom, 28 June – 4 July 2015}, year = {2015}, month = {7}, volume = {1}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {797-811}, keywords = {measurement uncertainty, LED, CIE S 025, Test Method for LED lamps, international standard}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Commission Internationale de L'Eclairage}, address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A, 1010 Vienna, Austria}, event_place = {Manchester, UK}, event_name = {28th Session of the CIE}, event_date = {28-06-2015 to 04-07-2015}, language = {30}, ISBN = {978-3-902842-55-8}, stag_bib_extends_levelofaccess = {NA}, author = {Blattner, P. and Kr{\"u}ger, U. and Jordan, W. and Steudtner, W. and Hornischer, R. and Bechter, W.} } @Article { , title = {Imaging microwave and DC magnetic fields in a vapor-cell Rb atomic clock}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, day = {30}, volume = {64}, number = {12}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {3629-3637}, keywords = {Atomic clocks, diode lasers, microwave measurements, microwave resonators, microwave spectroscopy, optical pumping}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7140794}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, NY, USA}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2444261}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1505.07739}, author = {Affolderbach, C. and Du, G.-X. and Bandi, T. and Horsley, A. and Treutlein, P. and Mileti, G.} } @Article { , title = {Effects of thermal drifts on the calibration of capacitive displacement probes at the nanometer level of accuracy}, journal = {Instrumentation and Measurement, IEEE Transactions}, year = {2015}, month = {6}, day = {26}, volume = {PP}, number = {99}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {1}, keywords = {thermal behavior and drift, capacitive displacement probe, dimensional metrology, evaluation}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2440563}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bouderbala, K and Nouira, H and Girault, M and Videcoq, E and Salgado, J} } @Article { , title = {High temperature measurement and characterisation of piezoelectric properties}, journal = {Journal of Materials Science: Materials in Electronics}, year = {2015}, month = {6}, day = {26}, volume = {26}, number = {12}, number2 = {NEW09: METCO: Metrology of electro-thermal coupling for new functional materials technology}, pages = {9268-9278}, keywords = {Piezoelectric, High Temperature, Measurement, Metrology, Interferometry}, web_url = {http://link.springer.com/article/10.1007\%2Fs10854-015-3285-8}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer US}, language = {30}, ISSN = {0957-4522}, DOI = {10.1007/s10854-015-3285-8}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Weaver, PMW and Stevenson, TS and Quast, TQ and Bartl, GB and Schmitz-Kempen, TSK and Wooliams, PW and Blumfield, AB and Stewart, MS and Cain, MGC} } @Article { , title = {Coherent precession in arrays of dipolar-coupled soft magnetic nanodots}, journal = {Journal of Applied Physics}, year = {2015}, month = {6}, day = {25}, volume = {117}, number = {24}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {7/243905}, keywords = {nanodot, VNA-FMR, precessional mode}, web_url = {http://scitation.aip.org/content/aip/journal/jap}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publisching}, address = {NY}, language = {30}, ISSN = {0021-8979 (print) ; 1089-7550 (online)}, DOI = {10.1063/1.4923160}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hu, X.K and Dey, H. and Liebing, N. and Schumacher, H.W. and Csaba, G. and Orlov, A. and Bernstein, G.H. and Porod, W.} } @Proceedings { , title = {The statistical inverse problem of scatterometry: Bayesian inference and the effect of different priors}, journal = {Proc. SPIE 9526, Modeling Aspects in Optical Metrology V, 95260U (June 21, 2015)}, year = {2015}, month = {6}, day = {21}, volume = {9526}, number = {Modeling Aspects in Optical Metrology V}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {Uncertainty quantification, Diffraction gratings, Hybrid metrology}, tags = {MAT}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2344591}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Society of Photo-Optical Instrumentation Engineers (SPIE)}, address = {Munich}, event_place = {Munich}, event_name = {SPIE Modeling Aspects in Optical Metrology V}, event_date = {21-06-2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1117/12.2185707}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heidenreich, S and Gross, H and Wurm, M and Bodermann, B and B{\"a}r, M} } @Article { , title = {Direct Comparison of a 1 V Josephson Arbitrary Waveform Synthesizer and an AC Quantum Voltmeter}, journal = {Metrologia}, year = {2015}, month = {6}, day = {16}, volume = {52}, number = {4}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {528-537}, keywords = {ac Josephson voltage Standard, Josephson arbitrary waveform Synthesizer, ac quantum Voltmeter, direct comparison}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/4/528}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {BIPM \& IOP Publishing Ltd}, address = {Bristol}, language = {30}, ISSN = {ISSN 0026-1394 (print) ; ISSN 1681-7575 (online)}, DOI = {10.1088/0026-1394/52/4/528}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Behr, Ralf and Kieler, Oliver and Lee, Jinni and Bauer, Stephan and Palafox, Luis and Kohlmann, Johannes} } @Proceedings { , title = {Blowing hot and cold: temperature sensitivities of 3D optical scanners}, journal = {Proceedings of the 15th international conference of the european society for precision engineering and nanotechnology}, year = {2015}, month = {6}, day = {1}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {161}, keywords = {3D optical scanners, temperature, verification}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Euspen}, address = {Cranfield}, event_place = {Leuven}, event_name = {15th international conference of the european society for precision engineering and nanotechnology}, event_date = {01-06-2015 to 05-06-2015}, language = {30}, ISBN = {978-0-9566790-7-9}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Dury, M R and Brown, S B and McCarthy, M B and Woodward`, S D} } @Article { , title = {Absolute Intensity Measurements of CW GHz and THz Radiation Using Electro-Optic Sampling}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {1734-1740}, keywords = {Absolute intensity measurements, antenna measurements, electro-optic (EO) sampling, terahertz (THz) metrology}, web_url = {http://ieeexplore.ieee.org/xpl/freeabs_all.jsp?arnumber=6983632\&abstractAccess=no\&userType=inst}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {unknown}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2014.2375692}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-1-1}, author = {Deng, Yuqiang and F{\"u}ser, Heiko and Bieler, Mark} } @Proceedings { , title = {Development of a virtual instrument to improve the estimation of measurement uncertainty of a metrological atomic force microscope using Monte Carlo method}, journal = {Proceedings of euspen’s 15 th International Conference \& Exhibition, Leuven, Belgium, June 2015}, year = {2015}, month = {6}, number = {2015}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {O3.3, p 107}, keywords = {metrological atomic force microscopy, virtual instrument, modelling, Monte Carlo method, measurement uncertainty}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Euspen}, address = {Delft}, event_place = {Leuven, Belgium}, event_name = {euspen’s 15 th International Conference \& Exhibition}, event_date = {June 1-5, 2015}, language = {30}, ISBN = {978-0-9566790-7-9}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ceria, P. and Ducourtieux, S. and Boukellal, Y.} } @Article { , title = {Verification of statistical calculations in interlaboratory comparisons by simulating input datasets}, journal = {International Journal of Simulation Modelling}, year = {2015}, month = {6}, volume = {14}, number = {2}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {227-237}, keywords = {Interlaboratory Comparison, Validation Software, Performance Metrics, Verification, Simulation}, tags = {MAT}, web_url = {http://www.ijsimm.com/Full_Papers/Fulltext2015/text14-2_227-237.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {DAAAM International Vienna }, address = {Vienna}, language = {30}, ISSN = {1726-4529}, DOI = {10.2507/IJSIMM14(2)4.288}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Acko, BA and Brezovnik, SB and Crepinsek-Lipus, LCL and Klobucar, RK} } @Article { , title = {Dynamic torque calibration by means of model parameter identification}, journal = {Acta Imeko}, year = {2015}, month = {6}, volume = {4}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {39-44}, keywords = {model parameter identification; dynamic torque calibration; dynamic measurement; mechanical model}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-04\%20\%282015\%29-02-07}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Imeko}, address = {Budapest}, language = {30}, ISSN = {ISSN 2221-870X}, DOI = {10.21014/acta_imeko.v4i2.211}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klaus, L. and Arendack{\'a}, B. and Kobusch, M. and Bruns, T.} } @Article { , title = {Investigations for the model‐based dynamic calibration of force transducers by using shock excitation}, journal = {Acta Imeko}, year = {2015}, month = {6}, volume = {4}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {45-51}, keywords = {Dynamic calibration, shock force, dynamic modelling, parameter identification}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-04\%20(2015)-02-08/384}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Imeko}, address = {Budapest}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v4i2.214}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kobusch, M. and Eichst{\"a}dt, S. and Klaus, L. and Bruns, T.} } @Article { , title = {MODELING ASPECTS TO IMPROVE THE SOLUTION OF THE INVERSE PROBLEM IN SCATTEROMETRY}, journal = {Discrete and Continuous Dynamical Systems Series S}, year = {2015}, month = {6}, volume = {8}, number = {3}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {497-519}, keywords = {critical dimensions, uncertainty, lithography, scatterometry, inverse problem}, tags = {MAT}, web_url = {http://www.aimsciences.org/journals/displayArticlesnew.jsp?paperID=10417}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {American Institute of Mathematical Sciences}, address = {Springfield, MO}, language = {30}, ISSN = {-}, DOI = {10.3934/dcdss.2015.8.497}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gross, H and Heidenreich, S and Henn, M-A and B{\"a}r, M} } @Article { SuomalainenSNMMLLKHEDBHW2015, title = {Performance of a Modular Wideband HVDC Reference Divider for Voltages up to 1000 kV}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {1390-1397}, keywords = {Voltage measurement, Calibration, Resistors, HVDC transmission, Uncertainty, Voltage control, Resistance}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2408795}, stag_bib_extends_levelofaccess = {NA}, author = {Suomalainen, E.P. and Schmidt, M. and Nieminen, T. and Merev, A. and Meisner, J. and Lucas, W. and Lehtonen, T. and Kl{\"u}ss, J. and Houtzager, E. and Elg, A.P. and Dedeoğlu, S. and Bergman, A. and H{\"a}llstr{\"o}m, J. and Weber, C.} } @Article { NieminenKHBE2015, title = {Traceability and Characterization of a 1000 kV HVDC Reference Divider}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {1709-1715}, keywords = {Resistors, Resistance, Calibration, Uncertainty, Voltage measurement, Measurement uncertainty, HVDC transmission}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2410373}, stag_bib_extends_levelofaccess = {NA}, author = {Nieminen, T. and Kharezy, M. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Elg, A.P.} } @Proceedings { , title = {Auditory cortex activation by infrasonic and low-frequency sound of equalized individual loudness}, journal = {Euronoise 2015}, year = {2015}, month = {5}, day = {31}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {2577-2582}, keywords = {Infrasound, loudness, MEG}, web_url = {http://www.conforg.fr/euronoise2015/output_directory/data/articles/000402.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Maastricht (Nederlands)}, event_name = {Euronoise 2015, Maastricht}, event_date = {3rd June 2015}, language = {30}, ISSN = {2226-5147}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"u}hler, Robert and Bauer, Martin and Hensel, Johannes and Koch, Christian and Sander-Th{\"o}mmes, Tillmann} } @Proceedings { , title = {MEG and fMRI localization of infrasonic and low-frequency sound}, journal = {Proccedings of the ISMRM 2015 - International Society for Magnetic Resonance in Medicine}, year = {2015}, month = {5}, day = {30}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, web_url = {http://www.ismrm.org/15/}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Toronto, Ontario, Canada}, event_name = {ISMRM 23rd Annual Meeting \& Exhibition}, event_date = {30 May-05 June 2015}, language = {30}, ISSN = {1545-4428}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Weichenberger, M. and Br{\"u}hl, R. and Bauer, M. and K{\"u}hler, R. and Ihlenfeld, A. and Hensel, J. and Koch, C. and Ittermann, B. and K{\"u}hn, S. and Sander-Th{\"o}mmes, T.} } @Article { , title = {The Effect of Bilayer Regions on the Response of Epitaxial Graphene Devices to Environmental Gating}, journal = {Carbon}, year = {2015}, month = {5}, day = {23}, volume = {93}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {896–902}, keywords = {grapheme, metrology, scanning Kelvin probe microscopy}, web_url = {http://www.sciencedirect.com/science/article/pii/S0008622315004686}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {n/a}, DOI = {10.1016/j.carbon.2015.05.061}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-5-23}, author = {Hill-Pearce, R. E. and Eless, V and Lartsev, A and Martin, N. A. and Barker-Snook, I. L. and Helmore, J. J. and Yakimova, R. and Gallop, J. C. and Hao, L} } @Article { , title = {Precise determination of micromotion for trapped-ion optical clocks}, journal = {Atomic Physics (physics.atom-ph); Quantum Physics (quant-ph)}, year = {2015}, month = {5}, day = {21}, number = {2015}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {https://arxiv.org/abs/1505.05907}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Keller, J. and Partner, H. L. and Burgermeister, T. and Mehlstaeubler, T. E.} } @Proceedings { , title = {An active reference spring array for in-situ calibration of the normal spring constant of AFM cantilevers}, journal = {Proc. SPIE 9517, Smart Sensors, Actuators, and MEMS VII; and Cyber Physical Systems, 951719 (May 21, 2015); doi:10.1117/12.2178850; http://dx.doi.org/10.1117/12.2178850}, year = {2015}, month = {5}, day = {21}, volume = {Proc. SPIE 9517}, number = {Proc. SPIE 9517}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {951719}, keywords = {Calibration ; Microelectromechanical systems ; Reactive ion etching ; Simulations ; Fabrication}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, event_place = {Barcelona, Spain}, event_name = {Smart Sensors, Actuators, and MEMS VII and Cyber Physical Systems}, event_date = {2015-May-04}, language = {30}, DOI = {10.1117/12.2178850}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gao, S. and Brand, U. and Hahn, S. and Hiller, K.} } @Proceedings { , title = {Smart sensors and calibration standards for high precision metrology}, journal = {'' Smart sensors and calibration standards for high precision metrology '', Proc. SPIE 9517, Smart Sensors, Actuators, and MEMS VII; and Cyber Physical Systems, 95170V (May 21, 2015); doi:10.1117/12.2179455; http://dx.doi.org/10.1117/12.2179455}, year = {2015}, month = {5}, day = {21}, volume = {9517}, number = {9517}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {95170V}, keywords = {Calibration ; Metrology ; Smart sensors ; Silicon ; Sensors ; Microtechnology ; Dimensional metrology ; Equipment and services ; Fabrication}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, event_place = {Barelona, Spain}, event_name = {Smart Sensors, Actuators, and MEMS VII; and Cyber Physical Systems}, event_date = {May 4, 2015}, language = {30}, DOI = {10.1117/12.2179455}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Brand, U. and Gao, S. and Li, Z. and XU, M. and Buetefisch, S. and Peiner, E. and Frueauf, J. and Hiller, K.} } @Article { , title = {Edge-Mode Resonance-Assisted Switching of Nanomagnet Logic Elements}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {5}, day = {21}, volume = {51}, number = {11}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {4/3401004}, keywords = {Ferromagnetic resonance (FMR) mode, microwave-assisted magnetization switching (MAS), nanomagnet logic (NML), simulation}, web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=20}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2015.2435901}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hu, X.K. and Dey, H. and Liebing, N. and Csaba, G. and Orlov, A. and Bernstein, G.H. and Porod, W. and Krzysteczko, P. and Sievers, S. and Schumacher, H.W.} } @Article { , title = {Single shot lateral shear interferometer with variable shear}, journal = {Optical Engineering}, year = {2015}, month = {5}, day = {20}, volume = {54}, number = {5}, number2 = {SIB08: subnano: Traceability of sub-nm length measurements}, pages = {054105}, keywords = {Wave front sensing, Shear interferometry, Spatial carrier}, web_url = {http://opticalengineering.spiedigitallibrary.org/article.aspx?articleid=2297869}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {SPIE}, address = {Bellingham}, language = {30}, ISSN = {1.OE.54.5.054105}, DOI = {10.1117/1.OE.54.5.054105}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Falldorf, C. and Klattenhoff, R. and Bergmann, R. B.} } @Article { , title = {The portable device for continual measurement of radon progenies on filter using the detector Timepix}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {19}, volume = {164}, number = {4}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {493-496}, keywords = {Timepix, EEC, radon progenies}, web_url = {http://rpd.oxfordjournals.org/content/164/4/493.long}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Oxford University Press}, address = {Oxford}, language = {30}, ISSN = {1742-3406}, DOI = {10.1093/rpd/ncv343}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://rpd.oxfordjournals.org/content/164/4/493.abstract}, author = {Bul{\'a}nek, BB and Hůlka, JH and J{\'i}lek, KJ and Štekl, IŠ} } @Article { , title = {New frontiers in angle metrology at the PTB}, journal = {Measurement}, year = {2015}, month = {5}, day = {14}, number2 = {SIB58: Angles: Angle metrology}, keywords = {Angle measurement; Angle standard; Angle encoder; Autocollimator; Traceability; Key comparison}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Geckeler, R D and Krause, M and Just, A and Kranz, O and Bosse, H} } @Article { SuranKBAMSHTLT2015, title = {A new large-volume metal reference standard for radioactive waste management}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {13}, volume = {168}, number = {3}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {293-299}, keywords = {reference materials, calibration, ionizing radiation, free release measurement}, web_url = {http://rpd.oxfordjournals.org}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv309}, stag_bib_extends_levelofaccess = {NA}, author = {Šur{\'a}ň, J. and Kov{\'a}ř, P. and Burda, O. and Arnold, D. and Marissens, G. and Stroh, H. and Hult, M. and Tzika, F. and Listkowska, A. and Tyminski, Z.} } @Article { , title = {NANODOSIMETRY OF ELECTRONS: ANALYSIS BY EXPERIMENT AND MODELLING}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {12}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, web_url = {http://rpd.oxfordjournals.org/content/early/2015/05/12/rpd.ncv301.abstract}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1093/rpd/ncv301}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bantsar, A. and Pszona, S} } @Proceedings { , title = {Systematische Fehler bei der Anwendung verschiedener Verfahren zur Ermittlung des Schallleistungspegels [Systematic errors by applying different procedures for determining the sound power level]}, journal = {Fortschritte der Akustik - DAGA 2015}, year = {2015}, month = {5}, day = {11}, volume = {41. Jahrestagung f{\"u}r Akustik}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {sound power level determination, sound intensity, systematic differences}, web_url = {http://daga2015.de/de/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, event_place = {N{\"u}rnberg}, event_name = {Fortschritte der Akustik - DAGA 2015}, event_date = {16. bis 19. M{\"a}rz 2015}, language = {43}, ISBN = {978-3-939296-08-9}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arendt, I. and Berger, A.} } @Article { , title = {Frequency and time transfer for metrology and beyond using telecommunication network fibres}, journal = {Comptes Rendus Physique}, year = {2015}, month = {5}, day = {8}, volume = {16}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {531–539}, keywords = {Time and frequency metrology Optical links Frequency stabilized lasers Fibre optics}, web_url = {www.sciencedirect.com}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1016/j.crhy.2015.04.005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopez, O. and K{\'e}f{\'e}lian, F. and Jiang, H. and Haboucha, A. and Bercy, A. and Stefani, F. and Chanteau, B. and Kanj, A. and Rovera, D. and Achkar, J. and Chardonnet, C and Pottie, P.-O. and Amy-Klein, A. and Santarelli, G.} } @Article { , title = {Motion-Induced Fields in Magnetic Resonance Imaging: Are the Dielectric Currents Really Negligible?}, journal = {IEEE MAGNETICS LETTERS,}, year = {2015}, month = {5}, day = {5}, volume = {6}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {Biomagnetics, magnetic resonance imaging, motion-induced fields, human exposure to electromagnetic fields.}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {1949-307X}, DOI = {10.1109/LMAG.2015.2429641}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, Luca and Bottauscio, Oriano and Chiampi, Mario} } @Article { , title = {Automatic minimisation of micromotion in a 88Sr+ optical clock}, journal = {Measurement Science \& Technology}, year = {2015}, month = {5}, volume = {26}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0957-0233/26/7/075203}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barwood, GP and Huang, G and Klein, HA and Gill, P} } @Article { , title = {Heavy ion Beams for Radiobiology: Dosimetry and Nanodosimetry at HIL}, journal = {Acta Physica Polonica A}, year = {2015}, month = {5}, volume = {127}, number = {5}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {1516-1519}, keywords = {PACS numbers: 87.53.Bn, 87.53.-j}, web_url = {http://przyrbwn.icm.edu.pl/APP/ABSTR/127/a127-5-18.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.12693/APhysPolA.127.1516}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kamierczak, U. and Bantsar, A. and Banas, D. and Braziewicz, J. and Czub, J. and Jask{\'o}la, M. and Korman, A. and Kruszewski, M. and Lankoff, A. and Lisowska, H. and Pietrzak, M. and Pszona, S. and Stepkowski, T. and Szeflinski, Z. and Wojew{\'o}dzka, M.} } @Article { , title = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, journal = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, year = {2015}, month = {5}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Dirac-point physics, epitaxial graphene, magneto-transport, measurement, graphene, hall effect, electron-hole puddles,}, web_url = {http://arxiv.org/abs/1505.03747}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1103/PhysRevB.92.075407}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, J. and Alexander-Webber, J.A. and Baker, A.M.R. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.} } @Article { MustoeRBBGBM2015, title = {Ten years of mercury measurement at urban and industrial air quality monitoring stations in the UK}, journal = {Atmospheric Environment}, year = {2015}, month = {5}, volume = {109}, number = {-}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {1-8}, keywords = {Ten years of mercury measurement at urban and industrial air quality monitoring stations in the UK}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {1352-2310}, DOI = {10.1016/j.atmosenv.2015.03.003}, stag_bib_extends_levelofaccess = {NA}, author = {Mustoe, C.L. and Robins, C. and Brown, A.S. and Butterfield, D.M. and Goddard, S.L. and Brown, R.J.C. and McGhee, E.A.} } @Article { , title = {Simulating photoconductive atomic-force 5 microscopy on disordered photovoltaic materials}, journal = {Physical Review B}, year = {2015}, month = {4}, day = {28}, volume = {91}, number = {14}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {144202}, web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.91.144202}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {APS Physics}, address = {Washington DC}, language = {30}, ISSN = {1098-0121}, DOI = {10.1103/PhysRevB.91.144202}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-4-28}, author = {Blakesley, J.C. and Castro, F.A} } @Article { , title = {Phase Locking a Clock Oscillator to a Coherent Atomic Ensemble}, journal = {Phys. Rev. X}, year = {2015}, month = {4}, day = {27}, volume = {5}, number = {2}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {021011}, keywords = {Atomic and Molecular Physics, Quantum Physics}, web_url = {http://arxiv.org/abs/1501.03709}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {2160-3308}, DOI = {10.1103/PhysRevX.5.021011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kohlhaas, R and Bertoldi, A and Cantin, E and Aspect, A and Landragin, A and Bouyer, P} } @Article { , title = {Mapping the Optical Absorption of a Substrate-Transferred Crystalline AlGaAs Coating at 1.5um}, journal = {Classical and Quantum Gravity}, year = {2015}, month = {4}, day = {27}, volume = {32}, number = {10}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {105008}, keywords = {gravitational wave detectors, absorption, crystalline coating}, web_url = {http://iopscience.iop.org/article/10.1088/0264-9381/32/10/105008/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0264-9381}, DOI = {10.1088/0264-9381/32/10/105008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Steinlechner, J and Martin, I W and Bell, A and Cole, G and Hough, J and Penn, S and Rowan, S and Steinlechner, S} } @Article { , title = {Multiphoton luminescence imaging of chemically functionalized multi-walled carbon nanotubes in cells and solid tumors†}, journal = {ChemComm}, year = {2015}, month = {4}, day = {24}, volume = {51}, number = {45}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {9366-9369}, keywords = {N/A}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/CC/c5cc02675j\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Royal Society of Chemistry}, address = {Picadilly UK}, language = {30}, ISSN = {N/A}, DOI = {10.1039/c5cc02675j}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Rubio, N. and Hirvonen, L.M. and Chong, E.Z. and Wang, J.T.W. and Bourgognon, M. and Kafa, H. and Hassan, H.A.F.M. and Al-Jamal, W.T. and McCarthy, D. and Hogstrand, C. and Festy, F. and Al-Jamal, K.T.} } @Article { , title = {Development of a primary thoron activity standard for the calibration of thoron measurement instruments}, journal = {Radiation Protection and Dosimetry}, year = {2015}, month = {4}, day = {24}, number = {167}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {70-74}, keywords = {thoron, radon}, web_url = {http://rpd.oxfordjournals.org/content/167/1-3/70.abstract?maxtoshow=\&hits=10\&RESULTFORMAT=\&fulltext=thoron+sabot\&searchid=1\&FIRSTINDEX=0\&resourcetype=HWCIT}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Oxford Journals}, address = {Oxford University}, language = {30}, ISSN = {1742-3406}, DOI = {10.1093/rpd/ncv221}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sabot, B and Cassette, P and Pierre, S and Michielsen, N and Bondiguel, S} } @Article { , title = {A GPU Computational Code for Eddy-Current Problems in Voxel-Based Anatomy}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2015}, month = {4}, day = {22}, volume = {51}, number = {3}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {Biological effects of electromagnetic radiation, boundary element (BE) method, eddy currents, finite element (FE) method, magnetic resonance imaging (MRI).}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2363140}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bottauscio, O and Chiampi, M and Hand, J and Zilberti, L} } @Article { , title = {EXPERIMENTAL INVESTIGATION OF IONISATION TRACK STRUCTURE OF CARBON IONS AT HIL WARSAW}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {4}, day = {20}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, web_url = {http://rpd.oxfordjournals.org/content/early/2015/04/20/rpd.ncv191.abstract}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1093/rpd/ncv191}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bantsar, A and Hilgers, G. and Pszona, S. and Rabus, H. and Szeflinski, Z.} } @Article { , title = {Measurement Infrastructure to Support the Reliable Operation of Smart Electrical Grids}, journal = {IEEE transactions on instrumentation and measurement}, year = {2015}, month = {4}, day = {20}, volume = {64}, number = {6}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1355 - 1363}, keywords = {smart grid, metrology, synchrophasor, phasor measurement unit, revenue metering, power quality, grid modelling, electrical grids}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7089250}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, address = {n/a}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2406056}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rietveld, Gert and Braun, Jean-Pierre and Martin, Ricardo and Wright, Paul and Heins, Weibke and Ell, Nikola and Clarkson, Paul and Zisky, Norbert} } @Article { , title = {In-field Raman amplification on coherent optical fiber links for frequency metrology}, journal = {Optics Express}, year = {2015}, month = {4}, day = {20}, volume = {23}, number = {8}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {10604 - 10615}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/OE.23.010604}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Clivati, C. and Bolognini, G. and Calonico, D. and Faralli, S. and Mura, A. and Levi, F.} } @Article { , title = {Epitaxial graphene on SiC: Modification of structural and electron transport properties by substrate pretreatment}, journal = {Epitaxial graphene on SiC: modification of structural and electron transport properties by substrate pretreatment}, year = {2015}, month = {4}, day = {20}, volume = {27}, number = {18}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {185303}, keywords = {Epitaxial graphene, step bunching, graphene buffer layer, graphene bilayer, resistance anisotropy, quantum Hall resistance, hydrogen, argon, pretreatment, transport properties, SiC substrate, annealing, shallowly stepped}, web_url = {http://iopscience.iop.org/article/10.1088/0953-8984/27/18/185303/meta}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {0953-8984}, DOI = {10.1088/0953-8984/27/18/185303}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kruskopf, M. and Pierz, K. and Wundrack, S. and Stosch, R. and Dziomba, T. and Kalmbach, C.C. and M{\"u}ller, A. and Ahlers, F.J. and Schumacher, H.W. and Baringhaus, J. and Tegenkamp, C.} } @Article { , title = {Tackling the limits of optical fiber links}, journal = {J. Opt. Soc. Am. B}, year = {2015}, month = {4}, day = {9}, volume = {32}, number = {5}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {787 - 797}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/JOSAB.32.000787}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stefani, F. and Lopez, O. and Bercy, A. and Lee, W.-K. and Chardonnet, C. and Santarelli, G. and Pottie, P.-E. and Amy-Klein, A.} } @Article { , title = {Outgassing rate measurements with the difference method in framework of EMRP IND12}, journal = {Vacuum}, year = {2015}, month = {4}, day = {8}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {Outgassing rate measurement, Outgassing reference probes, Outgassing reference samples}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2015.03.033}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hauer, V. and Battes, K. and Fl{\"a}mmich, M. and Lerardi, V. and Jousten, K. and Šetina, J.} } @Article { , title = {Evaluation and Selection of High-Temperature Fixed-Point Cells for Thermodynamic Temperature Assignment}, journal = {Int J Thermophys}, year = {2015}, month = {4}, day = {5}, volume = {36}, number = {8}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1834-1847}, keywords = {High-temperature fixed points · Metal-carbon eutectics · Radiation thermometry · Temperature standards · Thermodynamic temperature}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1860-0}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Link}, address = {Europe/Asia/Africa}, language = {30}, ISSN = {NA}, DOI = {10.1007/s10765-015-1860-0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yamada, Y and Anhalt, K and Battuello, M and Bloembergen, P and Khlevnoy, B and Machin, G and Matveyev, M and Sadli, M and Todd, A and Wang, T} } @Article { , title = {Magnetoencephalographic accuracy profiles for the detection of auditory pathway sources}, journal = {Biomedizinische Technik}, year = {2015}, month = {4}, day = {1}, volume = {Vol.60 (2015-Apr)}, number = {2}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {135–145}, keywords = {head phantom; magnetoencephalography; source localisation.}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/25490026}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {0013-5585}, DOI = {10.1515/bmt-2013-0136}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bauer, M. and Sander, T. and Trahms, L.} } @Article { , title = {Electroluminescence from a diamond device with ion-beam-micromachined buried graphitic electrodes}, journal = {Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms}, year = {2015}, month = {4}, day = {1}, volume = {348}, number = {8}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {187-190}, keywords = {Diamond; Electroluminescence; Graphite; Ion beam micro-machining}, web_url = {http://www.sciencedirect.com/science/journal/0168583X}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Elsevier}, address = {London}, language = {30}, ISSN = {0168-583X}, DOI = {10.1016/j.nimb.2014.12.036}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Forneris, J. and Battiato, A. and Gatto Monticone, D. and Picollo, F. and Amato, G. and Boarino, L. and Brida, G. and Degiovanni, I.P. and Enrico, E. and Genovese, M. and Moreva, E. and Traina, P. and Verona, C. and Verona Rinati, G. and Olivero, P.} } @Article { , title = {Positive operator-valued measure reconstruction of a beam-splitter tree-based photon-number-resolving detector}, journal = {OPTICS LETTERS}, year = {2015}, month = {4}, day = {1}, volume = {40}, number = {7}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {1548-1551}, keywords = {Quantum optics, Quantum detectors, Quantum information and processing.}, web_url = {https://www.osapublishing.org/ol/home.cfm}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington}, language = {30}, ISSN = {0146-9592}, DOI = {10.1364/OL.40.001548}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-4-1}, author = {Piacentini, F. and Levi, M. P. and Avella, A. and L{\'o}pez, M. and K{\"u}ck, S. and Polyakov, S. V. and Degiovanni, I. P. and Brida, G. and Genovese, M.} } @Article { BaekRB2015, title = {Calculation of electron track structure in water and DNA medium}, journal = {Radiotherapy and Oncology}, year = {2015}, month = {4}, volume = {115}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {S76}, keywords = {BioQuaRT, track structure, particle track simulation, nanodosimetry, low energy electrons, PTra, cross sections, DNA molecules}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier BV}, address = {Suite 800, 230 Park Avenue, New York, NY 10169, United States}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/S0167-8140(15)40154-9}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Baek, W.Y. and Rabus, H. and Bug, M.U.} } @Article { SchneiderRB2015, title = {A database application to investigate the validity of the nanodosimetric approach}, journal = {Radiotherapy and Oncology}, year = {2015}, month = {4}, volume = {115}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {S734-S735}, keywords = {BioQuaRT, track structure, ion beam therapy, nanodosimetry, biological effectiveness}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier BV}, address = {Suite 800, 230 Park Avenue, New York, NY 10169, United States}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/S0167-8140(15)41355-6}, stag_bib_extends_levelofaccess = {NA}, author = {Schneider, T. and Rabus, H. and Bug, M.U.} } @Article { MeylanGGVBOABBG2015, title = {Characterisation of interaction of radiation with cells - Track structure modelling and biodescriptors of the topology of energy deposition}, journal = {Radiotherapy and Oncology}, year = {2015}, month = {4}, volume = {115}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {S106-S107}, keywords = {BioQuaRT, track structure, ion beam therapy, microdosimetry, nanodosimetry, multi-scale model, reactive species}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier BV}, address = {Suite 800, 230 Park Avenue, New York, NY 10169, United States}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/S0167-8140(15)40209-9}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Meylan, S. and Gruel, G. and Gonon, G. and Villagrasa, C. and Bug, M.U. and Otto, Sandra and Arndt, A. and Baek, W.Y. and Bueno, M. and Giesen, U.} } @Article { , title = {Assessment of drug delivery devices}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {3}, day = {30}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {347-357}, keywords = {compliance; drug delivery; infusion; metrology; pump; standards}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0138}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Batista, E. and Almeida, N. and Fillipe, E. and Sousa, L. and Martins, R. and Lucas, P. and Petter, H.T. and Snijder, R.A and Timmerman, A.M.D.E.} } @Article { AzumaBBBBBCDFFHKKKMMMMNNPRRSSVWWZ, title = {Improved measurement results for the Avogadro constant using a 28Si-enriched crystal}, journal = {Metrologia}, year = {2015}, month = {3}, day = {25}, volume = {52}, number = {2}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, keywords = {fundamental constants, Avogadro constant, kilogram}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0026-1394/52/2/360}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Azuma, Y and Barat, P and Bartl, G and Bettin, H and Borys, M and Busch, I and Cibik, L and D’Agostino, G and Fujii, K and Fujimoto, H and Hioki, A and Krumrey, M and Kuetgens, U and Kuramoto, N and Mana, G and Massa, E and Mee{\ss}, R and Mizushima, S and Narukawa, T and Nicolaus, A and Pramann, A and Rabb, S A and Rienitz, O and Sasso, C and Stock, M and Vocke Jr, R D and Waseda, A and Wundrack, S and Zakel, S} } @Article { , title = {The measurement of sparkle}, journal = {Metrologia}, year = {2015}, month = {3}, day = {24}, volume = {52}, number = {2}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {317–323}, keywords = {sparkle, glint, glitter, goniospectrophotometry, scattering}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/2/317/pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {BIPM \& IOP Publishing Ltd}, address = {Bristol}, language = {30}, ISSN = {1681-7575 (on line)}, DOI = {10.1088/0026-1394/52/2/317}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, A and Bay{\'o}n, S} } @Article { , title = {Status and Strategy for Moisture Metrology in European Metrology Institutes}, journal = {Int. J. Thermophysics}, year = {2015}, month = {3}, day = {22}, volume = {36}, number = {8}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {2185-2198}, keywords = {Certified reference materials · Measurement traceability · Moisture content · Strategy · Water content}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1859-6}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer International Publishing AG}, address = {Teddington}, language = {30}, ISSN = {NA}, DOI = {10.1007/s10765-015-1859-6}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bell, S and Bose, N and Bosma, R and Buzoianu, M and Carroll, P and Frenicola, V and Georgin, E and Heinonen, M and Kentved, A and Melvad, C and Nielsen, J} } @Article { , title = {3D optical scanner dimensional verification facility at the NPL’s “National FreeForm Centre}, journal = {Laser Metrology and Machine Performance XI}, year = {2015}, month = {3}, day = {17}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {187-197}, keywords = {3D optical scanners, characterisation, verification}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Euspen}, address = {Cranfield}, language = {30}, ISBN = {978-0-9566790-5-5}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dury, M R and Brown, S B and McCarthy, M B and Woodward, S D} } @Proceedings { , title = {Upgrade of goniospectrophtometer GEFE for near-field scattering and fluorescence radiance measurements}, journal = {Measuring, Modeling, and Reproducing Material Appearance 2015}, year = {2015}, month = {3}, day = {13}, volume = {9393}, number = {93980E}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {93980E-1 - 93980E-11}, keywords = {Goniospectrophotometry, BSSRDF, BRDF, fluorescence, sparkle, translucency, appearance}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, address = {Bellingham WA, USA}, event_place = {San Francisco, California, USA}, event_name = {IS\&T/SPIE Electronic Imaging}, event_date = {9-10 February 2015}, language = {30}, ISBN = {9781628414882}, ISSN = {0277-786X}, DOI = {10.1117/12.2077084}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bernad, B and Ferrero, A and Pons, A and Hernanz, M. L. and Campos, J} } @Article { LorenzBS2015, title = {Phase topography-based characterization of thermal effects on materials and joining techniques}, journal = {Applied Optics / Vol 54, No 8 / 10 March 2015}, year = {2015}, month = {3}, day = {6}, volume = {54}, number = {8}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {2046-2056}, keywords = {Interferometric imaging; Rotation-invariant pattern recognition; Fringe analysis; Height measurements; Interferometry; Metrological instrumentation; Optomechanics;Thermal effects}, web_url = {http://www.opticsinfobase.org/ao/abstract.cfm?uri=ao-54-8-2046}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, DOI = {10.1364/AO.54.002046}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lorenz, Hagen and Beckert, Erik and Sch{\"o}del, Ren{\'e}} } @Article { , title = {Parametric investigation of Linear Quadratic Gaussian and Model Predictive Control approaches for thermal regulation of a high precision geometric measurement machine}, journal = {Applied Thermal Engineeing}, year = {2015}, month = {3}, day = {5}, volume = {78}, number = {5 March 2015}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {720-730}, keywords = {Temperature control;Closed-loop; State feedback; K{\'a}lm{\'a}n filter; Reduced model}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1016/j.applthermaleng.2014.10.080}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Videcoq, E and Girault, M and Bouderbala, K and Nouira, H and Salgado, J and Petit, D} } @Article { , title = {Thermal Analysis of Human Tissues Exposed to Focused Beam THz Radiations}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2015}, month = {3}, volume = {51}, number = {3}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, keywords = {Biological effects of electromagnetic radiation, finite element (FE) method, heating, propagation, scattering}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Bottauscio, O. and Chiampi, M. and Zilberti, L.} } @Article { , title = {Effect of Tissue Parameters on Skin Heating Due to Millimeter EM Waves}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2015}, month = {3}, volume = {51}, number = {3}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, keywords = {Dosimetry, millimeter wave propagation}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, L. and Voyer, D. and Bottauscio, O. and Chiampi, M. and Scorretti, R.} } @Article { , title = {Mineral composition and heavy metal contamination of sediments originating from radium rich formation water}, journal = {CHEMOSPHERE}, year = {2015}, month = {3}, volume = {122}, number = {2015}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {79–87}, keywords = {Radioactivity Heavy metals Formation water Sediments}, web_url = {http://www.sciencedirect.com/science/article/pii/S0045653514012703}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {ELSEVIER}, language = {30}, DOI = {10.1016/j.chemosphere.2014.10.077}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bzowski, Zbigniew and Michalik, Boguslaw} } @Article { BrunnerHRV2015, title = {First Observations of the Fourth Generation Synthetic Halocarbons HFC-1234yf, HFC-1234ze(E), and HCFC-1233zd(E) in the Atmosphere}, journal = {Environmental Science \& Technology}, year = {2015}, month = {3}, volume = {49}, number = {5}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2703-2708}, keywords = {synthetic halocarbons}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0013-936X, 1520-5851}, DOI = {10.1021/es505123x}, stag_bib_extends_levelofaccess = {NA}, author = {Brunner, D. and Hill, M. and Reimann, S. and Vollmer, M.K.} } @Article { , title = {Analysis of protein coatings on gold nanoparticles by XPS and liquid-based particle sizing techniques}, journal = {Biointerphases}, year = {2015}, month = {2}, day = {27}, volume = {10}, number = {1}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, pages = {019012}, keywords = {X-ray photoelectron spectroscopy; Peptides; Gold; Refractive index; Metallic coatings}, web_url = {http://scitation.aip.org/content/avs/journal/bip/10/1/10.1116/1.4913566}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {American Vacuum Society}, address = {New York}, language = {30}, ISSN = {1934-8630}, DOI = {10.1116/1.4913566}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {1559-4106}, author = {Belsey, Natalie A and Shard, Alex G and Minelli, Caterina} } @Article { , title = {Digital holography and quantitative phase contrast imaging using computational shear interferometry}, journal = {Optical Engineering}, year = {2015}, month = {2}, day = {26}, volume = {54}, number = {2}, number2 = {SIB08: subnano: Traceability of sub-nm length measurements}, pages = {024110}, keywords = {Shear interferometry, Wave field sensing, Digital holography, Phase contrast imaging}, web_url = {http://opticalengineering.spiedigitallibrary.org/article.aspx?articleid=2174776}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {SPIE}, address = {Bellingham}, language = {30}, ISSN = {1.OE.54.2.024110}, DOI = {10.1117/1.OE.54.2.024110}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Falldorf, C. and Agour, M. and Bergmann, R. B.} } @Article { , title = {Metrology to support therapeutic and diagnostic techniques based on electromagnetics and nanomagnetics}, journal = {Rendiconti Lincei}, year = {2015}, month = {2}, day = {17}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {1-10}, keywords = {Magnetic resonance imaging, Dosimetry, Magnetic nanoparticles, Biosensors}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {Print ISSN 2037-4631, Online ISSN 1720-0776}, DOI = {10.1007/s12210-015-0386-5}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Barrera, G and Borsero, M and Bottauscio, O and Celegato, F and Chiampi, M and Coı¨sso, M and Giordano, D and Inguscio, M and Manzin, A and Simonetto, E and Tiberto, P and Zilberti, L} } @Article { , title = {Numerical Prediction of Temperature Elevation Induced around Metallic Hip Prostheses by Traditional, Split, and Uniplanar Gradient Coils}, journal = {Magnetic Resonance in Medicine}, year = {2015}, month = {2}, day = {17}, volume = {early view}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {temperature elevation; hip prostheses; gradient coils}, tags = {MAT}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {1522-2594}, DOI = {10.1002/mrm.25687}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, L and Bottauscio, O and Chiampi, M and Hand, J and Sanchez Lopez, H and Br{\"u}hl, R and Crozier, S} } @Article { , title = {A numerical and experimental investigation of the heat losses in thermometric fixed-point cells}, journal = {International Journal of Heat and Mass Transfer}, year = {2015}, month = {2}, day = {17}, volume = {85}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {321-335}, keywords = {Open metal-freezing-point cells, heat loss, radiation modeling, light piping, immersion profile.}, web_url = {http://www.sciencedirect.com/science/article/pii/S0017931015001325}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0017-9310}, DOI = {10.1016/j.ijheatmasstransfer.2015.01.114}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Batagelj, V. and Žužek, V. and Drnovšek, J. and Bojkovski, J.} } @Article { , title = {HfTi-nanoSQUID gradiometers with high linearity}, journal = {Applied Physics Letters}, year = {2015}, month = {2}, day = {17}, volume = {106}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {072601}, keywords = {nanoSQUID gradiometers, metrology}, web_url = {http://scitation.aip.org/content/aip/journal/apl/106/7/10.1063/1.4909523}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, address = {Melville, New York}, language = {30}, ISSN = {n/a}, DOI = {10.1063/1.4909523}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-8-17}, author = {Bechstein, S and Ruede, F and Drung, D and Storm, J. -H. and Kieler, O. F. and Kohlmann, J. and Weimann, T. and Schurig, T.} } @Article { KuepferlingZSVDPRRB2015, title = {Vortex dynamics in Co-Fe-B magnetic tunnel junctions in presence of defects}, journal = {Journal of Applied Physics}, year = {2015}, month = {2}, day = {13}, volume = {117}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, web_url = {http://scitation.aip.org/content/aip/journal/jap/117/17/10.1063/1.4908142}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {0021-8979}, DOI = {10.1063/1.4908142}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kuepferling, M. and Zullino, S. and Sola, A. and Van de Wiele, B. and Durin, G. and Pasquale, M. and Rott, K. and Reiss, G. and Bertotti, G.} } @Article { , title = {Precision measurement of a potential-profile tunable single-electron pump}, journal = {Metrologia}, year = {2015}, month = {2}, day = {5}, volume = {52}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {195-200}, keywords = {single electron pump, quantum current standard, QD electron pump}, web_url = {http://m.iopscience.iop.org/0026-1394/52/2/195}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1088/0026-1394/52/2/195}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bae, M.-H. and Ahn, Y.-H. and Seo, M. and Chung, Y. and Fletcher, J. D. and Giblin, S. P. and Kataoka, M. and Kim, N.} } @Article { , title = {Reference-free, depth-dependent characterization of nanolayers and gradient systems with advanced grazing incidence X-ray fluorescence analysis}, journal = {pss(a) - ALTECH Proc}, year = {2015}, month = {2}, day = {5}, volume = {212}, number = {3}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {523-528}, keywords = {GIXRF, XRR, depth profiling, ultra-shallow implants, nanolaminates, tetralactam macrocycle self-assembled multilayers}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/pssa.201400204/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Wiley}, address = {Honoken}, language = {30}, DOI = {10.1002/pssa.201400204}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Honicke, P. and Detlefs, B. and Muller, M. and Darlatt, E. and Nolot, E. and Grampeix, H. and Beckhoff, B.} } @Article { ZuccaHB, title = {Quantities affecting the behavior of vibrational magnetostrictive transducers}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {2}, day = {2}, volume = {51}, number = {11}, number2 = {ENG02: Harvesting: Metrology for Energy Harvesting}, keywords = {Electromagnetic measurements, Electromagnetic modeling, Energy harvesting .}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2359248}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, Mauro and Hadadian, Arash and Bottauscio, Oriano} } @Article { BeckerBBBJJMPV2015, title = {Realization, characterization and measurements of standard leak artefacts}, journal = {Measurement}, year = {2015}, month = {2}, volume = {61}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {Gas flow metrology, Standard leak artefacts, Experimental data set}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1016/j.measurement.2014.10.045}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Becker, Ute and Bentouati, Djlali and Bergoglio, Merdede and Boineau, Fr{\'e}d{\'e}ric and Jitschin, Wolfang and Jousten, Karl and Mari, Domenico and Praž{\'a}k, Dominik and Vičar, Martin} } @Article { GiordanoZBFW2015, title = {Validation of numerical methods for electromagnetic dosimetry through near‐field measurements}, journal = {ACTA IMEKO}, year = {2015}, month = {2}, volume = {4}, number = {1}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {90-96}, keywords = {electromagnetic dosimetry; MRI; near‐field measurements}, web_url = {http://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-04\%20\%282015\%29-01-14/323}, web_url2 = {http://acta.imeko.org/index.php/acta-imeko/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {2221-870X}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Giordano, D. and Zilberti, L. and Borsero, M. and Forastiere, R. and Wang, W.} } @Techreport { , title = {Progress Report of the Department ‘Fundamentals of Dosimetry’}, journal = {CCRI(I) working documents}, year = {2015}, month = {2}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arndt, A. and Baek, W. Y. and Bennett, D. and Bug, M. U. and Buhr, T. and Hilgers, G. and Nettelbeck, H. and Pfl{\"u}ger, T. and Rabus, H. and Rahm, J. and Ren, X. and Rudek, B. and Sellner, S. and Szymanowski, H. and Wang, M. and Weyland, M.} } @Proceedings { , title = {A model-based approach for the dynamic calibration of torque transducers}, year = {2015}, month = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {61-71}, keywords = {dynamic calibration, mechanical modelling, model parameter identification, dynamic measurement, dynamic torque calibration}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Orlando USA}, event_name = {International Modal Analysis Conference IMAC XXXIII}, event_date = {02-02-2015 to 05-02-2015}, language = {30}, ISBN = {978-3-319-15211-0}, DOI = {10.7795/820.20150414K}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klaus, L. and Kobusch, M. and Bruns, T.} } @Article { , title = {En route to traceable reference standards for surface group quantifications by XPS, NMR and fluorescence spectroscopy.}, journal = {Analyst}, year = {2015}, month = {1}, day = {28}, volume = {140}, number = {6}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/AN/C4AN02248C\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {0003-2654}, DOI = {10.1039/c4an02248c}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hennig, A. and Dietrich, P. M. and Hemmann, F. and Thiele, T. and Borcherding, H. and Hoffmann, A. and Schedler, U. and J{\"a}ger, C. and Resch-Genger, U. and Unger, W. E. S.} } @Article { , title = {Etching of silicon surfaces using atmospheric plasma jets}, journal = {Plasma Sources Science and Technology}, year = {2015}, month = {1}, day = {27}, volume = {24}, number = {2}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {025002}, keywords = {plasma jet machining, plasma etching, surface roughness}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, DOI = {10.1088/0963-0252/24/2/025002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Paetzelt, H. and B{\"o}hm, G. and Arnold, Th.} } @Article { , title = {Quantification of Variable Functional-Group Densities of Mixed-Silane Monolayers on Surfaces via a Dual-Mode Fluorescence and XPS Label}, journal = {Analytical Chemistry}, year = {2015}, month = {1}, day = {26}, volume = {87}, number = {5}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, web_url = {http://pubs.acs.org/doi/abs/10.1021/ac503850f}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {0003-2700}, DOI = {10.1021/ac503850f}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Fischer, T. and Dietrich, P. M. and Streeck, C. and Ray, S. and Nutsch, A. and Shard, A. and Beckhoff, B. and Unger, W. E. S. and Rurack, K.} } @Article { VerbeystABF2015, title = {Asynchronous electro-optic sampling of all-electronically generated ultrashort voltage pulses}, journal = {Measurement Science and Technology}, year = {2015}, month = {1}, day = {20}, volume = {26}, number = {2}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {025203}, keywords = {electro-optic sampling, pulse generator, waveform metrology}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/26/2/025203}, stag_bib_extends_levelofaccess = {NA}, author = {Verbeyst, F. and Ahmed, S. and Bieler, M. and F{\"u}ser, H.} } @Article { MalikBPTHH2015, title = {Specific absorption rate in neonates undergoing magnetic resonance procedures at 1.5 T and 3 T}, journal = {NMR in Biomedicine}, year = {2015}, month = {1}, day = {16}, volume = {28}, number = {3}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {344-352}, keywords = {specific absorption rate; neonatal MRI; RF safety; electromagnetic simulations}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {1099-1492}, DOI = {10.1002/nbm.3256}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Malik, Shaihan J. and Beqiri, Arian and Price, Anthony N. and Teixeira, Jose Nuno and Hand, Jeffrey W. and Hajnal, Joseph V.} } @Article { , title = {Doppler-stabilized fiber link with 6 dB noise improvement below the classical limit}, journal = {Optics Letters}, year = {2015}, month = {1}, day = {15}, volume = {40}, number = {2}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {131-134}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/OL.40.000131}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Calosso, C. E. and Bertacco, E. K. and Calonico, D. and Clivati, C. and Costanzo, G. A. and Frittelli, M. and Levi, F. and Micalizio, S. and Mura, A. and Godone, A.} } @Article { , title = {Ultrastable long-distance fiber-optic time transfer: Active compensation over a wide range of delays}, journal = {Metrologia}, year = {2015}, month = {1}, day = {7}, volume = {52}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {82 - 88}, keywords = {time transfer, frequency transfer, fibre optics}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1088/0026-1394/52/1/82}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Krehlik, P. and Śliwczyński, L. and Buczek, L. and Kołodziej, J. and Lipiński, M.} } @Article { , title = {Determining the viscoelastic properties obtained by depth sensing microindentation of epoxy and polyester thermosets using a new phenomenological method}, journal = {Materials Research Express}, year = {2015}, month = {1}, day = {2}, volume = {2}, number = {1}, number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials}, pages = {015301}, web_url = {http://iopscience.iop.org/article/10.1088/2053-1591/2/1/015301/pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, address = {London}, language = {30}, ISSN = {2053-1591}, DOI = {10.1088/2053-1591/2/1/015301}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kohl, JGK and Schwarzer, NS and Ngo, TTN and Favaro, GF and Rengnet, ER and Bierwisch, NB} } @Article { , title = {A novel NIR laser-based sensor for measuring the surface moisture in polymers}, journal = {Sensors and Actuators A: Physical}, year = {2015}, month = {1}, day = {1}, volume = {221}, number = {-}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {53-59}, keywords = {Surface moisture sensor, Near-infrared laser, Optical fiber, Embedded system}, web_url = {http://www.sciencedirect.com/science/article/pii/S092442471400466X}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {New York}, language = {30}, ISSN = {0924-4247}, DOI = {10.1016/j.sna.2014.10.032}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-2}, author = {Beguš, Samo and Begeš, Gaber and Drnovšek, Janko and Hudoklin, Domen} } @Article { , title = {Frequency Noise Processes in a Strontium Ion Optical Clock}, journal = {J. Phys. B: At. Mol. Opt. Phys}, year = {2015}, month = {1}, volume = {48}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {http://iopscience.iop.org/0953-4075/48/3/035401/}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0022-3700}, DOI = {10.1088/0953-4075/48/3/035401}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barwood, GP and Huang, G and King, SA and Klein, HA and Gill, P} } @Article { , title = {Calibration of bridge-, charge- and voltage amplifiers for dynamic measurement applications}, journal = {Metrologia}, year = {2015}, month = {1}, volume = {52}, number = {1}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {72-81}, keywords = {dynamic calibration bridge amplifier charge amplifier voltage amplifier}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing on behalf of Bureau International des Poids et Mesures}, address = {Bristol}, language = {30}, ISSN = {ISSN 0026-1394 (print) ; ISSN 1681-7575 (online)}, DOI = {10.1088/0026-1394/52/1/72}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Klaus, L. and Bruns, Th. and Volkers, H.} } @Article { , title = {Surface mapping of field induced piezoelectric strain at elevated temperatures employing full-field interferometry}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2015}, month = {1}, volume = {62}, number = {1}, number2 = {NEW09: METCO: Metrology of electro-thermal coupling for new functional materials technology}, pages = {88-96}, web_url = {http://ieeexplore.ieee.org/document/7002928/?arnumber=7002928}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2014.006683}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stevenson, TS and Quast, TQ and Bartl, GB and Schmitz-Kempen, TSK and Weaver, PMW} } @Proceedings { , title = {Metrological traceability for metrological sensors illustrated through examples}, journal = {none}, year = {2015}, day = {10}, volume = {none}, number = {none}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {none}, keywords = {traceability, meteorology, measurement uncertainty, weather stations, calibration, temperature, humidity, pressure}, web_url = {https://www.wmo.int/pages/prog/www/CIMO/cimo-teco-meteorex.html}, web_url2 = {https://www.wmo.int/pages/prog/www/IMOP/publications/IOM-109_TECO-2012/Session4/O4_01_Dobre_Metrological_Traceability_Examples.pdf}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {none}, address = {none}, event_place = {Brussels}, event_name = {TECO 2012 - WMO technical conference on meteorological and environmental instruments and methods of observation}, event_date = {16-18 October 2012}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dobre, M. and Bell, S and del Campo, D. and Hudoklin, D. and Heinonen, M. and Lopardo, G. and Merlone, A.} } @Article { GarciaToranoPCRABLD2015, title = {A novel radionuclide specific detector system for the measurement of radioactivity at steelworks}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2015}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, keywords = {Metal radioactivity; HPGe detectors; MDA; metallurgy; steel works}, web_url = {http://www.springer.com/chemistry/journal/10967}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1007/s10967-014-3901-8}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Garc{\'i}a-Tora{\~n}o, E. and Peyres, V. and Caro, B. and Roteta, M. and Arnold, D. and Burda, O. and Loan, M-R. and De Felice, P.} } @Proceedings { BosseBDFFHKKW2015, title = {Challenges in nanometrology: high precision measurement of position and size}, year = {2015}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, keywords = {traceability, measurement uncertainty, New SI, interferometry, line scale length encoder, straightness, photomask, CD metrology, signal modeling, reference}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Ilmenau, Germany}, event_name = {58th IWK Ilmenau Scientific Colloquium}, event_date = {12 September 2014}, DOI = {10.1515/teme-2015-0002}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bosse, Harald and Bodermann, Bernd and Dai, Gaoliang and Fl{\"u}gge, Jens and Frase, Carl Georg and H{\"a}{\ss}ler-Grohn, Wolfgang and K{\"o}chert, Paul and K{\"o}ning, Rainer and Weichert, Christoph} } @Article { , title = {Optical frequency standard using acetylene-filled hollow-core photonic crystal fibers}, journal = {Optics Express}, year = {2015}, volume = {23}, number = {9}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {11227-11241}, web_url = {https://www.osapublishing.org/oe/}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1364/OE.23.011227}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Triches, Marco and Michieletto, Mattia and Hald, Jan and Lyngs{\o}, Jens K. and L{\ae}gsgaard, Jesper and Bang, Ole} } @Article { , title = {Ultrastable low-noise current amplifier: a novel device for measuring small electric currents with high accuracy}, journal = {Rev. Sci. Instrum.}, year = {2015}, volume = {86}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1063/1.4907358}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Drung, D. and Krause, C. and Becker, U. and Scherer, H. and Ahlers, F. J.} } @Article { , title = {An active filter for Delta-Sigma-modulated Josephson waveforms}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, volume = {64}, number = {6}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1559-1563}, keywords = {Active filters, analog circuits, Butterworth filters, harmonic distortion, Josephson voltage standards, low-pass filters, phase distortion, temperature dependence}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2418454}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bergsten, Tobias and Eklund, Gunnar and Tarasso, Valter and Rydler, Karl-Erik} } @Article { , title = {Absolute distance measurementby dual-comb interferometry with multi-channel digital lock-in phase detection}, journal = {Meas. Sci. Technol.}, year = {2015}, volume = {26 (8)}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1088/0957-0233/26/8/084001}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yang, R. and Pollinger, F. and Meiners-Hagen, K. and Krystek, M. and Tan, J. and Bosse, H.} } @Proceedings { , title = {Imaging the Static Magnetic Field Distribution in a Vapor Cell Atomic Clock}, year = {2015}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {21-24}, keywords = {Atomic clocks, Magnetic field measurement, Microwave resonators, Microwave spectroscopy, Optical pumping.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Denver CO, USA}, event_name = {2015 JOINT CONFERENCE OF THE IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM \& European Frequency and Time Forum}, event_date = {13-17 April 2015}, language = {30}, DOI = {10.1109/FCS.2015.7138785}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Affolderbach, C. and Du, G.-X. and Bandi, T. and Horsley, A. and Treutlein, P. and Mileti, G.} } @Article { , title = {Experimental and computational study of gas flow delivered by a rectangular microchannels leak}, journal = {Measurement}, year = {2015}, volume = {73}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {Micro flowrates; rectangular microchannels; secondary standard leaks; slip flow; transition flow.}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bergoglio, M. and Mari, D. and Chen, J. and Si Hadj Mohand, H. and Colin, S. and Barrot, C.} } @Proceedings { , title = {A Model to Analyze the Skin Heating Produced by Millimeter and Submillimeter Electromagnetic Waves}, journal = {Proceedings of the 2013 International Conference on Electromagnetics in Advanced Applications (ICEAA)}, year = {2015}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {895 - 898}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Torino, Italy}, event_name = {2013 International Conference on Electromagnetics in Advanced Applications (ICEAA)}, event_date = {9-13 September 2013}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, L. and Arduino, A. and Bottauscio, O. and Chiampi, M.} } @Article { , title = {Determination of the 151Sm half-life}, journal = {Radiochimica Acta}, year = {2015}, volume = {103}, number = {9}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {1-8}, keywords = {151Sm, half-life, standardisation, mass spectrometry.}, web_url = {http://www.degruyter.com/view/j/ract.2015.103.issue-9/ract-2015-2393/ract-2015-2393.xml?format=INT}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {De Gruyter}, address = {Berlin}, language = {30}, ISSN = {2193-3405}, DOI = {10.1515/ract-2015-2393}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Be, Marie-Martine} } @Article { , title = {Results of the EURAMET.RI(II)-S6.I-129 Supplementary Comparison}, journal = {Metrologia Tech. Suppl.}, year = {2015}, volume = {52}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {06017}, keywords = {Activity measurements; I-129; International comparisons}, web_url = {http://iopscience.iop.org/0026-1394}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Institute of Physcis Science}, address = {Bristol, UK}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/0026-1394/52/1A/06017}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-1}, author = {Garcia-Tora{\~n}o, E. and Altzitzoglou, T. and Pavel Auerbach, P. and B{\'e}, M.M. and Lourenco, V. and Bobin, C. and Cassette, P. and Dersch, R. and Kossert, K. and N{\"a}hle, O. and Peyr{\'e}s, V. and Pomm{\'e}, S. and Rozkov, A. and Sanchez-Cabezudo, A. and Sochorov{\'a}, J.} } @Proceedings { , title = {In-situ determination of the spring constant of AFM cantilevers using a MEMS nanoforce transducer}, journal = {Proceedings of the 14th international conference of the european society for precision engineering and nanotechnology}, year = {2015}, volume = {I}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {P4.11, 205V1}, keywords = {Atomic force microscope (AFM), Cantilever calibration, Nano-force transducer}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Sieca Repro}, address = {Delft}, event_place = {Dubrovnik, Croatia}, event_name = {14th international conference of the european society for precision engineering and nanotechnology}, event_date = {June 2-6, 2014}, language = {30}, ISBN = {14: 978 - 0 - 9566790 - 3 - 1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gao, S. and Brand, U. and Li, Z.} } @Proceedings { , title = {Provisional Assessment of Candidate High-Temperature Thermal Conductivity Reference Materials in the EMRP “Thermo” Project}, journal = {32nd International Thermal Conductivity Conference and 20th International Thermal Expansion Symposium}, year = {2015}, volume = {N/A}, number = {N/A}, number2 = {SIB52: Thermo: Metrology for thermal protection materials}, pages = {142-153}, keywords = {thermal conductivity, reference material, provisional assessment, high temperature, dimensional stability, mechanical stability, chemical stability, uniformity}, web_url = {http://docs.lib.purdue.edu/thermal/2014/steady/5/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Purdue University Press}, address = {West Lafayette, IN, USA}, event_place = {Purdue University, West Lafayette, Indiana, USA}, event_name = {32nd International Thermal Conductivity Conference}, event_date = {Apr. 27 - May 1, 2014}, language = {30}, ISBN = {Print ISBN: 978-1-62671-050-4; ePUB ISBN: 978-1-62671-051-1; ePDF ISBN: 978-1-62671-052-8}, ISSN = {N/A}, DOI = {10.5703/1288284315555}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wu, J. and Morrell, R. and Fry, T. and Gnaniah, S. and Dohil, D. and Dawson, A. and Hameury, J. and Koenen, A. and Hammerschmidt, U. and Turz{\'o}-Andr{\'a}s, E. and Strnad, R. and Blahut, A.} } @Article { , title = {Development of on-line FTIR spectroscopy for siloxane detection in biogas to enhance carbon contactor management}, journal = {Tantala}, year = {2015}, volume = {141}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {128-36}, keywords = {Adsorption; Biogas; CHP; Interference; Landfill; VOCs}, tags = {EnG}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/25966392}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.talanta.2015.03.063}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hepburn, C. A. and Vale, P and Brown, A. S. and Simms, N. J. and McAdam, E. J.} } @Proceedings { , title = {Measurement requirements for biogas specifications}, journal = {17 International Congress of Metrology}, year = {2015}, number2 = {ENG54: Biogas: Metrology for biogas}, keywords = {Biogas}, tags = {EnG}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08006.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {17 International Congress of Metrology}, event_date = {21 September 2015}, language = {30}, DOI = {10.1051/metrology/201508006}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {van der Veen, Adriaan M. H. and Brown, Andrew S. and Heinonen, Martti and Murugan, Arul and Haloua, Frederique and Arrhenius, Karine and Li, Jianrong} } @Proceedings { , title = {Development of a microflow primary standard}, year = {2015}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Flow. uncertainty, measurement}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Coimbra/Portugal}, event_name = {5th National meeting of the Portuguese Society of Metrology}, event_date = {November 2012}, language = {92}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Batista, Elsa and Gala, Jo{\~a}o and Ribeiro, Luis and Almeida, Nelson and Filipe, Eduarda and Martins, Rui} } @Proceedings { , title = {Development of a microflow gravimetric System}, year = {2015}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Microflow, calibration, uncertainty}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Sintra/Portugal}, event_name = {II European Coriolis and Ultrasonic Wokshop}, event_date = {March 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Batista, Elsa} } @Proceedings { , title = {D{\'e}veloppement d’un instrument virtuel pour am{\'e}liorer l’estimation de l’incertitude de mesure du microscope {\`a} force atomique m{\'e}trologique du LNE}, journal = {Proceedings of Forum des microscopies {\`a} sonde locale}, year = {2015}, volume = {11}, number = {2015}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {p 11-12}, keywords = {metrological atomic force microscopy, virtual instrument, modelling, Monte Carlo method, measurement uncertainty}, web_url = {http://www.sondeslocales.fr/livret2015}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Rouilly-Sacey, France}, event_name = {Forum des microscopies {\`a} sonde locale}, event_date = {March 16-20, 2015}, language = {37}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ceria, P. and Ducourtieux, S. and Boukellal, Y.} } @Article { , title = {Ongoing trends in precision metrology,particularly in nanopositioning and nanomeasuring technology}, journal = {tm – Technisches Messen 2015; 82(7–8): 359–366}, year = {2015}, volume = {82}, number = {7-8}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {359-366}, keywords = {Nanopositioning and nanomeasuring machine, multiscale measurement, optical and tactile sensors}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {De Gruyter}, address = {Oldenbourg}, language = {30}, DOI = {10.1515/teme-2015-0011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Manske, E. and Fuessl, R. and Mastylo, R. and Vorbringer-Dorozhovets, N. and Birli, O. and Jaeger, G.} } @Proceedings { , title = {Calibration of infusion pumps using liquids whose physical properties differ from those of water}, year = {2015}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Viscosity, density, infusion medical devices}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Funchal/Portugal}, event_name = {IMEKO TC13}, event_date = {September 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Batista, Elsa and Almeida, Nelson and Moura, Sara and Martins, Rui and Furtado, Andreia and Sousa, Luis and Filipe, Eduarda} } @Proceedings { , title = {High precision dimensional metrology of periodic nanostructures using laser scatterometry}, year = {2015}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Braunschweig, Germany}, event_name = {10th IMEKO Symposium Laser Metrology for Precision Measurement and Inspection in Industry}, event_date = {12 - 13 September 2011}, language = {30}, ISBN = {978-3-18-092156-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bodermann, Bernd and Bonifer, Stefanie and Buhr, Egbert and Diener, Alexander and Wurm, Matthias} } @Proceedings { , title = {Towards traceability in scatterometric-optical dimensional metrology for optical lithography}, journal = {DGaO-Proceedings}, year = {2015}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, web_url = {http://www.dgao-proceedings.de}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Eindhoven, The Netherlands}, event_name = {113th annual meeting of the DGaO}, event_date = {29 May - 1 June 2012}, language = {30}, ISSN = {1614-8436}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bodermann, Bernd and Endres, Johannes and Gro{\ss}, Hermann and Henn, Mark-Alexander and Kato, Akiko and Scholze, Frank and Wurm, Matthias} } @Article { , title = {Mode-resolved frequency comb interferometry for high-accuracy long distance measurement}, journal = {Scientific Reports}, year = {2015}, volume = {5}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {14661}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Nature Publishing Group}, language = {30}, DOI = {10.1038/srep14661}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {van den Berg, S. and van Eldrik, S. and Bhattacharya, N.} } @Article { , title = {Distributed Raman optical amplification in phase coherent transfer of optical frequencies}, journal = {IEEE Photon. Techn. Lett.}, year = {2015}, volume = {25}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {1711-1714}, keywords = {Coherent optical links, frequency comparisons of optical clocks, optical amplifiers}, web_url = {http://arxiv.org/abs/1211.3910}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1109/LPT.2013.2273269}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Clivati, C. and Bolognini, G. and Calonico, D. and Faralli, S. and Levi, F. and Murra, A. and Poli, N.} } @Proceedings { , title = {Improving the traceability chain in geodetic length measurement by the new robust interferometer TeleYAG}, journal = {Proceedings 19th International Research/Expert Conference ''Trends in the Development of Machinery and Associated Technology''}, year = {2015}, volume = {19}, number = {1}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {117-120}, keywords = {traceability, refractive index compensation, multi-wavelength}, web_url = {http://www.tmt.unze.ba/zbornik/TMT2015Journal/030_Journal_TMT_2015.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Zenica: Univ.}, event_place = {Barcelona, Spain}, event_name = {19th International Research/Expert Conference ''Trends in the Development of Machinery and Associated Technology,'' TMT 2015}, event_date = {July 22-23, 2015}, language = {30}, ISSN = {2303-4009}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bošnjakovic, A. and Pollinger, F. and Meiners–Hagen, K.} } @Proceedings { , title = {Fast Simulation Method for Parameter Reconstruction in Optical Metrology}, journal = {Proc SPIE}, year = {2015}, volume = {8681}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, optical metrology, 3D rigorous electromagnetic field simulations, computational metrology, computational lithography, finite-element methods}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Jose, California, United States}, event_name = {SPIE Metrology, Inspection, and Process Control for Microlithography XXVII}, event_date = {February 24, 2013}, language = {30}, DOI = {10.1117/12.2011154}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Burger, S. and Zschiedrich, L. and Pomplun, J. and Schmidt, F. and Bodermann, B.} } @Proceedings { , title = {Scatterometry sensitivity analysis for conical diffraction versus in-plane diffraction geometry with respect to the side wall angle}, journal = {Proc SPIE}, year = {2015}, volume = {8789}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {EUV scatterometry, horizontal and vertical di raction, optical metrology, computational lithography, finite-element methods}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Munich, Germany}, event_name = {SPIE Modelling Aspects in Optical Metrology IV}, event_date = {May 13, 2013}, language = {30}, DOI = {10.1117/12.2020487}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Soltwisch, V. and Burger, S. and Scholze, F.} } @Proceedings { , title = {The effect of line roughness on DUV scatterometry.}, journal = {Proc SPIE}, year = {2015}, volume = {8789}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, Optical metrology, Line edge roughness}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Munich, Germany}, event_name = {SPIE Modelling Aspects in Optical Metrology IV}, event_date = {May 13, 2013}, language = {30}, DOI = {10.1117/12.2020761}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Henn, M.-A. and Heidenreich, S. and Gro{\ss}, H. and Bodermann, B. and Baer, M.} } @Proceedings { , title = {Measurement comparison of goniometric scatterometry and coherent Fourier scatterometry}, journal = {Proc SPIE}, year = {2015}, volume = {9132}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, CD, pitch, inverse diffraction problem}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brussels, Belgium}, event_name = {SPIE Optical Micro- and Nanometrology V}, event_date = {April 14, 2014}, language = {30}, DOI = {10.1117/12.2052819}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Endres, J. and Kumar, N. and Petrik, P. and Henn, M.-A. and Heidenreich, S. and Pereira, S. F. and Urbach, H. P. and Bodermann, B.} } @Proceedings { , title = {Development of a scatterometry reference standard}, journal = {Proc SPIE}, year = {2015}, volume = {9132}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, CD metrology, traceability, reference standard, tool matching, AFM, SEM, rigorous modelling}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brussels, Belgium}, event_name = {SPIE Optical Micro- and Nanometrology V}, event_date = {April 14, 2014}, language = {30}, DOI = {10.1117/12.2052278}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bodermann, B. and Loechel, B. and Scholze, F. and Dai, G. and Wernecke, J. and Endres, J. and Probst, J. and Schoengen, M. and Krumrey, M. and Hansen, P.-E. and Soltwisch, V.} } @Proceedings { , title = {Determination of line profiles on photomasks using DUV, EUV and X-ray scattering}, journal = {Proc SPIE}, year = {2015}, volume = {9231}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {scatterometry, GISAXS, EUV-scatterometry, line structure}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Dresden, Germany}, event_name = {30th European Mask and Lithography Conference}, event_date = {June 24, 2014}, language = {30}, DOI = {10.1117/12.2065941}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Scholze, F. and Bodermann, B. and Burger, S. and Endres, J. and Haase, A. and Krumrey, M. and Laubis, C. and Soltwisch, V. and Ullrich, A. and Wernecke, J.} } @Article { , title = {Fourier ellipsometry – an ellipsometric approach to Fourier scatterometry}, journal = {JEOS}, year = {2015}, volume = {10}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Optical metrology, ellipsometry, scatterometry, RCWA, Fourier scatterometry, sensitivity}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {1990-2573}, DOI = {10.2971/jeos.2015.15002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Petrik, P. and Kumar, N. and Fried, M. and Fodor, B. and Juhasz, G. and Pereira, S.E. and Burger, S. and Urbach, H. P.} } @Proceedings { , title = {hp-finite element method for simulating light scattering from complex 3D structures}, journal = {Proc SPIE}, year = {2015}, volume = {9424}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, optical metrology, computational metrology, computational lithography, 3D rigorous electromagnetic field simulations, finite-element methods, hp-FEM}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Jose, California, United States}, event_name = {Metrology, Inspection, and Process Control for Microlithography XXIX}, event_date = {February 22, 2015}, language = {30}, DOI = {10.1117/12.2085795}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Burger, S. and Zschiedrich, L. and Pomplun, J. and Herrmann, S. and Schmidt, F.} } @Proceedings { , title = {Advanced finite-element methods for design and analysis of nanooptical structures: Applications}, journal = {Proc SPIE}, year = {2015}, volume = {8642}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {3D electromagnetic field simulations, finite-element methods, Maxwell-solver, nanooptics, nanophotonics}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Francisco, California, USA}, event_name = {SPIE Emerging Liquid Crystal Technologies VIII}, event_date = {February 02, 2013}, language = {30}, ISBN = {9780819494115}, DOI = {10.1117/12.2001094}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Burger, S. and Zschiedrich, L. and Pomplun, J. and Blome, M. and Schmidt, F.} } @Article { , title = {Review of Devices, Packaging, and Materials for Cryogenic Optoelectronics}, journal = {Journal of Microelectronics and Electronic Packaging (2015) 12, 189-204 Copyright © International Microelectronics Assembly and Packaging Society ISSN: 1551-4897}, year = {2015}, volume = {Volume 12}, number = {, Issue 4}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {189-204}, keywords = {Packaging and interconnection, cryogenic operation, superconductive circuit, photodetector, photodiode, optical fiber, Josephson junction, single-quantum flux electronics}, web_url = {http://www.imapsource.org/doi/abs/10.4071/imaps.485}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {International Microelectronics Assembly and Packaging Society}, address = {Research Triangle Park}, language = {30}, ISSN = {1551-4897}, DOI = {10.4071/imaps.485}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bardalen, Eivind and Akram, Muhammed Nadeem and Malmbekk, Helge and Ohlckers, Per} } @Proceedings { , title = {Design and Analysis of a Verification Device for the Nonlinear Vector Network Analyzer}, journal = {Proceedings 85th ARFTG Conference}, year = {2015}, volume = {85}, number = {1}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Verification device, Network analyzer, NVNA, LSNA, Verification of calibration, Traceability}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7162895\&isnumber=7162886}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Phoenix, Arizona, USA}, event_name = {85th ARFTG Microwave Measurement Conference}, event_date = {22-05-2015}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, DOI = {10.1109/ARFTG.2015.7162895}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7162895\&isnumber=7162886}, author = {Rajabi, M. and Humphreys, D. A. and Nielsen, T. and Barmuta, P. and Schreurs, D.} } @Article { , title = {A coherent population trapping Cs vapor cell atomic clock based on push-pull optical pumping}, journal = {Journal of Applied Physics}, year = {2015}, volume = {118}, number = {--}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {124903}, keywords = {time and frequency, vapor cell clock, frequency stability, push-pull optical pumping, CPT}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP}, address = {-}, language = {30}, ISSN = {0021-8979}, DOI = {10.1063/1.4931768}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hafiz, M A and Boudot, R} } @Proceedings { , title = {Factors that affect the sound power emitted by reference sound sources}, journal = {Fortschritte der Akustik : DAGA 2015}, year = {2015}, volume = {41. Jahrestagung f{\"u}r Akustik ; Tagungsband (2015)}, number = {2015}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, pages = {3}, keywords = {Directivity measurements, Influential parameters, Factors that affect the sound power emitted by reference sound sources}, web_url = {http://daga2015.de/de/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {N{\"u}rnberg}, event_place = {N{\"u}rnberg}, event_name = {DAGA 2015}, event_date = {16.-19.03.2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brezas, S. and Wittstock, V.} } @Article { , title = {TestDose: a nuclear medicine software based on Monte-Carlo modelling for generating gamma camera acquisitions and dosimetry}, journal = {Medical Physics}, year = {2015}, volume = {42}, number = {12}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {6885-6894}, keywords = {nuclear medicine, GATE, Monte Carlo simulations, SPECT, dosimetry}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {American Association of Physicists in Medicine}, address = {Alexandria}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4934828}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Garcia, MP and Villoing, D and McKay, E and Ferrer, L and Cremonesi, M and Botta, F and Ferrari, M and Bardi{\`e}s, M} } @Article { , title = {Model-based versus specific dosimetry in diagnostic context: Comparison of three dosimetric approaches}, journal = {Medical Physics}, year = {2015}, volume = {42}, number = {3}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {1288-1296}, keywords = {radiopharmaceutical dosimetry, Monte Carlo modeling, GATE, OLINDA/EXM, STRATOS}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {American Association of Physicists in Medicine}, address = {Alexandria}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4907957}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Marcatili, S and Villoing, D and Mauxion, T and McParland, BJ and Bardi{\`e}s, M} } @Article { , title = {Experimental Plane Wave and Random Field Coupling to Uniform and Non-uniform Transmission Lines}, journal = {Proceedings of the 2015 IEEE International Symposium on EMC (EMC Europe), Dresden, 2015}, year = {2015}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {767 - 772}, keywords = {NUTL, coupling into cables, GTEM, reverberation chamber}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7256260}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {2158-110X}, DOI = {10.1109/ISEMC.2015.7256260}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogt-Ardatjew, R.A. and Leferink, F.B.J. and Buesink, Frits} } @Article { , title = {Quantification of Minimal Needed Cable Terminations}, journal = {Proceedings of the 2015 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Taipei, Taiwan}, year = {2015}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {470-473}, keywords = {Current Boundary, Zoning, Regions, Cable shield termination Cable transit}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7175236}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {2162-7673}, DOI = {10.1109/APEMC.2015.7175236}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {van Leersum, B.J.A.M. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Protection Against Common Mode Currents on Exposed Cables}, journal = {Proceedings of the 2015 IEEE International Symposium on EMC (EMC Europe), Dresden, 2015}, year = {2015}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1478 - 1483}, keywords = {system level EMC; exposed cables; HIRF; naval ship;}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7256392}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {2158-110X}, DOI = {10.1109/ISEMC.2015.7256392}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {van Leersum, B.J.A.M. and van der Ven, C.C.J. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Primary standardization of SIR-Spheres based on the dissolution of the 90Y-labelled resin microspheres}, journal = {Applied Radiation and Isotopes}, year = {2015}, volume = {97}, number = {-}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {170 176}, keywords = {Radionuclide metrology, SIR-Spheres standardization, 90Y-labelled resin microspheres, Dissolution of ion exchange resin, TDCR method, Calibration factors of ionization chambers}, web_url = {-}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0969 8043}, DOI = {10.1016/j.apradiso.2014.12.024}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S0969804314004515}, author = {Louren\c{c}o, VL and Bobin, CB and Chist{\'e}, VC and Lacour, DL and Rigoulay, FR and Tapner, MT and Thiam, CT and Ferreux, LF} } @Article { , title = {Arctic metrology: calibration of radiosondes ground check sensors in Ny-{\AA}lesund}, journal = {METEOROLOGICAL APPLICATIONS}, year = {2015}, volume = {22}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {854 - 860}, keywords = {atmospheric sensors calibration; GRUAN; MeteoMet; metrology; Ny-{\AA}lesund; radiosondes}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/met.1506/abstract}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Royal Meteorological Society}, address = {Reading}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1506}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Musacchio, C and Bellagarda, S and Maturilli, M and Graeser, J and Vitale, V and Merlone, A} } @Article { , title = {A calibration facility for automatic weather stations}, journal = {METEOROLOGICAL APPLICATIONS}, year = {2015}, volume = {22}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {842 - 846}, keywords = {automatic weather station calibration; calibration chamber; pressure; simultaneous calibration of pressure and temperature;temperature;thermometercalibrationinair;traceabilityformeteorologicalobservations;uncertainty}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/met.1514/abstract}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Royal Meteorological Society}, address = {Reading}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1514}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopardo, G and Bellagarda, S and Bertiglia, F and Merlone, A and Roggero, G and Jandric, N} } @Proceedings { , title = {Surface Finish and 3D Optical Scanner Measurement Performance for Precision Engineering}, journal = {Proceedings of the 30th ASPE Annual Meeting}, year = {2015}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, keywords = {3D scanning, laser line scanners, articulating arms, usage effects}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {American Society for Precision Engineering}, address = {Raleigh}, event_place = {Austin, Texas, USA}, event_name = {30th ASPE Annual Meeting}, event_date = {01-11-2015 to 06-11-2015}, language = {30}, ISBN = {978-1-887706-69-8}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Woodward, S and Dury, M and Brown, S and McCarthy, M} } @Article { SiegenthalerB2015, title = {The calibration of static and dynamic performances of PMUs}, journal = {17th International Congress of Metrology}, year = {2015}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, keywords = {calibration, PMU performance, static, dynamic}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {EDP Sciences}, language = {30}, DOI = {10.1051/metrology/20150012002}, stag_bib_extends_levelofaccess = {NA}, author = {Siegenthaler, S. and Braun, J.P.} } @Article { , title = {Two-way optical frequency comparisons at 5x10-21 relative stability over 100-km telecommunication network fibers}, journal = {PHYSICAL REVIEW A}, year = {2014}, month = {12}, day = {22}, volume = {90}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1103/PhysRevA.90.061802}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bercy, A. and Stefani, F. and Lopez, O. and Chardonnet, C. and Pottie, P.-E. and Amy-Klein, A.} } @Article { PolyakovGMKPBDRG2014_2, title = {Reconstruction of mode structure of faint light sources and its applications}, journal = {Physica Scripta}, year = {2014}, month = {12}, day = {19}, volume = {2014}, number = {T163}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, keywords = {photon-number statistics, photon-number resolving detection, hight-order correlation function, mode reconstruction}, web_url = {http://iopscience.iop.org/1402-4896/}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, ISSN = {0031-8949}, DOI = {10.1088/0031-8949/2014/T163/014024}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Polyakov, S. V. and Goldschmidt, E. A. and Migdall, A. and K{\"u}ck, S. and Piacentini, F. and Brida, G. and Degiovanni, I. P. and Ruo Berchera, I. and Genovese, M.} } @Article { BaerSPSO2014, title = {Calibration of a non-null test interferometer for the measurement of aspheres and free-form surfaces}, journal = {Optics Express}, year = {2014}, month = {12}, day = {15}, volume = {22}, number = {25}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {31200-31211}, keywords = {Interferometry, Non-Null-Test, Asphere, Freeform}, web_url = {http://www.opticsinfobase.org/oe/abstract.cfm?uri=oe-22-25-31200}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1364/OE.22.031200}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Baer, Goran and Schindler, Johannes and Pruss, Christof and Siepmann, Jens and Osten, Wolfgang} } @Article { , title = {Single-photon emitters based on NIR color centers in diamond coupled with solid immersion lenses}, journal = {International Journal of Quantum Information}, year = {2014}, month = {12}, day = {10}, volume = {12}, number = {07n08}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {1560011}, keywords = {Diamond; single-photon emitters; color centers.}, web_url = {http://www.worldscientific.com/worldscinet/ijqi}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {worldscientific}, address = {Singapore}, language = {30}, ISSN = {0219-7499}, DOI = {10.1142/S0219749915600114}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gatto Monticone, D. and Forneris, J. and Levi, M. and Picollo, F. and Olivero, P. and Traina, P. and E. Moreva, E. and Enrico, E. and Brida, G. and Degiovanni, I. P. and Genovese, M. and Amato, G. and Boarino, L.} } @Article { , title = {Micro-flow facility for traceability in steady and pulsating flow}, journal = {Flow measurement and instrumentation}, year = {2014}, month = {12}, day = {8}, volume = {44}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {34-42}, keywords = {Micro-flow, Liquid, Dynamic, gravimetric, calibration, Pulsating flow}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1016/j.flowmeasinst.2014.11.008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bissig, H. and Tschannen, M. and Huu, M. de} } @Article { , title = {High-accuracy coherent optical frequency transfer over a doubled 642-km fiber link}, journal = {Applied Physics B}, year = {2014}, month = {12}, volume = {117}, number = {3}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {979 - 986}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1007/s00340-014-5917-8}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Calonico, D. and Bertacco, E. K. and Calosso, C. E. and Clivati, C. and Costanzo, G. A. and Frittelli, M. and Godone, A. and Mura, A. and Poli, N. and Sutyrin, D. V. and Tino, G. and Zucco, M. E. and Levi, F.} } @Article { VanermenGPSLGPFEBE2014, title = {Novel concepts for preparation of reference materials as whole water samples for priority substances at nanogram-per-liter level using model suspended particulate matter and humic acids}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, month = {12}, volume = {407}, number = {11}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {3055-3067}, keywords = {Slurry, PBDE, PAH, TBT, Reference materials, Suspended particulate matter, Whole water, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-014-8349-8}, stag_bib_extends_levelofaccess = {NA}, author = {Vanermen, G. and Goenaga-Infante, H. and Petrov, P. and Swart, C. and Lal{\`e}re, B. and Gantois, F. and Philipp, R. and Fettig, I. and Elordui-Zapatarietxe, S. and Boom, G. and Emteborg, H.} } @Article { , title = {Proposed Process for Estimating Definitive Temperatures of High-Temperature Fixed Points}, journal = {Int J Thermophys}, year = {2014}, month = {11}, day = {30}, volume = {36}, number = {2-3}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {347-366}, keywords = {Eutectics · Filter radiometry · High-temperatures fixed points (HTFPs) · Thermodynamic temperature}, web_url = {http://link.springer.com/article/10.1007\%2Fs10765-014-1800-4}, web_url2 = {http://www.npl.co.uk/content/ConPublication/6571}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Int J Thermophys}, address = {Europe/Asia/Africa}, language = {30}, DOI = {10.1007/s10765-014-1800-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {NPL Doc. Ref: PDB: 7492 | DDB: 5944}, author = {Wooliams, E.R and Bloembergen, P and Machin, G} } @Article { , title = {Optical characterisation of patterned thin films}, journal = {Thin Solid Films}, year = {2014}, month = {11}, day = {28}, volume = {571}, number = {3}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {601-604}, keywords = {Spectroscopic imaging and mapping ellipsometry, Inhomogeneous and patterned thin films, SiO2, Photoresist}, web_url = {http://www.sciencedirect.com/science/article/pii/S0040609013019056}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, language = {30}, ISSN = {0040-6090}, DOI = {10.1016/j.tsf.2013.11.052}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rosu, DR and Petrik, PP and Rattmann, GR and Schellenberger, MS and Beck, UB and Hertwig, AH} } @Article { GilabertBLMRCMB2014, title = {Traceability of Ground-Based Air-Temperature Measurements: A Case Study on the Meteorological Observatory of Moncalieri (Italy)}, journal = {International Journal of Thermophysics}, year = {2014}, month = {11}, day = {28}, volume = {36}, number = {2-3}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {589-601}, keywords = {Air temperature, Calibration facility, Calibration uncertainty, Climate, change analysis, Historical temperature data series, Metrology for meteorology and climate, Traceability}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-014-1806-y}, stag_bib_extends_levelofaccess = {NA}, author = {Gilabert, A. and Bertiglia, F. and Lopardo, G. and Merlone, A. and Roggero, G. and Cat Berro, D. and Mercalli, L. and Brunet, M.} } @Article { RastelloDSKCPSMIKSHKTBMPTACMKV2014, title = {Metrology for industrial quantum communications: the MIQC project}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {10}, keywords = {Metrology, quantum cryptography, quantum communication}, web_url = {http://iopscience.iop.org/0026-1394/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S267}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rastello, M L and Degiovanni, I P and Sinclair, A G and K{\"u}ck, S and Chunnilall, C J and Porrovecchio, G and Smid, M and Manoocheri, F and Ikonen, E and Kubarsepp, T and Stucki, D and Hong, K S and Kim, S K and Tosi, A and Brida, G and Meda, A and Piacentini, F and Traina, P and Al Natsheh, A and Cheung, J Y and M{\"u}ller, I and Klein, R and Vaigu, A} } @Article { , title = {Phytos: a portable goniometer for in situ spectro-directional measurements of leaves}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {S309-S313}, keywords = {vegetation, BRF-measurement, spectrogoniometer}, web_url = {http://iopscience.iop.org/0026-1394/51/6/S309}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S309''}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lolli, LL and Pisani, MP and Rajteri, MR and Widlowski, JLW and Bialek, AB and Greenwell, CG and Fox, NF} } @Article { , title = {Design and Fabrication of Coupled NanoSQUIDs and NEMS}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2014}, month = {11}, day = {20}, volume = {25}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1602604}, keywords = {SQUIDs, nanoscale Dayem bridges, nanoSUQID, metrology}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6960081\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fxpls\%2Fabs_all.jsp\%3Farnumber\%3D6960081}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2371696}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bechstein, S and Ruede, F and Drung, D and Storm, J.-H. and K{\"o}hn, C and Kieler, O. F. and Kohlmann, J. and Weimann, T. and Patel, T and Li, B and Cox, D and Gallop, J. C. and Hao, L. and Schurig, T} } @Article { SchneidmillerBCTSSZRYSBY2014, title = {Time-dependent wave front propagation simulation of a hard x-ray split-and-delay unit: Towards a measurement of the temporal coherence properties of x-ray free electron lasers}, journal = {Physical Review Special Topics - Accelerators and Beams}, year = {2014}, month = {11}, day = {18}, volume = {17}, number = {11}, number2 = {SIB58: Angles: Angle metrology}, keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {1098-4402}, DOI = {10.1103/PhysRevSTAB.17.110705}, stag_bib_extends_levelofaccess = {NA}, author = {Schneidmiller, E. and Buzmakov, A. and Chubar, O. and Tschentscher, Th. and Sinn, H. and Samoylova, L. and Zacharias, H. and Roling, S. and Yurkov, M. V. and Siewert, F. and Braun, S. and Yandayan, T.} } @Proceedings { VolkelBBW2014, title = {First results in the realization of the unit Watt in airborne sound}, year = {2014}, month = {11}, day = {16}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound Power, Metrology, Traceability}, web_url = {http://www.acoustics.asn.au/conference_proceedings/INTERNOISE2014/papers/p357.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Melbourne, Australia}, event_name = {Internoise - 43rd International Congress on Noise Control Engineering}, event_date = {16 to 19 November 2014}, language = {English}, ISSN = {978-0-909882-02-0}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {V{\"o}lkel, K and Bethke, C and Brezas, S and Wittstock, V} } @Thesis { , title = {Nanodosimetric particle track simulations in water and DNA media}, year = {2014}, month = {11}, day = {13}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {DNA, water, cross sections, electron impact, electron cross sections, purine, pyrimidine, tetrahydrofuran, trimethylphosphate, PTra, track structure simulations, benchmark, nanodosimetry, propane, nitrogen}, web_url = {http://ro.uow.edu.au/theses/4150}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, school = {University of Wollongong, Wollongong, NSW, Australia}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bug, M.} } @Article { GiordanoZBCB2014, title = {Experimental Validation of MRI Dosimetric Simulations in Phantoms Including Metallic Objects}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2014}, month = {11}, day = {11}, volume = {50}, number = {11}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {Boundary element methods (BEM), electromagnetic (EM) fields, electromagnetic measurements, finite element methods (FEM), magnetic resonance imaging (MRI)}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2323428}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Giordano, Domenico and Zilberti, Luca and Borser, Michele and Chiampi, Mario and Bottauscio, Oriano} } @Proceedings { MuhligSLJSB2014, title = {Tilted Wave Interferometer - Improved Measurement Uncertainty}, journal = {Proceedings of 58th Ilmenau Scientific Colloqium}, year = {2014}, month = {11}, day = {11}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {Twyman-Green Interferometer, Asphere and freeform measurement, Interfrometer calibration, Virtual experiments}, web_url = {http://www.db-thueringen.de/servlets/DocumentServlet?id=24989}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Technische Universit{\"a}t Ilmenau, Ilmenau, Germany}, event_name = {58th Ilmenau Scientific Colloquium}, event_date = {08 - 12 Sep. 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}hlig, S. and Siepmann, J. and Lotz, M. and Jung, S. and Schindler, J. and Baer, G.} } @Proceedings { LotzSMJB2014, title = {TILTED WAVE INTERFEROMETER – DESIGN AND TEST}, journal = {Proceedings of 58th Ilmenau Scientific Colloqium}, year = {2014}, month = {11}, day = {11}, volume = {58}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {Tilted Wave Interferometer, Asphere and freeform measurement, Design}, web_url = {http://www.db-thueringen.de/servlets/DerivateServlet/Derivate-30704/ilm1-2014iwk-117.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Technische Universit{\"a}t Ilmenau, Ilmenau, Germany}, event_name = {58th ILMENAU SCIENTIFIC COLLOQUIUM}, event_date = {8.-12. September 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lotz, M. and Siepmann, J. and M{\"u}hlig, S. and Jung, S. and Baer, G.} } @Article { BeqiriWHM2014, title = {Comparison between simulated decoupling regimes for specific absorption rate prediction in parallel transmit MRI}, journal = {Magnetic Resonance in Medicine}, year = {2014}, month = {11}, day = {4}, volume = {Early View}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {SAR; modeling; parallel transmission}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {1522-2594}, DOI = {10.1002/mrm.25504}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Beqiri, Arian and W. Hand, Jeffrey and Hajnal, Joseph V. and Malik, Shaihan J.} } @Article { , title = {Towards a 1 V Josephson Arbitrary Waveform Synthesizer}, journal = {IEEE TRANSACTIONS ON APPLIED SUPERCONDUCTIVITY}, year = {2014}, month = {11}, day = {3}, volume = {25}, number = {3}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {5}, keywords = {AC Josephson voltage standard, Josephson arbitrary waveform synthesizer, SNS junction, sigma-delta modulation}, web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6945363\&tag=1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2366916}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {14818378}, author = {Kieler, O.F. and Behr, R. and Wendisch, R. and Palafox, L. and Kohlmann, J.} } @Article { MariBPZ2014, title = {Dynamic vacuum measurement by an optical interferometric technique}, journal = {Measurement Science and Technology}, year = {2014}, month = {11}, volume = {25 (Dec 2014).}, number = {12}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {dynamic vacuum standard, laser interferometry, nanometrology, vacuum gauge}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1088/0957-0233/25/12/125303}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Mari, Domenico and Bergoglio, Mercede and Pisani, Marco and Zucco, Massimo} } @Article { ZilbertiBCHLC2014, title = {Collateral Thermal Effect of MRI-LINAC Gradient Coils on Metallic Hip Prostheses}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2014}, month = {11}, volume = {50}, number = {11}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {Dosimetry, finite element–boundary element method, magnetic resonance imaging (MRI), medical implants, Pennes’ bioheat equation.}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2323119}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zilberti, Luca and Bottauscio, Oriano and Chiampi, Mario and Hand, Jeff and Lopez, Hector Sanchez and Crozier, Stuart} } @Article { , title = {Frequency ratio of two optical clock transitions in 171Yb+ and constraints on the time-variation of fundamental constants}, journal = {Physical Review Letters}, year = {2014}, month = {11}, volume = {113}, number = {21}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, keywords = {Optical frequency metrology, fundamental constants}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.113.210801}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Godun, R. M. and Nisbet-Jones, P. B. R. and Jones, J. M. and King, S. A. and Johnson, L. A. M. and Margolis, H. S. and Szymaniec, K. and Lea, S. N. and Bong, K. and Gill, P.} } @Article { RoggeroBCVVM2014, title = {QA/QC Procedures for in-Situ Calibration of a High Altitude Automatic Weather Station: The Case Study of the AWS Pyramid, 5050 m asl, Khumbu Valley, Nepal}, journal = {Atmospheric and Climate Sciences}, year = {2014}, month = {11}, volume = {04}, number = {05}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {796-802}, keywords = {Automatic Weather Station, Himalaya, Climate Monitoring, AWSs Calibration, QA/QC Procedure}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Scientific Research Publishing Inc}, language = {30}, ISSN = {2160-0414, 2160-0422}, DOI = {10.4236/acs.2014.45070}, stag_bib_extends_levelofaccess = {NA}, author = {Roggero, G. and Bonasoni, P. and Cristofanelli, P. and Verza, G.P and Vuillermoz, E. and Merlone, A.} } @Article { TesaovaBGWERCTSJNMMN2014, title = {Comparison of micromagnetic parameters of the ferromagnetic semiconductors (Ga,Mn)(As,P) and (Ga,Mn)As}, journal = {Physical Review B}, year = {2014}, month = {10}, day = {23}, volume = {90}, number = {15}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, keywords = {Comparison of micromagnetic parameters of the ferromagnetic semiconductors (Ga,Mn)(As,P) and (Ga,Mn)As}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society (APS)}, address = {1 Research Rd, Ridge, NY 11961, USA}, language = {30}, ISSN = {1098-0121, 1550-235X}, DOI = {10.1103/PhysRevB.90.155203}, stag_bib_extends_levelofaccess = {NA}, author = {Tesařov{\'a}, N. and Butkovičov{\'a}, D. and Gallagher, B. L. and Wadley, P. and Edmonds, K. W. and Rushforth, A. W. and Campion, R. P. and Troj{\'a}nek, F. and Schmoranzerov{\'a}, E. and Jungwirth, T. and Nov{\'a}k, V. and Motloch, P. and Mal{\'y}, P. and Němec, P.} } @Proceedings { NwabohBWSWE2014, title = {Spectral reference line data relevant to remote sensing applications: a review and outline of the EUMETRISPEC project}, journal = {Remote Sensing of Clouds and the Atmosphere XIX; and Optics in Atmospheric Propagation and Adaptive Systems XVII}, year = {2014}, month = {10}, day = {17}, volume = {9242}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {92420D-1 92420D-14}, keywords = {spectral line parameters, infrared spectroscopy, Fourier transform spectroscopy, TDLAS, gas metrology}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {SPIE Digital Library}, address = {Bellingham}, event_place = {Amsterdam}, event_name = {Remote Sensing of Clouds and the Atmosphere XIX}, event_date = {22-09-2014 to 25-09-2014}, language = {30}, DOI = {10.1117/12.2067358}, stag_bib_extends_levelofaccess = {NA}, author = {Nwaboh, J. and Brunzendorf, J. and Werhahn, O. and Serdyukov, A. and Werwein, V. and Ebert, V.} } @Article { , title = {Novel and improved techniques for traceable temperature dissemination}, journal = {High Temperatures-High Pressures,}, year = {2014}, month = {10}, day = {13}, volume = {43}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {1-11}, keywords = {Temperature, thermometer, ITS-90, traceability, fixed points, standard platinum resistance thermometer, radiation thermometer, thermocouple}, web_url = {http://www.oldcitypublishing.com/HTHP/HTHPcontents/HTHP43.1contents.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0018-1544}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {del Campo, Dolores and Bojkovski, Jovan and Dobre, Miruna and Filipe, Eduarda and Kalemci, Murat and Merlone, Andrea and Pearce, Jonathan and Peruzzi, Andrea and Sparasci, Fernando and Strnad, Radek and Taubert, Dietert and Turz{\'o}-Andr{\'a}s, Emese} } @Article { KramerMMKHB2014, title = {Experimental Verification of the Individual Energy Dependencies of the PartialL-Shell Photoionization Cross Sections of Pd and Mo}, journal = {Physical Review Letters}, year = {2014}, month = {10}, day = {13}, volume = {113}, number = {16}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, keywords = {Individual Energy Dependencies of the PartialL-Shell Photoionization Cross Sections Pd Mo}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.113.163001}, stag_bib_extends_levelofaccess = {NA}, author = {Kr{\"a}mer, M. and Mantler, M. and Muller, M. and Kolbe, M. and Honicke, P. and Beckhoff, B.} } @Article { , title = {Multimodal optical characterisation of collagen photodegradation by femtosecond infrared laser ablation†}, journal = {Analyst}, year = {2014}, month = {10}, day = {9}, volume = {Analyst 2014}, number = {139}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {6135-6143}, keywords = {N/A}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/25318007}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Royal Society of Chemistry}, address = {Picadilly UK}, language = {30}, ISSN = {0003-2654}, DOI = {10.1039/c4an01523a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Manickavasagam, M. and Hirvonen, L.M. and Melita, L.N. and Chong, E.Z. and Cook, R.J. and Bozec, L. and Festy, F.} } @Article { , title = {Trends in single-cell analysis by use of ICP-MS}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, month = {10}, day = {1}, volume = {406 / 2014}, number = {27}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {6963–6977}, keywords = {Bioanalytical methodsCell systems/single cell analysisMass spectrometry/ICP-MS}, web_url = {http://link.springer.com/article/10.1007/s00216-014-8143-7}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer Berlin}, address = {Heidelberg}, language = {30}, ISSN = {1618-2642 (print); 1618-2650 (online)}, DOI = {10.1007/s00216-014-8143-7}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mueller, Larissa and Traub, Heike and Jakubowski, Norbert and Drescher, Daniela and Baranov, Vladimir I. and Kneipp, Janina} } @Proceedings { IvanovBDHATMS2014, title = {Experimental and numerical study of the microwave field distribution in a compact magnetron-type microwave cavity}, year = {2014}, month = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {208-211}, keywords = {atomic clock, microwave cavity, field imaging, optical pumping.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Neuchatel, Switzerland}, event_name = {28th European Frequency and Time Forum (EFTF)}, event_date = {22-26 June 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ivanov, A. and Bandi, T. and Du, G.-X. and Horsley, A. and Affolderbach, C. and Treutlein, P. and Mileti, G. and Skrivervik, A. K.} } @Article { , title = {Heterodyne multi-wavelength absolute interferometry based on a cavity-enhanced electro-optic frequency comb pair}, journal = {Optics Letters}, year = {2014}, month = {10}, volume = {39}, number = {20}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {5834-5837}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1364/OL.39.005834}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yang, R. and Pollinger, F. and Meiners-Hagen, K. and Tan, J. and Bosse, H.} } @Article { GattoMonticoneKTMFRODBG2014, title = {Beating the diffraction Abbe limit in confocal microscopy via nonclassical photon statistics}, journal = {Physical Review Letters}, year = {2014}, month = {9}, day = {30}, volume = {113}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {143602 [1 to 5]}, web_url = {http://journals.aps.org/prl/}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.113.143602}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gatto Monticone, D and Katamadze, K and Traina, P and Moreva, E and Forneris, J and Ruo-Berchera, I and Olivero, P and Degiovanni, I. P and Brida, G and Genovese, M} } @Article { , title = {Future development of biologically relevant dosimetry}, journal = {British Journal of Radiology}, year = {2014}, month = {9}, day = {26}, volume = {88}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Radiation quantities, biologically relevant dosimetry, microbeam, nanodosimetry, microdosimetry, reactive species, BioQuaRT}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0007-1285}, DOI = {10.1259/bjr.20140392}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Palmans, H. and Rabus, H. and Belchior, A. L. and Bug, M. U. and Galer, S. and Giesen, U. and Gonon, G. and Gruel, G. and Hilgers, G. and Moro, D. and Nettelbeck, H. and Pinto, M. and Pola, A. and Pszona, S. and Schettino, G. and Sharpe, P. H. G. and Teles, P. and Villagrasa, C. and Wilkens, J. J.} } @Article { ChuBCGHSG2014, title = {Experimental realization of an optical antenna designed for collecting 99\% of photons}, journal = {Optica}, year = {2014}, month = {9}, day = {25}, volume = {1}, number = {4}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {203-208}, web_url = {http://www.opticsinfobase.org/optica/home.cfm}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.1.000203}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Chu, X.-L. and Brenner, T. J. K. and Chen, X.-W. and Ghosh, Y. and Hollingsworth, J. A. and Sandoghdar, V. and G{\"o}tzinger, S.} } @Article { , title = {ZnO Nanorod Surface Modification With PDDA/PSS Bi-Layer Assembly For Performance Improvement Of ZnO Piezoelectric Energy Harvesting Devices}, journal = {Journal of Sol-Gel Science and Technology}, year = {2014}, month = {9}, day = {23}, volume = {73}, number = {3}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {544-549}, keywords = {Nanogerator, p–n junction, ZnO nanorods, Piezoelectric, Energy harvesting, Surface passivation}, web_url = {http://link.springer.com/article/10.1007\%2Fs10971-014-3512-4}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Springer US}, language = {30}, ISSN = {0928-0707}, DOI = {10.1007/s10971-014-3512-4}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Jalali, NJ and Briscoe, JB and Zhi Tan, YZT and Woolliams, PW and Stewart, MS and Weaver, PMW and Cain, MGC and Dunn, SD} } @Article { LafontRHCDCRBDSP2014, title = {Anomalous dissipation mechanism and Hall quantization limit in polycrystalline graphene grown by chemical vapor deposition}, journal = {Physical Review B}, year = {2014}, month = {9}, day = {18}, volume = {Phys. Rev. B 90, 115422}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1103/PhysRevB.90.115422}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lafont, F. and Ribeiro-Palau, R. and Han, Z. and Cresti, A. and Delvall{\'e}e, A. and Cummings, A. W. and Roche, S. and Bouchiat, V. and Ducourtieux, S. and Schopfer, F. and Poirier, W.} } @Article { LerardiBPFVJ2014, title = {Nano-holes as standard leak elements}, journal = {Measurement}, year = {2014}, month = {9}, day = {16}, volume = {58}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {Focused ion beam,Nanotechnology, SEM, STEM, AFM, Standard leak, Gas flow meter, Vacuum Metrology, DSMC.}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1016/j.measurement.2014.09.017}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lerardi, V. and Becker, U. and Pantazis, S. and Firpo, G. and Valbusa, U. and Jousten, K.} } @Article { , title = {Numerical Modelling of Thermal Effects in Fixed-Point Cells}, journal = {International Journal of Thermophysics}, year = {2014}, month = {9}, day = {13}, volume = {35}, number = {6-7}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {1156-1168}, keywords = {fixed-point cell, numerical modelling, radiative heat transfer, sandblasting}, web_url = {http://link.springer.com/article/10.1007/s10765-014-1733-y}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {New York}, language = {30}, ISSN = {1572-9567}, DOI = {10.1007/s10765-014-1733-y}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Batagelj, V. and Bojkovski, J. and Žužek, V. and Drnovšek, J.} } @Article { , title = {Absolute calibration of a charge-coupled device camera with twin beams}, journal = {Applied Physics Letters}, year = {2014}, month = {9}, day = {12}, volume = {105}, number = {10}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {101113}, keywords = {Charge-Coupled Device (CCD), calibration, mesoscopic regime, spontaneous parametric down conversion}, web_url = {http://scitation.aip.org/content/aip/journal/apl}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP}, address = {New York}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4895665}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Meda, A. and Ruo-Berchera, I. and Degiovanni, I.P. and Brida, G. and Rastello, M.L. and Genovese, M.} } @Article { , title = {D{\'e}termination de l'acc{\'e}l{\'e}ration de la pesanteur pour la balance du watt du LNE}, journal = {Revue Fran\c{c}aise de M{\'e}trologie}, year = {2014}, month = {9}, day = {1}, volume = {36}, number = {2014-04}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {11}, keywords = {GRAVIM{\'E}TRIE, CARTOGRAPHIE GRAVIM{\'E}TRIQUE, MOD{\'E}LISATION GRAVIM{\'E}TRIQUE, INTERF{\'E}ROM{\'E}TRIE ATOMIQUE, BALANCE DU WATT}, web_url = {http://www.metrologie-francaise.fr/fr/publications/RFM/2014/rfm1413.asp}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {LNE}, address = {Paris}, language = {37}, ISSN = {1772-1792}, DOI = {10.1051/rfm/2014013}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Merlet, S{\'e}bastien and Gillot, Pierre and Farah, Tristan and Bodart, Quentin and Le Gouet, Julien and Cheinet, Patrick and Guerlin, Christine and Louchet-Chauvet, Anne and Malossi, Nicola and Kopaev, Alexander and Francis, Olivier and d'Agostino, Giancarlo and Diament, Michel and Genev{\`e}s, G{\'e}rard and Clairon, Andr{\'e} and Landragin, Arnaud and Pereira dos Santos, Franck} } @Proceedings { BrezasW2014, title = {Detailed study towards the dissemination of the unit watt in airborne sound}, year = {2014}, month = {9}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {dissemination, sound power, bandwidth, temperature}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Krakow}, event_name = {Forum Acustikum}, event_date = {September 2014}, language = {English}, ISSN = {2221 - 3767}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Brezas, S. and Wittstock, V.} } @Article { WeberSHBDEHLMMS2014, title = {Performance of a Wideband 200-kV HVDC Reference Divider Module}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2014}, month = {9}, volume = {63}, number = {9}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {2264-2270}, keywords = {Resistors, Voltage measurement, Capacitors, HVDC transmission, Uncertainty, Temperature measurement, Wideband}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2014.2304857}, stag_bib_extends_levelofaccess = {NA}, author = {Weber, C. and Suomalainen, E.P. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Dedeoğlu, S. and Elg, A.P. and Houtzager, E. and Lucas, W. and Merev, A. and Meisner, J. and Schmidt, M.} } @Article { FalkenbergSZBSS2014, title = {On the characterization of ultra-precise X-ray optical components: advances and challenges inex situmetrology}, journal = {Journal of Synchrotron Radiation}, year = {2014}, month = {8}, day = {27}, volume = {21}, number = {5}, number2 = {SIB58: Angles: Angle metrology}, pages = {968-975}, keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {International Union of Crystallography (IUCr)}, language = {30}, ISSN = {1600-5775}, DOI = {10.1107/S1600577514016221}, stag_bib_extends_levelofaccess = {NA}, author = {Falkenberg, G. and St{\"o}rmer, M. and Zeschke, T. and Buchheim, J. and Siewert, F. and Sankari, R.} } @Proceedings { , title = {Set-up of a THz Time Domain Spectrometer at INRIM}, journal = {Proceedings of 29-th Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2014}, month = {8}, day = {24}, volume = {29}, number = {1}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {188-189}, keywords = {Terahertz, Time Domain Spectroscopy, Time domain analysis, Spectroscopy, Terahertz measurements}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898322}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {Piscataway}, event_place = {Rio de Janeiro, Brazil}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29/08/2014}, language = {30}, ISBN = {978-1-4799-5205-2}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898322}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Oberto, L. and Bisi, M. and Jahn, D. and Lippert, S. and Brunetti, L.} } @Proceedings { , title = {Smart Grid Metrology to Support Reliable Electricity Supply}, journal = {n/a}, year = {2014}, month = {8}, day = {24}, volume = {n/a}, number = {n/a}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {680 – 681}, keywords = {smart grid, metrology, synchrophasor, revenue metering, power quality, grid modelling, electrical grids}, web_url = {http://ieeexplore.ieee.org/application/enterprise/entconfirmation.jsp?arnumber=6898568\&icp=false}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {n/a}, address = {n/a}, event_place = {Rio de Janeiro, Brasil}, event_name = {CPEM Conference on precision and electromagnetic measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-5205-2}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898568}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rietveld, Gert and Braun, Jean-Pierre and Wright, Paul and Clarkson, Paul and Zisky, Norbert} } @Article { BodnarE2014, title = {On the adjustment of inconsistent data using the Birge ratio}, journal = {Metrologia}, year = {2014}, month = {8}, day = {19}, volume = {51}, number = {5}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {516-521}, keywords = {Birge ratio, modified Birge adjustment, Bayesian inference, general location-scale model}, tags = {MAT}, web_url = {http://iopscience.iop.org/0026-1394/51/5/516/pdf/0026-1394_51_5_516.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {1}, ISSN = {Online ISSN: 1681-7575; Print ISSN: 0026-1394}, DOI = {10.1088/0026-1394/51/5/516}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bodnar, Olha and Elster, Clemens} } @Article { , title = {Construction and in-situ characterisation of high-temperature fixed point cells devoted to industrial applications.}, journal = {16th International Congress of Metrology}, year = {2014}, month = {8}, day = {19}, volume = {77}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {00018}, web_url = {http://www.epj-conferences.org/articles/epjconf/abs/2014/14/epjconf_icm2014_00018/epjconf_icm2014_00018.html}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {EDP Sciences}, address = {Les Ulis}, language = {30}, ISSN = {2100-014X}, DOI = {10.1051/epjconf/20147700018}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31}, author = {Sadli, M and Bourson, F and Diril, A and Journeau, C and Lowe, D and Parga, C} } @Article { , title = {Tuning carrier density across Dirac point in epitaxial graphene on SiC by corona discharge.}, journal = {Applied Physics Letters}, year = {2014}, month = {8}, day = {12}, volume = {105}, number = {6}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {063106}, ke