This file was created by the TYPO3 extension bib --- Timezone: CEST Creation date: 2022-08-19 Creation time: 09-49-26 --- Number of references 1573 article BatistaSAAM2022 2840 Application of the front tracking method in micro flow measuring devices Measurement: Sensors 2022 10 23 18HLT08: MEDDII: Metrology for drug delivery 100397 Microflow measurement, Front tracking, Calibration, Measurement uncertainty https://www.sciencedirect.com/science/article/pii/S2665917422000319?via%3Dihub EMPIR 2018: Health Elsevier BV 30 2665-9174 10.1016/j.measen.2022.100397 NA E.Batista J.A.Sousa M.Alvares J.Afonso R.F.Martins article BourgouinKSHKHSSKR2022 2833 The probe‐format graphite calorimeter, Aerrow, for absolute dosimetry in ultrahigh pulse dose rate electron beams Medical Physics 2022 8 14 1 1 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 1-11 calorimeter, dosimetry, electron beam, FLASH, ultrahigh dose per pulse EMPIR 2018: Health Wiley 30 0094-2405, 2473-4209 10.1002/mp.15899 NA A.Bourgouin F.Keszti A.A.Schönfeld T.Hackel J.Kozelka J.Hildreth W.Simon A.Schüller R‐P.Kapsch J.Renaud article SchneiderHBBZB2022 2828 Computation of eigenfrequency sensitivities using Riesz projections for efficient optimization of nanophotonic resonators Communications Physics 2022 8 10 5 1 20FUN02: POlight: Pushing boundaries of nano-dimensional metrology by light 202 Nanophotonic resonances, quasi-normal modes, eigenfrequency sensitivities, eigenvalue partial derivatives, Riesz projection method EMPIR 2020: Fundamental Springer Nature 30 2399-3650 10.1038/s42005-022-00977-1 NA P-I.Schneider M.Hammerschmidt F.Betz F.Binkowski L.Zschiedrich S.Burger article ZanovelloCBBAAZCB2022 2823 Classification Scheme of Heating Risk during MRI Scans on Patients with Orthopaedic Prostheses Diagnostics 2022 8 12 8 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 1873 MRI heating risk, MRI safety, orthopaedic implants, radiofrequency-induced heating, gradient-induced heating. https://www.mdpi.com/2075-4418/12/8/1873 EMPIR 2017: Industry MDPI AG 30 2075-4418 10.3390/diagnostics12081873 NA U.Zanovello M.Chiampi B.Bordini F.Baruffaldi C.Ancarani A.Arduino L.Zilberti V.Clementi O.Bottauscio miscellaneous ColomBBKB 2775 Source code and simulation results for nanoantennas supporting an enhanced Purcell factor due to interfering resonances Zenodo 2022 6 8 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology Nanophotonics, nano resonator, Riesz projection expansion EMPIR 2020: Fundamental 30 NA http://dx.doi.org/10.5281/zenodo.6565850 R.Colom F.Binkowski F.Betz Y.Kivshar S.Burger miscellaneous ColomBBKB_2 2775 Source code and simulation results for nanoantennas supporting an enhanced Purcell factor due to interfering resonances Zenodo 2022 6 8 20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light Nanophotonics, nano resonator, Riesz projection expansion EMPIR 2020: Fundamental 30 NA http://dx.doi.org/10.5281/zenodo.6565850 R.Colom F.Binkowski F.Betz Y.Kivshar S.Burger article IrwinHSBSBSV2022 2623 Characterising the silver particle generator; a pathway towards standardising silver aerosol generation Journal of Aerosol Science 2022 6 163 19ENV09: MetroPEMS: Improved vehicle exhaust quantification by portable emission measurement systems metrology 105978 silver particle generator, calibration, reference aerosol, CPC calibration, DMA calibration https://www.sciencedirect.com/science/article/pii/S002185022200026X?via%3Dihub EMPIR 2019: Environment Elsevier BV 30 0021-8502 10.1016/j.jaerosci.2022.105978 NA M.Irwin T.Hammer J.Swanson V.Berger U.Sonkamble A.Boies H.Schulz K.Vasilatou thesis Boonants2022 2835 Testing and analysis of universal high voltage divider 2022 6 19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes High Voltage Metrology, High Voltage Divider, Universal Divider https://trepo.tuni.fi/handle/10024/140641 EMPIR 2019: Pre-Co-Normative Tampere University Tampere University 30 NA https://urn.fi/URN:NBN:fi:tuni-202205275312 S, Boonants article WitkowskiBBKSTZ2022 2771 Optics Express 2022 5 31 30 12 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 21423 blue magic wavelength, photoionization, Sr clock EMPIR 2017: Fundamental Optica Publishing Group 30 1094-4087 10.1364/OE.460554 NA M.Witkowski S.Bilicki M.Bober D.Kovacic V.Singh A.Tonoyan M.Zawada article WitkowskiBBKSTZ2022_2 2771 Photoionization cross sections of ultracold ⁸⁸Sr in ¹P₁ and ³S₁ states at 390 nm and the resulting blue-detuned magic wavelength optical lattice clock constraints Optics Express 2022 5 31 30 12 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 21423 blue magic wavelength, photoionization, Sr clock EMPIR 2017: Fundamental Optica Publishing Group 30 1094-4087 10.1364/OE.460554 NA M.Witkowski S.Bilicki M.Bober D.Kovacic V.Singh A.Tonoyan M.Zawada article WitkowskiBBKSTZ2022_6 2807 Optics Express 2022 5 31 30 12 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 21423 photoionisatio, magic wavelenght, strontium, optical lattice clock EMPIR 2017: Fundamental Optica Publishing Group 30 1094-4087 10.1364/OE.460554 NA M.Witkowski S.Bilicki M.Bober D.Kovacic V.Singh A.Tonoyan M.Zawada article RadtkeGPEBHSKLK2022 2793 Measurements and Utilization of Consistent Gibbs Energies of Transfer of Single Ions: Towards a Unified Redox Potential Scale for All Solvents Chemistry – A European Journal 2022 5 31 28 2022 17FUN09: UnipHied: Realisation of a Unified pH Scale 14 Gibbs Energies of Transfer of Single Ionsunified pH EMPIR 2017: Fundamental Wiley 30 0947-6539, 1521-3765 10.1002/chem.202200509 NA V.Radtke N.Gebel D.Priester A.Ermantraut M.Bäuerle D.Himmel R.Stroh T.Koslowski I.Leito I.Krossing proceedings BossePBOFEP2022 2781 Progress of the European Metrology Network for Advanced Manufacturing Proceedings 22nd euspen International Conference and Exhibition 2022 5 30 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing 299 advanced manufacturing, metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0 EMPIR 2019: Support for Networks Geneva, Switzerland 22nd euspen International Conference and Exhibition 30-05-2022 to 03-06-2022 30 NA https://www.euspen.eu/knowledge-base/ICE22299.pdf H.Bosse A.Przyklenk A.Balsamo D.O'Connor G.Favre A.Evans D.Phillips article BaselgaGGL2022 2766 GBDM+: an improved methodology for a GNSS-based distance meter Measurement Science and Technology 2022 5 25 33 8 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 085020 GNSS, Si, index of refraction, EDM, GeoMetre https://iopscience.iop.org/article/10.1088/1361-6501/ac6f45 EMPIR 2018: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac6f45 NA S.Baselga L.García-Asenjo P.Garrigues R.Luján article RubenVogtRGDKMKKSBBMPFCRVSH2022 2751 PV Module Energy Rating Standard IEC 61853-3 Intercomparison and Best Practice Guidelines for Implementation and Validation IEEE Journal of Photovoltaics 2022 5 12 3 19ENG01: Metro-PV: Metrology for emerging PV applications 844-852 Standards, Meteorology, IEC Standards, Temperature measurement, Power measurement, Photovoltaic systems, Mathematical models https://www.techrxiv.org/articles/preprint/PV_module_energy_rating_standard_IEC_61853-3_intercomparison_and_best_practice_guidelines_for_implementation_and_validation/19635333/1 EMPIR 2019: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 2156-3381, 2156-3403 10.1109/JPHOTOV.2021.3135258 NA M.Ruben Vogt S.Riechelmann A.M.Gracia-Amillo A.Driesse A.Kokka K.Maham P.Kärhä R.Kenny C.Schinke K.Bothe J.Blakesley E.Music F.Plag G.Friesen G.Corbellini N.Riedel-Lyngskar R.Valckenborg M.Schweiger W.Herrmann article BriantKCLBWRMPCESTHPKKDZWMSNB2022 2714 Photonic and Optomechanical Thermometry Optics 2022 4 29 3 2 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 159-176 thermometry; photonic; optomechanic; temperature sensors; photonic integrated circuit https://doi.org/10.3390/opt3020017 EMPIR 2017: Fundamental MDPI AG 30 2673-3269 10.3390/opt3020017 NA T.Briant S.Krenek A.Cupertino F.Loubar R.Braive L.Weituschat D.Ramos M.J.Martin P.A.Postigo A.Casas R.Eisermann D.Schmid S.Tabandeh O.Hahtela S.Pourjamal O.Kozlova S.Kroker W.Dickmann L.Zimmermann G.Winzer T.Martel P.G.Steeneken R.A.Norte S.Briaudeau article VolkovaHTBCMARERBPN2022 2712 Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 color centers, optical quantum technology EMPIR 2020: Fundamental MDPI 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov article VolkovaHTBCMARERBPN2022_2 2721 Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time EMPIR 2020: Fundamental MDPI AG 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov article HoflingBHRHWTJBGR2022 2713 Numerical optimization of single-mode fiber-coupled single-photon sources based on semiconductor quantum dots Optics Express 2022 4 25 30 10 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 15913 single photon source; optical quantum technology https://arxiv.org/abs/2202.09562 EMPIR 2020: Fundamental Optica Publishing Group 30 1094-4087 10.1364/OE.456777 NA S.Höfling S.Burger Al.Herkommer S.Rodt T.Huber K.Weber S.Thiele C.Jimenez L.Bremer H.Giessen S.Reitzenstein article RubinSZHFABKLZA2022 2709 Thermodynamic effects in a gas modulated Invar-based dual Fabry–Pérot cavity refractometer Metrologia 2022 4 14 59 3 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 035003 quantumpascal, GAMOR, optical pressure standard, gas refractometry, pV-work, Invar-based EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ac5ef9 NA T.Rubin I.Silander J.Zakrisson M.Hao C.Forssén P.Asbahr M.Bernien A.Kussicke K.Liu M.Zelan O.Axner article vanHeerenSPB2022 2698 Metrology challenges for microfluidics CMM Magazine 2022 4 13 15 2 20NRM02: MFMET: Establishing metrology standards in microfluidic devices 20-25 Microfluidics, metrology, fabrication, testing http://www.cmmmagazine.com/cmm-articles/metrology-challenges-for-microfluidics/ EMPIR 2020: Pre-Co-Normative MST Global Ltd 30 2634-9167 NA ISSN 2634-9167 H.van Heeren V.Silverio C.Pecnik E.Batista article ZanovelloSBWZI2022 2551 CoSimPy: An open-source python library for MRI radiofrequency Coil EM/Circuit Cosimulation Computer Methods and Programs in Biomedicine 2022 4 216 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 106684 Electromagnetic (EM) simulations, EM/Circuit cosimulation, Magnetic Resonance Imaging (MRI), Radio-frequency (RF) coils, Open source Python library https://www.sciencedirect.com/science/article/pii/S0169260722000694?via%3Dihub EMPIR 2017: Industry Elsevier BV 30 0169-2607 10.1016/j.cmpb.2022.106684 NA U.Zanovello F.Seifert O.Bottauscio L.Winter L.Zilberti B.Ittermann article BystrovWG2022 2801 Analysis of Vector Network Analyzer Thermal Drift Error Metrology 2022 3 23 2 2 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 150-160 measurement techniques, metrology, terahertz, vector network analyzers EMPIR 2018: SI Broader Scope MDPI AG 30 2673-8244 10.3390/metrology2020010 NA A.Bystrov Y.Wang P.Gardner article KranzerSBHPLLP2022 2662 Response of diamond detectors in ultra-high dose-per-pulse electron beams for dosimetry at FLASH radiotherapy Physics in Medicine & Biology 2022 3 21 67 7 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 075002 dosimetry, FLASH radiotherapy, ultra-high dose-per-pulse, microDiamond EMPIR 2018: Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ac594e NA R.Kranzer A.Schüller A.Bourgouin T.Hackel D.Poppinga M.Lapp H.K.Looe B.Poppe article McManusRRBSPS2022 2661 Determination of beam quality correction factors for the Roos plane-parallel ionisation chamber exposed to very high energy electron (VHEE) beams using Geant4 Physics in Medicine & Biology 2022 3 17 67 6 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 065011 geant4, Monte Carlo, perturbation factors, beam quality correction, VHEE EMPIR 2018: Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ac5a94 NA M.McManus F.Romano G.Royle D.Botnariuc D.Shipley H.Palmans A.Subiel article BourgouinKMKSK2022 2663 Characterization of the PTB ultra-high pulse dose rate reference electron beam Physics in Medicine & Biology 2022 3 15 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates Ultra-High Dose Rate, Dosimetry for FLASH, Monte Carlo, Diamond detector,electron beams EMPIR 2018: Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ac5de8 NA A.Bourgouin A.Knyziak M.Marinelli R.Kranzer A.Schüller R-P.Kapsch article KronerABBBCPSSUW2022 2643 Evaluation of the measurement performance of water meters depending on water quality Water Supply 2022 3 14 17IND13: Metrowamet: Metrology for real-world domestic water metering cold water meters, test regime, water quality, water meter accuracy EMPIR 2017: Industry IWA Publishing 30 1606-9749, 1607-0798 10.2166/ws.2022.133 NA C.Kroner B.Akselli M.Benkova A.Borchling O.Büker N.Christoffersen J.Pavlas D.Schumann V.Seypka B.Unsal H.Warnecke article GarciaYipSRBBG2022 2620 Characterization of small active detectors for electronic brachytherapy dosimetry Journal of Instrumentation 2022 3 17 03 18NRM02: PRISM-eBT: Primary standards and traceable measurement methods for X-ray emitting electronic brachytherapy devices P03001 Detector alignment and calibration methods (lasers, sources, particle-beams), X-ray detectors, Diamond Detectors https://doi.org/10.1088/1748-0221/17/03/P03001 EMPIR 2018: Pre-Co-Normative IOP Publishing 30 1748-0221 10.1088/1748-0221/17/03/P03001 NA F.Garcia Yip T.Schneider M.Reginatto R.Behrens L.Büermann F.Grote article HuynhDDLBW2022 2681 Candidate High-Resolution Mass Spectrometry-Based Reference Method for the Quantification of Procalcitonin in Human Serum Using a Characterized Recombinant Protein as a Primary Calibrator Analytical Chemistry 2022 3 94 10 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis 4146-4154 High-Resolution Mass Spectrometry, Procalcitonin, Primary Calibrator https://doi.org/10.1021/acs.analchem.1c03061 EMPIR 2018: Health American Chemical Society (ACS) 30 0003-2700, 1520-6882 10.1021/acs.analchem.1c03061 NA H-H.Huynh V.Delatour M.Derbez-Morin Q.Liu A.Boeuf W.Webster article MuruganORWB2022 2722 Vision for a European metrology network for energy gases Environmental Research: Infrastructure and Sustainability 2022 3 2 1 18NET01: Energy Gases: Support for a European Metrology Network for energy gases 012003 metrology, energy gases, hydrogen, biomethane, natural gas, CCS ENG EMPIR 2018: Support for Networks IOP Publishing 30 2634-4505 10.1088/2634-4505/ac57f6 NA A.Murugan O.Omoniyi E.Richardson M.Workamp A.Baldan article KrokerSGKB2022 2816 Abbildende Müller-Matrix-Ellipsometrie für die Charakterisierung vereinzelter Nanostrukturen tm - Technisches Messen 2022 3 89 6 20FUN02: POlight: Pushing boundaries of nano-dimensional metrology by light 438-446 Nanometrology, ellipsometry, Mueller ellipsometry,imaging ellipsometry, nanostructures EMPIR 2020: Fundamental Walter de Gruyter GmbH 43 2196-7113, 0171-8096 10.1515/teme-2021-0133 NA S.Kroker T.Siefke J.Grundmann T.Käseberg B.Bodermann article MarlettoVKPBRAGDG2022 2679 Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment Physical Review Letters 2022 2 23 128 8 20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology 080401 Quantum Foundations, Quantum Measurements, Quantum thermodynamics https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401 EMPIR 2020: Industry American Physical Society (APS)
Ridge, NY, United States
30 0031-9007, 1079-7114 10.1103/PhysRevLett.128.080401 NA C.Marletto V.Vedral L.T.Knoll F.Piacentini E.Bernardi E.Rebufello A.Avella M.Gramegna I.P.Degiovanni M.Genovese
article MarlettoVKPBRAGDG20220 2679 Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment Physical Review Letters 2022 2 23 128 8 17FUN06: SIQUST: Single-photon sources as new quantum standards 080401 Quantum Foundations, Quantum Measurements, Quantum thermodynamics https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401 EMPIR 2017: Fundamental American Physical Society (APS)
Ridge, NY, United States
30 0031-9007, 1079-7114 10.1103/PhysRevLett.128.080401 NA C.Marletto V.Vedral L.T.Knoll F.Piacentini E.Bernardi E.Rebufello A.Avella M.Gramegna I.P.Degiovanni M.Genovese
article MarlettoVKPBRAGDG20221 2679 Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment Physical Review Letters 2022 2 23 128 8 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 080401 Quantum Foundations, Quantum Measurements, Quantum thermodynamics https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401 EMPIR 2020: Fundamental American Physical Society (APS)
Ridge, NY, United States
30 0031-9007, 1079-7114 10.1103/PhysRevLett.128.080401 NA C.Marletto V.Vedral L.T.Knoll F.Piacentini E.Bernardi E.Rebufello A.Avella M.Gramegna I.P.Degiovanni M.Genovese
article WarneckeKOKCBBHHU2022 2574 New metrological capabilities for measurements of dynamic liquid flows Metrologia 2022 2 17 17IND13: Metrowamet: Metrology for real-world domestic water metering dynamic liquid flow rates, test rigs with dynamic measurement capabilities, validation through inter-facility intercomparison EMPIR 2017: Industry IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ac566e NA H.Warnecke C.Kroner F.Ogheard J.B.Kondrup N.Christoffersen M.Benkova O.Büker S.Haack M.Huovinen B.Unsal article BergCG2022 2664 Silicone tube humidity generator Atmospheric Measurement Techniques 2022 2 16 15 3 20IND06: PROMETH2O: Metrology for trace water in ultra-pure process gases 819-832 Humidity, trace moisture, permeation tube, metrology https://amt.copernicus.org/articles/15/819/2022/ EMPIR 2020: Industry Copernicus GmbH 30 1867-8548 10.5194/amt-15-819-2022 NA R.F.Berg N.Chiodo E.Georgin proceedings SunCGLJBB2022 2584 Evaluation of X-ray computed tomography for surface texture measurements using a prototype additively manufactured reference standard Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022, 2022 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry calibration, X-ray computed tomography, additive manufacturing, Reference standard, surface texture, areal https://www.ndt.net/search/docs.php3?id=26568 EMPIR 2017: Industry Wels, Austria 11th Conference on Industrial Computed Tomography (iCT) 2022 08-02-2022 to 11-02-2022 30 NA https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id260.pdf W.Sun X.Chen C.Giusca S.Lou C.Jones H.Boulter S.Brown proceedings BircherMKBEKHHL2022 2585 Traceable determination of non-static XCT machine geometry: New developments and case studies Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022, 2022 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry traceability, Dimensional metrology, XCT machine geometry, calibrated reference standards, radiographic XCT geometry determination, stage error motion, CFD/FE simulations, image quality metric based methods https://www.ndt.net/search/docs.php3?id=26614 EMPIR 2017: Industry Wels, Austria 11th Conference on Industrial Computed Tomography (iCT) 2022 08-02-2022 to 11-02-2022 30 NA https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id209.pdf B.Bircher F.Meli A.Küng C.Bellon S.Evsevleev M.Katić V.Heikkinen B.Hemming A.Lassila article XuZAPB2022 2576 Using a Tip Characterizer to Investigate Microprobe Silicon Tip Geometry Variation in Roughness Measurements Sensors 2022 2 22 3 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 1298 roughness measurement, piezoresistive microprobe, silicon fracture, tip characterization https://www.mdpi.com/1424-8220/22/3/1298 EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s22031298 NA M.XU Z.Zhou T.Ahbe E.Peiner U.Brand article SunGLYCFJWBB2022 2588 Establishment of X-ray computed tomography traceability for additively manufactured surface texture evaluation Additive Manufacturing 2022 2 50 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 102558 Additive manufacturing, Surface texture, Reference standard, X-ray computed tomography https://www.sciencedirect.com/science/article/pii/S2214860421007053?via%3Dihub EMPIR 2017: Industry Elsevier BV 30 2214-8604 10.1016/j.addma.2021.102558 NA W.Sun C.Giusca S.Lou X.Yang X.Chen T.Fry X.Jiang A.Wilson S.Brown H.Boulter proceedings SinghRathoreLBSV2022 2587 Benchmarking of different reconstruction algorithms for industrial cone-beam CT Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022, 2022 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry reconstruction, tomography, iterative, Analytical https://www.ndt.net/search/docs.php3?id=26640 EMPIR 2017: Industry Wels, Austria 11th Conference on Industrial Computed Tomography (iCT) 2022 08-02-2022 to 11-02-2022 30 NA https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id244.pdf J.Singh Rathore R.Laquai A.Biguri M.Soleimani C. Vienne article ZutzBKHR2022 2630 DEVELOPMENT OF A EUROPEAN METROLOGY NETWORK FOR RELIABLE RADIATION PROTECTION: PULSED HIGH ENERGY PHOTON REFERENCE FIELD AS A METROLOGICAL GAP IN RADIATION PROTECTION Physica Medica 2022 2 94 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation S113 high energy pulsed fields, European Metrology Network for Radiation Protection, photon reference field, metrological gaps, supportBSS EMPIR 2019: Support for Networks Elsevier BV 30 1120-1797 10.1016/S1120-1797(22)01699-4 NA H.Zutz J.Busse B.Khanbabaee O.Hupe A.Röttger article ArrheniusFB2022 2685 Sampling methods for renewable gases and related gases: challenges and current limitations Analytical and bioanalytical chemistry 2022 2 20IND10: Decarb: Metrology for decarbonising the gas grid Material compatibility, Renewable gases, Sampling EMPIR 2020: Industry Springer 30 10.1007/s00216-022-03949-0 NA K.Arrhenius L.Francini O.Büker article MilanoBVR2022 2556 Memristive devices based on single ZnO nanowires—from material synthesis to neuromorphic functionalities Semiconductor Science and Technology 2022 1 28 37 3 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 034002 nanowires, ZnO, chemical vapor deposition (CVD), resistive switching,memristive devices, neuromorphic devices https://iopscience.iop.org/article/10.1088/1361-6641/ac4b8a EMPIR 2020: Fundamental IOP Publishing 30 0268-1242, 1361-6641 10.1088/1361-6641/ac4b8a NA G.Milano L.Boarino I.Valov C.Ricciardi article KuckLHGCRPSGBFLTTCMDTRR2022 2486 Single photon sources for quantum radiometry: a brief review about the current state-of-the-art Applied Physics B 2022 1 23 128 2 17FUN06: SIQUST: Single-photon sources as new quantum standards Single photon sources, quantum radiometry, quantum metrology https://doi.org/10.1007/s00340-021-07734-2 EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 0946-2171, 1432-0649 10.1007/s00340-021-07734-2 NA S.Kück M.López H.Hofer H.Georgieva J.Christinck B.Rodiek G.Porrovecchio M.Smid S.Götzinger C.Becher P.Fuchs P.Lombardi C.Toninelli M.Trapuzzano M.Colautti G.Margheri I.P.Degiovanni P.Traina S.Rodt S.Reitzenstein article KuckLHGCRPSGBFLTTCMDTRR2022_2 2752 Single photon sources for quantum radiometry: a brief review about the current state-of-the-art Applied Physics B 2022 1 23 128 2 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology Single-photon sources, quantum radiometry, calibration, single photon detectors. defect centres, (nano-)diamonds, molecule semiconductor quantum dots, photon flux, single-photon purity, spectral power distribution EMPIR 2020: Fundamental Springer Science and Business Media LLC 30 0946-2171, 1432-0649 10.1007/s00340-021-07734-2 NA S.Kück M.López H.Hofer H.Georgieva J.Christinck B.Rodiek G.Porrovecchio M.Smid S.Götzinger C.Becher P.Fuchs P.Lombardi C.Toninelli M.Trapuzzano M.Colautti G.Margheri I.P.Degiovanni P.Traina S.Rodt S.Reitzenstein article TongBKRGGGCHC2022 2570 Cathodoluminescence mapping of electron concentration in MBE-grown GaAs:Te nanowires Nanotechnology 2022 1 22 33 18 19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices 185704 nanowires, GaAs, doping, cathodoluminescence https://iopscience.iop.org/article/10.1088/1361-6528/ac4d58 EMPIR 2019: Energy IOP 30 NA https://hal.archives-ouvertes.fr/hal-03539939 C.Tong T.Bidaud E.Koivusalo M.Rizzo Piton M.Guina H.Galeti Y.Galvao Gobato A.Cattoni T.Hakkarainen S.Collin article DeVisMHMSB2022 2536 Ancillary Data Uncertainties within the SeaDAS Uncertainty Budget for Ocean Colour Retrievals Remote Sensing 2022 1 21 14 3 16ENV03: MetEOC-3: Further metrology for earth observation and climate 497 Ocean Colour, Atmospheric correction, uncertainty, ancillary parameters EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs14030497 NA P.De Vis F.Mélin S.E.Hunt R.Morrone M.Sinclair B.Bell article DeVisMHMSB2022_2 2590 Ancillary Data Uncertainties within the SeaDAS Uncertainty Budget for Ocean Colour Retrievals Remote Sensing 2022 1 21 14 3 19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system 497 ocean colour, atmospheric correction, uncertainty, ancillary parameters EMPIR 2019: Environment MDPI AG 30 2072-4292 10.3390/rs14030497 NA P.De Vis F.Mélin S.E.Hunt R.Morrone M.Sinclair B.Bell article KrokerVKGSKB2022 2815 Mueller Matrix Ellipsometric Approach on the Imaging of Sub-Wavelength Nanostructures Frontiers in Physics 2022 1 21 9 20FUN02: POlight: Pushing boundaries of nano-dimensional metrology by light 814559 metrology, nanometrology, ellipsometry, mueller ellipsometry, imaging ellipsometry, nanostructures,mueller matrix ellipsometry EMPIR 2020: Fundamental Frontiers Media SA 30 2296-424X 10.3389/fphy.2021.814559 NA S.Kroker M.Valtr P.Klapetek J.Grundmann T.Siefke T.Käseberg B.Bodermann article KellerSKFCVCOBHMMNORBCNCDDGLVWZK2022 2778 RNA reference materials with defined viral RNA loads of SARS-CoV-2—A useful tool towards a better PCR assay harmonization PLOS ONE 2022 1 20 17 1 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis e0262656 SARS-CoV-2, RNA, PCR EMPIR 2018: Health Public Library of Science (PLoS) 30 1932-6203 NA https://zenodo.org/record/6637818 T.Keller I.Schellenberg A.Kummrow S.Falak M.H.Cleveland P.M.Vallone S.Cowen D.O’Sullivan E.Busby J.Huggett M.Mielke J.Michel A.Nitsche M.Obermeier H.F.Rabenau A.Berger S.Ciesek D.Niemeyer V.Corman U.Duehring C.Drosten H-P.Grunert V.Lindig L.Vierbaum N.Wojtalewicz H.Zeichhardt M.Kammel article BeckhoffURHTHE2022 2463 Investigating Membrane‐Mediated Antimicrobial Peptide Interactions with Synchrotron Radiation Far‐Infrared Spectroscopy ChemPhysChem 2022 1 14 HLT10: BiOrigin: Metrology for biomolecular origin of disease 1-11 antimicrobialpeptides, electrostatic interactions, IR spectroscopy, phospholipid membranes, protein folding EMRP A169: Call 2011 Metrology for Health Wiley 30 1439-4235, 1439-7641 NA https://doi.org/10.1002/cphc.202100815 B.Beckhoff G.Ulm M.G.Ryadnov A.Hoehl B.Tiersch A.Hornemann D.M.Eichert article ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022 2567 2022 roadmap on neuromorphic computing and engineering Neuromorphic Computing and Engineering 2022 1 12 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology neuromorphic computing, neuromorphic engineering https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83 EMPIR 2020: Fundamental IOP Publishing 30 2634-4386 10.1088/2634-4386/ac4a83 NA D.V.Christensen R.Dittmann B.Linares-Barranco A.Sebastian M.Le Gallo A.Redaelli S.Slesazeck T.Mikolajick S.Spiga S.Menzel I.Valov G.Milano C.Ricciardi S-J.Liang F.Miao M.Lanza T.J.Quill S.T.Keene A.Salleo J.Grollier D.Markovic A.Mizrahi P.Yao J.J.Yang G.Indiveri J.P.Strachan S.Datta E.Vianello A.Valentian J.Feldmann X.Li W.H.P.Pernice H.Bhaskaran S.Furber E.Neftci F.Scherr W.Maass S.Ramaswamy J.Tapson P.Panda Y.Kim G.Tanaka S.Thorpe C.Bartolozzi T.A.Cleland C.Posch S-C.Liu G.Panuccio M.Mahmud A.N.Mazumder M.Hosseini T.Mohsenin E.Donati S.Tolu R.Galeazzi M.E.Christensen S.Holm D.Ielmini N.Pryds article CelikovicPVNiCGBQR2022 2428 Outdoor Radon as a Tool to Estimate Radon Priority Areas—A Literature Overview International Journal of Environmental Research and Public Health 2022 1 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level outdoor radon concentrations; literature overview; radiation risk; indoor radonconcentrations; radon priority areas EMPIR 2019: Environment 30 NA https://doi.org/10.3390/ijerph19020662 I.Čeliković G.Pantelić I.Vukanac J.K.Nikolić M.Živanović G.Cinelli V.Gruber S.Baumann L.S.Quindos Poncela D.Rabago article OanceaBPGJCOC2022 2657 Stray radiation produced in FLASH electron beams characterized by the MiniPIX Timepix3 Flex detector Journal of Instrumentation 2022 1 17 01 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates C01003 MiniPIX Timepix3, Particle fluxes, Dose rates, FLASH electron beams, UHDpulse, electronradiotherapy https://doi.org/10.48550/arXiv.2201.13171 EMPIR 2018: Health IOP Publishing 30 1748-0221 10.1088/1748-0221/17/01/C01003 NA C.Oancea C.Bălan J.Pivec C.Granja J.Jakubek D.Chvatil V.Olsansky V.Chiș article FasoloBBCCCCCDEFFFFGGGGKLLLMMMMMMMNOPPPRRRSUV2022 2612 Bimodal Approach for Noise Figures of Merit Evaluation in Quantum-Limited Josephson Traveling Wave Parametric Amplifiers IEEE Transactions on Applied Superconductivity 2022 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology Physics, Gain, Microwave amplifiers, Noise figure, Superconducting microwave devices, Microwave photonics, Bandwidth EMPIR 2017: Fundamental Institute of Electrical and Electronics Engineers (IEEE) 30 1051-8223, 1558-2515, 2378-707 10.1109/TASC.2022.3148692 NA L.Fasolo C.Barone M.Borghesi G.Carapella A.P.Caricato I.Carusotto W.Chung A.Cian D.Di Gioacchino E.Enrico P.Falferi M.Faverzani E.Ferri G.Filatrella C.Gatti A.Giachero D.Giubertoni A.Greco C.Kutlu A.Leo C.Ligi P.Livreri G.Maccarone B.Margesin G.Maruccio A.Matlashov C.Mauro R.Mezzena A.G.Monteduro A.Nucciotti L.Oberto S.Pagano V.Pierro L.Piersanti M.Rajteri A.Rettaroli S.Rizzato Y.K.Semertzidis S.V.Uchaikin A.Vinante article MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022 2764 Versailles project on advanced materials and standards (VAMAS) interlaboratory study on measuring the number concentration of colloidal gold nanoparticles Nanoscale 2022 14 12 18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration 4690-4704 nanoparticle, concentration, standardization, VAMAS, interlaboratory EMPIR 2018: Support for Impact Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/D1NR07775A NA C.Minelli M.Wywijas D.Bartczak S.Cuello-Nuñez H.G.Infante J.Deumer C.Gollwitzer M.Krumrey K.E.Murphy M.E.Johnson A.R.Montoro Bustos I.H.Strenge B.Faure P.Høghøj V.Tong L.Burr K.Norling F.Höök M.Roesslein J.Kocic L.Hendriks V.Kestens Y.Ramaye M.C.Contreras Lopez G.Auclair D.Mehn D.Gilliland A.Potthoff K.Oelschlägel J.Tentschert H.Jungnickel B.C.Krause Y.U.Hachenberger P.Reichardt A.Luch T.E.Whittaker M.M.Stevens S.Gupta A.Singh F-h.Lin Y-H.Liu A.L.Costa C.Baldisserri R.Jawad S.E.L.Andaloussi M.N.Holme T.G.Lee M.Kwak J.Kim J.Ziebel C.Guignard S.Cambier S.Contal A.C.Gutleb J.“Kuba” Tatarkiewicz B.J.Jankiewicz B.Bartosewicz X.Wu J.A.Fagan E.Elje E.Rundén-Pran M.Dusinska I.P.Kaur D.Price I.Nesbitt S.O′ Reilly R.J.B.Peters G.Bucher D.Coleman A.J.Harrison A.Ghanem A.Gering E.McCarron N.Fitzgerald G.Cornelis J.Tuoriniemi M.Sakai H.Tsuchida C.Maguire A.Prina-Mello A.J.Lawlor J.Adams C.L.Schultz D.Constantin N.T.K.Thanh L.D.Tung L.Panariello S.Damilos A.Gavriilidis I.Lynch B.Fryer A.Carrazco Quevedo E.Guggenheim S.Briffa E.Valsami-Jones Y.Huang A.A.Keller V-T.Kinnunen S.Perämäki Z.Krpetic M.Greenwood A.G.Shard article ColomBBKB2022 2774 Enhanced Purcell factor for nanoantennas supporting interfering resonances Physical Review Research 2022 4 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 023189 Nanoantennas, nanophotonics, near field optics, nanodisks, optical microcavities, electromagnetic wave theory, finite-element method EMPIR 2020: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.4.023189 NA R.Colom F.Binkowski F.Betz Y.Kivshar S.Burger article LeviCTB2022 2725 Optically Loaded Strontium Lattice Clock With a Single Multi-Wavelength Reference Cavity IEEE Transactions on Instrumentation and Measurement 2022 71 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 1-9 Atomic spectroscopy, laser stabilization, opticalfrequency metrology, optical frequency standard, optical latticeclock, strontium. EMPIR 2017: Fundamental Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2022.3165292 NA F.Levi D.Calonico M.G.Tarallo M.Barbiero article ColomBBKB2022_2 2774 Enhanced Purcell factor for nanoantennas supporting interfering resonances Physical Review Research 2022 4 20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light 023189 Nanoantennas, nanophotonics, near field optics, nanodisks, optical microcavities, electromagnetic wave theory, finite-element method EMPIR 2020: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.4.023189 NA R.Colom F.Binkowski F.Betz Y.Kivshar S.Burger article LeviCTB2022_2 2725 Optically Loaded Strontium Lattice Clock With a Single Multi-Wavelength Reference Cavity IEEE Transactions on Instrumentation and Measurement 2022 71 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 1-9 Atomic spectroscopy, laser stabilization, opticalfrequency metrology, optical frequency standard, optical latticeclock, strontium. EMPIR 2017: Fundamental Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2022.3165292 NA F.Levi D.Calonico M.G.Tarallo M.Barbiero article ArrheniusBSCGBB2021 2487 Detection of Contaminants in Hydrogen Fuel for Fuel Cell Electrical Vehicles with Sensors—Available Technology, Testing Protocols and Implementation Challenges Processes 2021 12 24 10 1 19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2 20 sensors, hydrogen quality, FCEV, testing protocols EMPIR 2019: Energy MDPI AG 30 2227-9717 10.3390/pr10010020 NA K.Arrhenius T.Bacquart K.Schröter M.Carré B.Gozlan C.Beurey C.Blondeel article MiloroABBZFR2021 2444 A standard test phantom for the performance assessment of magnetic resonance guided high intensity focused ultrasound (MRgHIFU) thermal therapy devices International Journal of Hyperthermia 2021 12 22 39 1 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 57-68 HIFU; thermal ablation; quality control; phantom; thermal dosimetry https://www.tandfonline.com/doi/full/10.1080/02656736.2021.2017023 EMPIR 2018: Health Informa UK Limited 30 0265-6736, 1464-5157 10.1080/02656736.2021.2017023 NA PMiloro S.Ambrogio F.Bosio R.M.Baêsso B.Zeqiri F.Fedele K.V.Ramnarine article WooldridgeAZZCCB2021 2546 Gradient coil and radiofrequency induced heating of orthopaedic implants in MRI: influencing factors Physics in Medicine & Biology 2021 12 21 66 24 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 245024 MRI; finite element modelling; implant heating https://iopscience.iop.org/article/10.1088/1361-6560/ac3eab EMPIR 2017: Industry IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ac3eab NA J.Wooldridge A.Arduino L.Zilberti U.Zanovello M.Chiampi V.Clementi O.Bottauscio article BassottiSC2021 2437 From the spin eigenmodes of isolated Nel skyrmions to the magnonic bands of a skyrmionic crystal: a micromagnetic study as a function of the strength of both the interfacial Dzyaloshinskii-Moriya and the exchange constants IEEE Magnetic Letters 2021 12 16 17FUN08: TOPS: Metrology for topological spin structures Micromagnetic simulations, skyrmiond, magnetic crystals, DMI https://arxiv.org/ftp/arxiv/papers/2112/2112.04967.pdf EMPIR 2017: Fundamental IEEE 30 NA https://ieeexplore.ieee.org/document/9653803 M.Bassotti R.Silvani G.Carlotti article KayserOHB2021 2485 Reliable compositional analysis of airborne particulate matter beyond the quantification limits of total reflection X-ray fluorescence. Analytica Chimica Acta 2021 12 12 1192 1 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 339367 Total reflection X-ray fluorescence, Grazing incidence X-ray fluorescence, Aerosols, Airborne particulate matter, Air pollution, Cascade impactors https://www.sciencedirect.com/journal/analytica-chimica-acta
http://www.aerometprojectii.com/ EMPIR 2019: Environment Elsevier B.V. 30 0003-2670 10.1016/j.aca.2021.339367 NA Y.Kayser J.Osán P.Honicke B.Beckhoff article OlbrichHLvBOS2021 2175 Comparing temporal characteristics of slug flow from tomography measurements and video observations Measurement: Sensors 2021 12 18 16ENG07: MultiFlowMet II: Multiphase flow reference metrology 100222 slug flow, interface dynamics, tomography, video observation https://www.sciencedirect.com/science/article/pii/S2665917421001859 EMPIR 2016: Energy Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100222 NA M.Olbrich A.Hunt T.Leonard D.S.van Putten M.Bär K.Oberleithner S.Schmelter article Bruns2021 2195 Efficient very low frequency primary calibration method for accelerometers Measurement: Sensors 2021 12 18 19ENV03: Infra-AUV: Metrology for low-frequency sound and vibration 100156 Primary vibration calibrationMulti-sineSine-approximation https://www.sciencedirect.com/science/article/pii/S2665917421001197 EMPIR 2019: Environment Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100156 NA T.Bruns article SchmelterOKB2021 2196 Analysis of multiphase flow simulations and comparison with high-speed video observations Measurement: Sensors 2021 12 18 16ENG07: MultiFlowMet II: Multiphase flow reference metrology 100154 Multiphase flowSlug flowPlug flowComputational fluid dynamics (CFD)High-speed video observationsLiquid level time series https://doi.org/10.1016/j.measen.2021.100154 EMPIR 2016: Energy Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100154 NA S.Schmelter M.Olbrich S.Knotek M.Bär article GrahamTKBBNBOZZ2021 2275 Ultra-low flow rate measurement techniques Measurement: Sensors 2021 12 18 18HLT08: MEDDII: Metrology for drug delivery 100279 Flow metrologyDrug deliveryCalibrationUncertaintyNanoflow EMPIR 2018: Health Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100279 NA E.Graham K.Thiemann S.Kartmann E.Batista H.Bissig A.Niemann A.W.Boudaoud F.Ogheard Y.Zhang M.Zagnoni article BatistaFFGAAM2021 2277 Uncertainty calculations in optical methods used for micro flow measurement Measurement: Sensors 2021 12 18 18HLT08: MEDDII: Metrology for drug delivery 100155 MicroflowFront trackingMethodPending drop methodMeasurement uncertainty EMPIR 2018: Health Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100155 NA E.Batista A.Furtado M. do C.Ferreira I.Godinho M.Alvares J.Afonso R.F.Martins article BatistaSAAM2021 2276 Development of an experimental setup for micro flow measurement using the front tracking method Measurement: Sensors 2021 12 18 18HLT08: MEDDII: Metrology for drug delivery 100152 Microflow measurementFront trackingCalibrationMeasurement uncertainty EMPIR 2018: Health Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100152 NA E.Batista J.A.Sousa M.Alvares J.Afonso R.F.Martins article AssoulineJBWTJGKRPR2021 2371 Excitonic nature of magnons in a quantum Hall ferromagnet Nature Physics 2021 12 17 12 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 1369-1374 Graphene, mangons, interferometry, p-n-junction https://arxiv.org/abs/2102.02068 EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 1745-2473, 1745-2481 10.1038/s41567-021-01411-z NA A.Assouline M.Jo P.Brasseur K.Watanabe T.Taniguchi Th.Jolicoeur D.C.Glattli N.Kumada P.Roche F.D.Parmentier P.Roulleau article SudTSBSDSSWZZRCKKC2021 2383 Tailoring interfacial effect in multilayers with Dzyaloshinskii–Moriya interaction by helium ion irradiation Scientific Reports 2021 12 11 23626 17FUN08: TOPS: Metrology for topological spin structures Spintronics, Nano magnetism, Magnetic skyrmions, Dzyaloshinskii–Moriya interaction https://www.nature.com/articles/s41598-021-02902-y.pdf EMPIR 2017: Fundamental Springer Nature 30 10.1038/s41598-021-02902-y NA A. Sud S.Tacchi D. Sagkovits C.Barton M.Sall L.H. Diez E. Stylianidis N.Smith L.Wright S. Zhang X.Zhang D. Ravelosona G.Carlotti H. Kurebayashi O.Kazakova M. Cubukcu proceedings ThorsethLB2021 2547 SENSITIVITY ANALYSIS ON THE EFFECT OF MEASUREMENT NOISE AND SAMPLING FREQUENCY ON THE CALCULATION OF THE TEMPORAL LIGHT ARTEFACTS Proceedings of the Conference CIE 2021 2021 12 x48 20NRM01: MetTLM: Metrology for temporal light modulation OP28 Photometry, Temporal light modulation, TLM, Temporal light artefacts, TLA, Flicker, Measurement uncertainty, Propagation of uncertainty. https://orbit.dtu.dk/en/publications/sensitivity-analysis-on-the-effect-of-measurement-noise-and-sampl EMPIR 2020: Pre-Co-Normative International Commission on Illumination, CIE Kuala Lumpur, Malaysia CIE 2021 Midterm Meeting & Conference 27-09-2021 to 29-09-2021 30 10.25039/x48.2021.OP28 NA A.Thorseth J.Lindén C.A.Bouroussis article RosnerWGB2021 2603 Uncertainty evaluation for complex GPS characteristics Measurement: Sensors 2021 12 18 - 17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry 100323 Coordinate measuring systems, Measurement uncertainty, Geometrical product specification, Sensitivity analysis, GUM uncertainty Framework https://www.sciencedirect.com/science/article/pii/S2665917421002865 EMPIR 2017: Pre-Co-Normative Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100323 NA P.Rosner M.Wojtyła E.Gomez-Acedo A.Balsamo article WojtyaRFSB2021 2605 Verification of sensitivity analysis method of measurement uncertainty evaluation Measurement: Sensors 2021 12 18 Part of sp 17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry 100274 Coordinate measuring machines, Measurement uncertainty, Geometrical product specification, Sensitivity analysis, GUM uncertainty Framework, Uncertainty evaluating software https://www.sciencedirect.com/science/article/pii/S2665917421002373 EMPIR 2017: Pre-Co-Normative Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100274 NA M.Wojtyła P.Rosner A.B.Forbes E.Savio A.Balsamo article PratoBMFG2021 2668 Theoretical insights on the influence of the experimental plan in the calibration of multicomponent force and moment transducers Measurement: Sensors 2021 12 18 18SIB08: ComTraForce: Comprehensive traceability for force metrology services 100209 Experimental planMulticomponent transducersForce metrologyCalibration EMPIR 2018: SI Broader Scope Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100209 NA A.Prato D.Borgiattino F.Mazzoleni A.Facello A.Germak article OgrincRDBMBKOAGQMUOG2021 2701 Support for a European metrology network on food safety Food-MetNet Measurement: Sensors 2021 12 18 20NET02: Food-MetNet: Support for a European Metrology Network on Food Safety 100285 Food; Metrology; Network; Safety; Stakeholders EMPIR 2020: Support for Networks Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100285 NA N.Ogrinc A.M.Rossi F.Durbiano R.Becker M.Milavec A.Bogožalec Košir E.Kakoulides H.Ozer F.Akçadag H.Goenaga-Infante M.Quaglia S.Mallia G.Umbricht G.O'Connor B.Guettler article ZjawinBCLZW2021 2745 Engineering the sensitivity of macroscopic physical systems to variations in the fine-structure constant Europhysics Letters 2021 12 136 5 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 58001 variation of alpha, EMPIR 2017: Fundamental IOP Publishing 30 0295-5075, 1286-4854 10.1209/0295-5075/ac3da3 NA B.Zjawin M.Bober R.Ciuryło D.Lisak M.Zawada P.Wcisło article DegiovanniGBSC2021 2760 EURAMET EMN-Q: The European metrology network for quantum technologies Measurement: Sensors 2021 12 18 19NET02: EMN-Quantum: Support for a European Metrology Network on quantum technologies 100348 Quantum Metrology, Metrology for Quantum Technologies, Quantum Technologies, Quantum Clocks, Atomic Sensors, Quantum Electronics, Quantum Photonics, Quantum Computing, Quantum Sensing, Quantum Imaging https://www.sciencedirect.com/science/article/pii/S2665917421003111 EMPIR 2019: Support for Networks Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100348 NA I.P.Degiovanni M.Gramegna S.Bize H.Scherer C.Chunnilall article KoybasiNTPRPBMSKGOIG2021 2601 High Performance Predictable Quantum Efficient Detector Based on Induced-Junction Photodiodes Passivated with SiO2/SiNx Sensors 2021 11 24 21 23 18SIB10: chipS·CALe: Self-calibrating photodiodes for the radiometric linkage to fundamental constants 7807 silicon photodetector; inversion layer photodiode; induced-junction; surface passivation;PECVD silicon nitride; radiometry; optical power; primary standard; predictable quantum efficiency EMPIR 2018: SI Broader Scope MDPI AG 30 1424-8220 10.3390/s21237807 NA O.Koybasi Ø.Nordseth T.Tran M.Povoli M.Rajteri C.Pepe E.Bardalen F.Manoocheri A.Summanwar M.Korpusenko M.N.Getz P.Ohlckers E.Ikonen J.Gran article RottgerVSPDISBAGGBWPiN2021 2317 Metrology for radiation protection: a new European network in the foundation phase Advances in Geosciences 2021 11 17 57 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation 1-7 supportBSS, EMN for Radiation Protection, metrology, regulation, EURAMET, EURATOM EMPIR 2019: Support for Networks Copernicus GmbH 30 1680-7359 10.5194/adgeo-57-1-2021 NA A.Röttger A.Veres V.Sochor M.Pinto M.Derlacinski M-R.Ioan A.Sabeta R.Bernat C.Adam-Guillermin J.H.Gracia Alves D.Glavič-Cindro S.Bell B.Wens L.Persson M.Živanović R.Nylund article RiemannAEBMSSRIF2021 2569 Assessment of measurement precision in single‐voxel spectroscopy at 7 T: Toward minimal detectable changes of metabolite concentrations in the human brain in vivo Magnetic Resonance in Medicine 2021 11 16 87 3 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 1119-1135 CRLBs, measurement precision, minimal detectable change, MR spectroscopy, reproducibility/repeatability, SPECIAL https://onlinelibrary.wiley.com/doi/10.1002/mrm.29034 EMPIR 2018: Health Wiley 30 0740-3194, 1522-2594 10.1002/mrm.29034 NA L.T.Riemann C.S.Aigner S.L.R.Ellison R.Brühl R.Mekle S.Schmitter O.Speck G.Rose B.Ittermann A.Fillmer article HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021 2336 Frequency drift in MR spectroscopy at 3T NeuroImage 2021 11 241 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 118430 Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site EMPIR 2018: Health Elsevier BV 30 1053-8119 10.1016/j.neuroimage.2021.118430 NA S.C.N.Hui M.Mikkelsen H.J.Zöllner V.Ahluwalia S.Alcauter L.Baltusis D.A.Barany L.R.Barlow R.Becker J.I.Berman A.Berrington P.K.Bhattacharyya J.U.Blicher W.Bogner M.S.Brown V.D.Calhoun R.Castillo K.M.Cecil Y.B.Choi W.C.W.Chu W.T.Clarke A.R.Craven K.Cuypers M.Dacko C.de la Fuente-Sandoval P.Desmond A.Domagalik J.Dumont N.W.Duncan U.Dydak K.Dyke D.A.Edmondson G.Ende L.Ersland C.J.Evans A.S.R.Fermin A.Ferretti A.Fillmer T.Gong I.Greenhouse J.T.Grist M.Gu A.D.Harris K.Hat S.Heba E.Heckova J.P.Hegarty K-F.Heise S.Honda A.Jacobson J.F.A.Jansen C.W.Jenkins S.J.Johnston C.Juchem A.Kangarlu A.B.Kerr K.Landheer T.Lange P.Lee S.R.Levendovszky C.Limperopoulos F.Liu W.Lloyd D.J.Lythgoe M.G.Machizawa E.L.MacMillan R.J.Maddock A.V.Manzhurtsev M.L.Martinez-Gudino J.J.Miller H.Mirzakhanian M.Moreno-Ortega P.G.Mullins S.Nakajima J.Near R.Noeske W.Nordhøy G.Oeltzschner R.Osorio-Duran M.C.G.Otaduy E.H.Pasaye R.Peeters S.J.Peltier U.Pilatus N.Polomac E.C.Porges S.Pradhan J.J.Prisciandaro N.A.Puts C.D.Rae F.Reyes-Madrigal T.P.L.Roberts C.E.Robertson J.T.Rosenberg D-G.Rotaru R.L.O'Gorman Tuura M.G.Saleh K.Sandberg R.Sangill K.Schembri A.Schrantee N.A.Semenova D.Singel R.Sitnikov J.Smith Y.Song C.Stark D.Stoffers S.P.Swinnen R.Tain C.Tanase S.Tapper M.Tegenthoff T.Thiel M.Thioux P.Truong P.van Dijk N.Vella R.Vidyasagar A.Vovk G.Wang L.T.Westlye T.K.Wilbur W.R.Willoughby M.Wilson H-J.Wittsack A.J.Woods Y-C.Wu J.Xu M.Y.Lopez D.K.W.Yeung Q.Zhao X.Zhou G.Zupan R.A.E.Edden article CervantesDBDB2021 2315 Monte Carlo calculation of detector perturbation and quality correction factors in a 1.5 T magnetic resonance guided radiation therapy small photon beams Physics in Medicine & Biology 2021 11 66 22 19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy 225004 magnetic fields, small fields, perturbation factors, quality correction factors, MRgRT, ionization chambers, solid-state detectors EMPIR 2019: Pre-Co-Normative IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ac3344 NA Y.Cervantes J.Duchaine I.Billas S.Duane H.Bouchard article RazoukBHH2021 2324 Towards accurate measurements of specific heat of solids by drop calorimetry up to 3000 °C Thermal Science and Engineering Progress 2021 11 26 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties 101130 Drop calorimetry, Specific heat, High temperature, Metrology EMPIR 2017: Industry Elsevier BV 30 2451-9049 10.1016/j.tsep.2021.101130 NA R.Razouk O.Beaumont J.Hameury B.Hay article RipaIGSGFBLDG2021_2 2694 Corrigendum: Refractive index gas thermometry between 13.8 K and 161.4 K (2021 Metrologia 58 025008) Metrologia 2021 10 25 58 6 18SIB02: Real-K: Realising the redefined kelvin 069501 refractive index gas thermometry EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ac2d9e NA D.M.Ripa D.Imbraguglio C.Gaiser P.P.M.Steur D.Giraudi M.Fogliati M.Bertinetti G.Lopardo R.Dematteis R.M.Gavioso article ZeichhardtFDBHSHIVHVMCGSOEBHK2021 2777 The Dangers of Using Cq to Quantify Nucleic Acid in Biological Samples: A Lesson From COVID-19 Clinical Chemistry 2021 10 22 68 1 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis 153-162 SARS-CoV-2, RT-qPC, EQA https://academic.oup.com/clinchem/article/68/1/153/6385233#325300656
https://zenodo.org/record/6637873/files/18HLT03%20Septimet%20Supplementary%20Funding%20Acknowledgement%20CLIN%20CHEM.pdf?download=1 EMPIR 2018: Health Oxford University Press (OUP) 30 0009-9147, 1530-8561 NA https://zenodo.org/record/6637873 H.Zeichhardt C.A.Foy U.Dühring Y-K.Bae S.Hingley-Wilson N.Storey K.H.Hong J.In J.Vandesompele K.Harris J.Verwilt J.Moran-Gilad S.Cowen H-P.Grunert G.Stewart D.M.O’Sullivan D.Evans J.Braybrook Ji.F.Huggett M.Kammel article DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021 2365 A Comprehensive Description of Multi-Term LSM for Applying Multiple a Priori Constraints in Problems of Atmospheric Remote Sensing: GRASP Algorithm, Concept, and Applications Frontiers in Remote Sensing 2021 10 19 2 19ENV04: MAPP: Metrology for aerosol optical properties GRASP, Radiative Transfer, Inversion model https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full EMPIR 2019: Environment Frontiers Media SA 30 2673-6187 10.3389/frsen.2021.706851 NA O.Dubovik D.Fuertes P.Litvinov A.Lopatin T.Lapyonok I.Doubovik F.Xu F.Ducos C.Chen B.Torres Y.Derimian L.Li M.Herreras-Giralda M.Herrera Y.Karol C.Matar G.L.Schuster R.Espinosa A.Puthukkudy Z.Li J.Fischer R.Preusker J.Cuesta A.Kreuter A.Cede M.Aspetsberger D.Marth L.Bindreiter A.Hangler V.Lanzinger C.Holter C.Federspiel article HayBFFGRDH2021 2250 Uncertainty Assessment for Very High Temperature Thermal Diffusivity Measurements on Molybdenum, Tungsten and Isotropic Graphite International Journal of Thermophysics 2021 10 17 43 1 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties High temperature, Isotropic graphite, Molybdenum, Thermal diffusivity, Tungsten, Uncertainty EMPIR 2017: Industry Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-021-02926-6 NA B.Hay O.Beaumont G.Failleau N.Fleurence M.Grelard R.Razouk G.Davée J.Hameury article ArrheniusABMBWBGLCSBNR2021 2482 Strategies for the sampling of hydrogen at refuelling stations for purity assessment International Journal of Hydrogen Energy 2021 10 11 46 70 19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2 34839-34853 Hydrogen,Refuelling stations,Sampling device,Fuel quality assessment https://www.sciencedirect.com/science/article/pii/S0360319921031694 EMPIR 2019: Energy Elsevier 30 0360-3199 10.1016/j.ijhydene.2021.08.043 NA K.Arrhenius T.A.Aarhaug T.Bacquart A.Morris S.Bartlett L.Wagner C.Blondeel B.Gozlan Y.Lescornes N.Chramosta C.Spitta E.Basset Q.Nouvelot M.Rizand article SteindlSABK2021 2345 On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001) New Journal of Physics 2021 10 23 10 17FUN06: SIQUST: Single-photon sources as new quantum standards 103029 Quantum Dots, carrier dynamics, optical spectroscopy, memory devices EMPIR 2017: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ac2bd6 NA P.Steindl E.M.Sala B.Alén D.Bimberg P.Klenovský article MilanoPMRHBIR2021 2676 In materia reservoir computing with a fully memristive architecture based on self-organizing nanowire networks Nature Materials 2021 10 21 2 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 195-202 memristive devices, memristive networks, nanowire networks, reservoir computing, physical computing https://iris.polito.it/retrieve/handle/11583/2936403/537201/05_Manuscript.pdf EMPIR 2020: Fundamental Springer Science and Business Media LLC 30 1476-1122, 1476-4660 10.1038/s41563-021-01099-9 NA G.Milano G.Pedretti K.Montano S.Ricci S.Hashemkhani L.Boarino D.Ielmini C.Ricciardi article SteindlSABK20210 2345 On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001) New Journal of Physics 2021 10 23 10 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 103029 Quantum Dots, carrier dynamics, optical spectroscopy, memory devices EMPIR 2020: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ac2bd6 NA P.Steindl E.M.Sala B.Alén D.Bimberg P.Klenovský article SteindlSABK20211 2345 On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001) New Journal of Physics 2021 10 23 10 20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology 103029 Quantum Dots, carrier dynamics, optical spectroscopy, memory devices EMPIR 2020: Industry IOP Publishing 30 1367-2630 10.1088/1367-2630/ac2bd6 NA P.Steindl E.M.Sala B.Alén D.Bimberg P.Klenovský article BukerSKBPS2021 2207 Investigations on the Influence of Total Water Hardness and pH Value on the Measurement Accuracy of Domestic Cold Water Meters MDPI Water 2021 9 29 13 19 17IND13: Metrowamet: Metrology for real-world domestic water metering domestic water meters; total hardness; pH value; wear test; flow measurement EMPIR 2017: Industry 30 10.3390/w13192701 NA O.Büker K.Stolt C.Kroner M.Benkova J.Pavlas V.Seypka proceedings SeferiCB2021 2268 Review of PMU Algorithms Suitable for Real-Time Operation With Digital Sampled Value Data 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 2021 9 29 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 6 Algorithms, frequency, phasor measurement unit, real-time operation, ROCOF, sample value data, synchrophasor https://strathprints.strath.ac.uk/78316/ EMPIR 2017: Industry IEEE Online IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 978-1-7281-6923-1 2475-2304 10.1109/AMPS50177.2021.9586034 NA Y.Seferi R.G.Q.Cetina S.M.Blair proceedings OlivanMBC2021 2313 An IEC 61850 Sampled Values-based Analyzer for Power Quality applications on Smart Substations 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 2021 9 29 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation Power quality,substation automation, smart grids, measuremen ttechniques, instrument transformers EMPIR 2017: Industry IEEE Cagliari, Italy 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 978-1-7281-6923-1 2475-2304 NA https://zenodo.org/record/5703000 M.A.Oliván A.Mareca J.Bruna D.Cervero proceedings ChenCDLMLB2021 2327 Novel Calibration systems for the dynamic and steady-state testing of digital instrument transformers 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems 2021 9 29 - - 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 6 Power quality, substation automation, smart grids, measurement techniques, instrument transformers https://ieeexplore.ieee.org/document/9586040 EMPIR 2017: Industry IEEE Cagliari, Italy 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 Electronic ISBN:978-1-7281-692 Electronic ISSN: 2475-2304 Pri NA https://doi.org/10.5281/zenodo.5717933 Y.Chen G.Crotti A.Dubowik P.S.Letizia E.Mohns M.Luiso J.Bruna article FogliettaGBCBFDSC2021 2263 5-Aminolevulinic Acid Triggered by Ultrasound Halts Tumor Proliferation in a Syngeneic Model of Breast Cancer Pharmaceuticals 2021 9 25 14 10 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 972 ultrasound; sonodynamic therapy; breast cancer EMPIR 2018: Health MDPI AG 30 1424-8247 10.3390/ph14100972 NA F.Foglietta G.Gola E.Biasibetti M.T.Capucchio I.Bruni A.Francovich G.Durando L.Serpe R.Canaparo article CzompolyBGPO2021 2484 Characterization of unique aerosol pollution episodes in urban areas using TXRF and TXRF-XANES. Atmospheric Pollution Research 2021 9 25 12 11 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 101214 Atmospheric aerosols, TXRF, XANES, Elemental size distribution, Elemental speciation, Cascade impactor EMPIR 2019: Environment Elsevier B.V. 30 1309-1042 10.1016/j.apr.2021.101214 NA O.Czömpöly E.Börcsök V.Groma S.Pollastri J.Osán article RottgerRGVCOHCCBIRKCAYFMM2021 2224 New metrology for radon at the environmental level Measurement Science and Technology 2021 9 23 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level radon, metrology, tracer, environmental measurements EMPIR 2019: Environment IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac298d NA A.Röttger S.Röttger C.Grossi A.Vargas R.Curcoll P.Otáhal M.Á.Hernández-Ceballos G.Cinelli S.Chambers S.A.Barbosa M-R.Ioan I.Radulescu D.Kikaj E.Chung T.Arnold C.Yver Kwok M.Fuente F.Mertes V.Morosh article GroscheKBK2021 2176 Validating frequency transfer via interferometric fiber links for optical clock comparisons New Journal of Physics 2021 9 20 23 9 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 093024 optical frequency dissemination, optical fiber links, optical clocks, optical clock comparisons, ultra-stable lasers https://iopscience.iop.org/article/10.1088/1367-2630/ac21a0 EMPIR 2018: SI Broader Scope IOP Publishing 30 1367-2630 10.1088/1367-2630/ac21a0 NA G.Grosche A.Kuhl E.Benkler S.Koke article GroscheKBK20210 2176 Validating frequency transfer via interferometric fiber links for optical clock comparisons New Journal of Physics 2021 9 20 23 9 15SIB05: OFTEN: Optical frequency transfer - a European network 093024 optical frequency dissemination, optical fiber links, optical clocks, optical clock comparisons, ultra-stable lasers https://iopscience.iop.org/article/10.1088/1367-2630/ac21a0 EMPIR 2015: SI Broader Scope IOP Publishing 30 1367-2630 10.1088/1367-2630/ac21a0 NA G.Grosche A.Kuhl E.Benkler S.Koke article BuonacorsiSSTKHHRWB2021 2168 Non-adiabatic single-electron pumps in a dopant-free GaAs/AlGaAs 2DEG Applied Physics Letters 2021 9 13 119 11 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 114001 Single electron transport, quantum dot, dopant-free GaAs/AlGaAs system, quantum transport, single electron pump https://arxiv.org/abs/2102.13320 EMPIR 2017: Fundamental AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0062486 NA B.Buonacorsi F.Sfigakis A.Shetty M.C.Tam H.S.Kim S.R.Harrigan F.Hohls M.E.Reimer Z.R.Wasilewski J.Baugh article YamakawaATBFBKRD2021 2038 Hg isotopic composition of one-year-old spruce shoots: Application to long-term Hg atmospheric monitoring in Germany Chemosphere 2021 9 279 16ENV01: MercOx: Metrology for oxidised mercury 130631 Hg isotopic composition, spruce shoots, Hg atmospheric monitoring EMPIR 2016: Environment Elsevier BV 30 0045-6535 10.1016/j.chemosphere.2021.130631 NA A.Yamakawa D.Amouroux E.Tessier S.Bérail I.Fettig J.P.G.Barre J.Koschorreck H.Rüdel O.F.X.Donard article EssBKGV2021 2081 Coated soot particles with tunable, well-controlled properties generated in the laboratory with a miniCAST BC and a micro smog chamber Journal of Aerosol Science 2021 9 157 18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants 105820 soot, aerosol, secondary organic matter, calibration, black carbon, absorption photometers EMPIR 2018: Health Elsevier BV 30 0021-8502 10.1016/j.jaerosci.2021.105820 NA M.N.Ess M.Bertò A.Keller M.Gysel-Beer K.Vasilatou article TeirLWHBFPL2021 2254 In-Line Measurement of the Surface Texture of Rolls Using Long Slender Piezoresistive Microprobes Sensors 2021 9 21 17 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 5955 silicon microprobe, high speed, roughness, paper machine roll, metrology EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s21175955 NA L.Teir T.Lindstedt T.Widmaier B.Hemming U.Brand M.Fahrbach E.Peiner A.Lassila article StoreyBPOHWBH2021 2597 Single base mutations in the nucleocapsid gene of SARS-CoV-2 affects amplification efficiency of sequence variants and may lead to assay failure Journal of Clinical Virology Plus 2021 9 1 3 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis 100037 SARS-CoV-2, Nucleocapsid, Mutations, PCR, Failure, Silico https://www.sciencedirect.com/science/article/pii/S2667038021000296 EMPIR 2018: Health Elsevier BV 30 2667-0380 10.1016/j.jcvp.2021.100037 NA N.Storey J.R.Brown R.P.A.Pereira D.M.O'Sullivan J.F.Huggett R.Williams J.Breuer K.A.Harris article FerreroBCVHYACMT2021 2146 Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes Nanomaterials 2021 8 25 11 9 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 2179 nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations EMPIR 2018: Health MDPI 30 2079-4991 10.3390/nano11092179 NA R.Ferrero G.Barrera F.Celegato M.Vicentini H.Hüseyin N.Yıldız C.Atila Dinçer M.Coïsson A.Manzin P.Tiberto article KneeviMBBIKMNNWi2021 2111 Investigations into the basic properties of different passive dosimetry systems used in environmental radiation monitoring in the aftermath of a nuclear or radiological event Radiation Measurements 2021 8 146 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 106615 Passive dosimetry systems, Environmental radiation monitoring, Nuclear or radiological event EMPIR 2016: Environment Elsevier BV 30 1350-4487 10.1016/j.radmeas.2021.106615 NA Ž.Knežević M.Majer Z.Baranowska O.C.Bjelac G.Iurlaro N.Kržanović F.Mariotti M.Nodilo S.Neumaier K.Wołoszczuk M.Živanović article EdlerBGJTAASZ2021 2137 Pt-40%Rh Versus Pt-6%Rh Thermocouples: An emf-Temperature Reference Function for the Temperature Range 0 °C to 1769 °C International Journal of Thermophysics 2021 8 42 11 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 1-13 Noble metal thermocouples, Reference function, Thermoelectric stability and homogeneity https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf. EMPIR 2017: Industry Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-021-02895-w NA F.Edler J.Bojkovski C.Garcia Izquerdo M.Jose Martin D.Tucker N.Arifovic S.L.Andersen L.Šindelárová V.Žužek article SousaBDFPRM2021 2153 Uncertainty calculation methodologies in microflow measurements: Comparison of GUM, GUM-S1 and Bayesian approach Measurement 2021 8 181 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards 109589 Uncertainty evaluation; Accuracy; Microflow measurement; Syringe pump; Gravimetric method; Bayesian approach EMPIR 2017: Pre-Co-Normative Elsevier BV 30 0263-2241 10.1016/j.measurement.2021.109589 NA J.A.Sousa E.Batista S.Demeyer N.Fischer O.Pellegrino A.S.Ribeiro L.L.Martins article uekB2021 2280 Miniature iron-carbon eutectic point crucible for the calibration of thermometers Measurement 2021 8 181 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 109619 temperature, calibration, melting point, iron-carbon eutectic, crucible EMPIR 2017: Industry Elsevier BV 30 0263-2241 10.1016/j.measurement.2021.109619 NA V.Žužek J.Bojkovski article BatistaG2021 2278 Improving infusion dosing accuracy for patient safety European Pharmaceutical Review 2021 8 26 4 18HLT08: MEDDII: Metrology for drug delivery 8-10 Drug deliverPatient safetyInfusion errors https://www.europeanpharmaceuticalreview.com/article/160985/european-pharmaceutical-review-issue-4-2021/ EMPIR 2018: Health Russell Publishing 30 1360-8606 NA ISSN 1360-8606 E.Batista E.Graham article BillasBOD2021 2316 Traceable reference dosimetry in MRI guided radiotherapy using alanine: calibration and magnetic field correction factors of ionisation chambers Physics in Medicine & Biology 2021 8 66 16 19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy 165006 MRI-linac, magnetic field, traceable reference dosimetry, magnetic field correction factors, alanine dosimetry EMPIR 2019: Pre-Co-Normative IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ac0680 NA I.Billas H.Bouchard U.Oelfke S.Duane article FuchsJKMB2021 2508 A cavity-based optical antenna for color centers in diamond APL Photonics 2021 8 6 8 17FUN06: SIQUST: Single-photon sources as new quantum standards 086102 color centres, diamond, optical antenna, single-photon source https://aip.scitation.org/doi/10.1063/5.0057161 EMPIR 2017: Fundamental AIP Publishing 30 2378-0967 10.1063/5.0057161 NA P.Fuchs T.Jung M.Kieschnick J.Meijer C.Becher article BarrattRCSKE2021 2167 Asymmetric arms maximize visibility in hot-electron interferometers Physical Review B 2021 7 30 104 3 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 035436 single electrons, electron interferometry, quantum transport, electron quantum optics https://arxiv.org/abs/2104.01653 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.104.035436 NA C.J.Barratt S.Ryu L.A.Clark H.-S.Sim M.Kataoka C.Emary article FogliettaPGBPDTSC2021 2264 Sonodynamic Treatment Induces Selective Killing of Cancer Cells in an In Vitro Co-Culture Model Cancers 2021 7 30 13 15 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 3852 ultrasound; sonodynamic therapy; cancer cells; membrane fluidity EMPIR 2018: Health MDPI AG 30 2072-6694 10.3390/cancers13153852 NA F.Foglietta V.Pinnelli F.Giuntini N.Barbero P.Panzanelli G.Durando E.Terreno L.Serpe R.Canaparo article RadtkeCKLSDAHNVRQLDBUL2021 2285 A unified pH scale for all solvents: part I – intention and reasoning (IUPAC Technical Report) Pure and Applied Chemistry 2021 7 30 93 9 17FUN09: UnipHied: Realisation of a Unified pH Scale 1049-1060 Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability EMPIR 2017: Fundamental Walter de Gruyter GmbH 30 0033-4545, 1365-3075 10.1515/pac-2019-0504 NA V.Radtke F.Camões I.Krossing I.Leito D.Stoica L.Deleebeeck B.Anes A.Heering T.Näykki S.Veltzé M.Roziková R.Quendera L.Liv N.Dániel F.Bastkowski E.Uysal N.Lawrence article MilanoLLBRV2021 2236 Structure‐Dependent Influence of Moisture on Resistive Switching Behavior of ZnO Thin Films Advanced Materials Interfaces 2021 7 28 8 16 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 2100915 effect of moisture on electroforming, electrical conductivity, memristors, nanostructures, resistive switching https://onlinelibrary.wiley.com/doi/10.1002/admi.202100915 EMPIR 2020: Fundamental Wiley 30 2196-7350, 2196-7350 10.1002/admi.202100915 NA G.Milano M.Luebben M.Laurenti L.Boarino C.Ricciardi I.Valov article RibeiroACSMLBSS2021 2198 Role of measurement uncertainty in the comparison of average areal rainfall methods Metrologia 2021 7 23 58 4 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards 044001 measurement uncertainty, rainfall, precipitation, estimating, arithmetic mean method, Thiessen polygon method, isohyetal method EMPIR 2017: Pre-Co-Normative IOP Publishing
Bristol, United Kingdom
30 0026-1394, 1681-7575 10.1088/1681-7575/ac0d49 NA A.S.Ribeiro M.C.Almeida M.G.Cox J.A.Sousa L.Martins D.Loureiro R.Brito M.Silva A.C.Soares
article TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021 2260 A multicentre and multi-national evaluation of the accuracy of quantitative Lu-177 SPECT/CT imaging performed within the MRTDosimetry project EJNMMI Physics 2021 7 23 8 1 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom EMPIR 2015: Health Springer Science and Business Media LLC 30 2197-7364 10.1186/s40658-021-00397-0 NA J.Tran-Gia A.M.Denis-Bacelar K.M.Ferreira A.P.Robinson N.Calvert A.J.Fenwick D.Finocchiaro F.Fioroni E.Grassi W.Heetun S.J.Jewitt M.Kotzassarlidou M.Ljungberg D.R.McGowan N.Scott J.Scuffham K.S.Gleisner J.Tipping J.Wevrett M.Bardiès S.Berenato I.Bilas C.Bobin M.Capogni M.Chauvin S.COLLINS M.Cox J.Dabin M.D’Arienzo J.Gustafsson A.Hallam T.Kalathas G.Kayal G.Lorusso F-J.Maringer D.Morgan V.Smyth J.Solc L.Štemberková L.Struelens A.Vergara-Gil H.Wiedner M.Lassmann article NissilaFKMIJBKKOBMGK2021 2138 Driving a low critical current Josephson junction array with a mode-locked laser Applied Physics Letters 2021 7 19 119 3 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 032601 Josephson voltage standard, Josephson effect, Superconducting device, Laser, Photodiode EMPIR 2015: SI Broader Scope AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0060804 NA J.Nissilä T.Fordell K.Kohopää E.Mykkänen P.Immonen R.N.Jabdaraghi E.Bardalen O.Kieler B.Karlsen P.A.Øhlckers R.Behr A.J.Manninen J.Govenius A.Kemppinen article KruskopfBPCPREPPGS2021 2113 Graphene Quantum Hall Effect Devices for AC and DC Electrical Metrology IEEE Transactions on Electron Devices 2021 7 68 7 18SIB07: GIQS: Graphene impedance quantum standard 3672-3677 Alternating current, dissipation factor,double-shield, epitaxial graphene, magnetocapacitance,magnetotransport, precision measurements, quantized Hallresistance (QHR) standards, quantum Hall effect (QHE),superconducting contacts https://ieeexplore.ieee.org/document/9446081 EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9383, 1557-9646 10.1109/TED.2021.3082809 NA M.Kruskopf S.Bauer Y.Pimsut A.Chatterjee D.K.Patel A.F.Rigosi R.E.Elmquist K.Pierz E.Pesel M.Götz J.Schurr techreport KlingKRBRBS2021 2126 Specifications and testing strategies for measurement devices for noise exposure determination in the infrasound frequency range PTB Open Access Repository 2021 7 n. a. n. a. 19ENV03: Infra-AUV: Metrology for low-frequency sound and vibration 20210609 Sound level meters, Infrasound, Type approval, Noise exposure https://oar.ptb.de/resources/show/10.7795/EMPIR.19ENV03.RE.20210609 EMPIR 2019: Environment PTB 30 n. a. n. a. 10.7795/EMPIR.19ENV03.RE.20210609 NA C.Kling C.Koch M.Rust R.Barham D.Rodrigues S.Barrera Figueroa E.Sandermann Olsen article PrzyklenkBOEYAFPZCMRB2021 2104 New European Metrology Network for Advanced Manufacturing Measurement Science and Technology 2021 6 21 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing Advance Manufacturing, Metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), Stakeholder EMPIR 2019: Support for Networks IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac0d25 NA A.Przyklenk A.Balsamo D.O'Connor A.Evans T.Yandayan A.Akgöz O.Flys D.Phillips V.Zelený D.Czułek F.Meli C.Ragusa H.Bosse article GajjelaHDSSKBMBK2021 2614 Structural and compositional analysis of (InGa)(AsSb)/GaAs/GaP Stranski–Krastanov quantum dots Light: Science & Applications 2021 6 15 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 125 Ga)(AsSb)/GaAs/GaP, Stranski–Krastanov, quantum dots https://www.nature.com/articles/s41377-021-00564-z EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2047-7538 10.1038/s41377-021-00564-z NA R.S.R.Gajjela A.L.Hendriks J.O.Douglas E.M.Sala P.Steindl P.Klenovský P.A.J.Bagot M.P.Moody D.Bimberg P.M.Koenraad proceedings PrzyklenkBOEYAFZCPMRB2021 2123 AdvManuNet: Support for a European Metrology Network for Advanced Manufacturing Proceedings 21st euspen International Conference and Exhibition 2021 6 2021 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing advanced manufacturing, metrology, European metrology networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0 EMPIR 2019: Support for Networks Online Conference 21st euspen International Conference and Exhibition 07-06-2021 to 10-06-2021 30 NA https://www.euspen.eu/knowledge-base//ICE21292.pdf A.Przyklenk A.Balsamo D.O’Connor A.Evans T.Yandayan S.Akgöz O.Flys V.Zelený D.Czułek D.Phillips F.Meli C.Ragusa H.Bosse article DeleebeeckSNSRVHBLQCS2021 2183 Unified pH Measurements of Ethanol, Methanol, and Acetonitrile, and Their Mixtures with Water Sensors 2021 6 21 11 17FUN09: UnipHied: Realisation of a Unified pH Scale 3935 pHabs; ionic liquid salt bridge; commercial glass electrodes; water–alcohol mixture;non-aqueous pH EMPIR 2017: Fundamental MDPI AG 30 1424-8220 10.3390/s21113935 NA L.Deleebeeck A.Snedden D.Nagy Z.Szilágyi Nagyné M.Roziková M.Vičarová A.Heering F.Bastkowski I.Leito R.Quendera V.Cabral D.Stoica article FahrbachFBXCBP2021 2255 Customized piezoresistive microprobes for combined imaging of topography and mechanical properties Measurement: Sensors 2021 6 15 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 100042 Cantilever microprobe, Piezoresistive, Atomic force microscopy, Force–distance curves, Contact resonance, Lubricants EMPIR 2017: Industry Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100042 NA M.Fahrbach S.Friedrich H.Behle M.XU B.Cappella U.Brand E.Peiner article PicolloBBSORR2021 2266 Creation of pure non-crystalline diamond nanostructures via room-temperature ion irradiation and subsequent thermal annealing Nanoscale Advances 2021 6 3 14 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 4156-4165 Diamond, Irradiation, Carbon, Imaging https://pubs.rsc.org/en/Content/ArticleLanding/2021/NA/D1NA00136A EMPIR 2017: Fundamental Royal Society of Chemistry (RSC) 30 2516-0230 10.1039/d1na00136a NA F.Picollo A.Battiato F.Bosia F.Scaffidi Muta P.Olivero V.Rigato S.Rubanov article KnotekBCKHUKS2021 2369 Measurements of water consumption for the development of new test regimes for domestic water meters Flow Measurement and Instrumentation 2021 6 79 - 17IND13: Metrowamet: Metrology for real-world domestic water metering 101963 water consumption, consumption measurement, water meters, dynamic loads, billing EMPIR 2017: Industry Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2021.101963 NA S.Knotek M.Benkova N.Christophersen J.B.Kondrup S.Haack B.Unsal C.Kroner D.Schumann article BircherNKM2021 2411 Measurement of temperature induced X-ray tube transmission target displacements for dimensional computed tomography Precision Engineering 2021 6 72 2021 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 409-416 X-ray tube, Transmission target, Thermal stability, Focal spot, Finite element simulation, Dimensional metrology, X-ray computed tomography https://www.sciencedirect.com/science/article/pii/S0141635921001574?via%3Dihub EMPIR 2017: Industry Elsevier 30 0141-6359 10.1016/j.precisioneng.2021.06.002 NA B.Bircher S.Neuhaus A.Küng F.Meli article PicolloBBSORR20210 2266 Creation of pure non-crystalline diamond nanostructures via room-temperature ion irradiation and subsequent thermal annealing Nanoscale Advances 2021 6 3 14 17FUN06: SIQUST: Single-photon sources as new quantum standards 4156-4165 Diamond, Irradiation, Carbon, Imaging https://pubs.rsc.org/en/Content/ArticleLanding/2021/NA/D1NA00136A EMPIR 2017: Fundamental Royal Society of Chemistry (RSC) 30 2516-0230 10.1039/d1na00136a NA F.Picollo A.Battiato F.Bosia F.Scaffidi Muta P.Olivero V.Rigato S.Rubanov article LanzaMCCSDGNKRCMBP2021 2392 Calibration of non-catching precipitation measurement instruments: A review Meteorological Applications 2021 5 25 28 3 18NRM03: INCIPIT: Calibration and accuracy of non-catching instruments to measure liquid/solid atmospheric precipitation e2002 calibration, hydro-meteorology, meteomet, non-catching gauges, precipitation, precipitation measurement and analysis, uncertainty analysis, verification https://onlinelibrary.wiley.com/doi/10.1002/met.2002 EMPIR 2018: Pre-Co-Normative RMets 30 14698080 10.1002/met.2002 NA L.G.Lanza A.Merlone A.Cauteruccio E.Chinchella M.Stagnaro M.Dobre M.C.Garcia Izquierdo J.Nielsen H.Kjeldsen Y.A.Roulet G.Coppa C.Musacchio C.Bordianu M.Parrondo proceedings FahrbachPXB2021 2256 Self-excited Contact Resonance Operation of a Tactile Piezoresistive Cantilever Microprobe with Diamond Tip SMSI 2021 - Sensors and Instrumentation 2021 5 A5 MEMS Se 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 73-74 MEMS, microprobe, thermal actuator, piezoresistive cantilever, contact resonance https://www.ama-science.org/proceedings/details/3948 EMPIR 2017: Industry AMA Service GmbH, Von-Münchhausen-Str. 49, 31515 Wunstorf, Germany Digital SMSI 2021 Conference – Sensor and Measurement Science International 03-05-2021 to 06-05-2021 30 978-3-9819376-4-0 10.5162/SMSI2021/A5.4 NA M.Fahrbach E.Peiner M.XU U.Brand article RebufelloPALVTGBCVDG2021 2447 Protective Measurement—A New Quantum Measurement Paradigm: Detailed Description of the First Realization Applied Sciences 2021 5 11 9 17FUN06: SIQUST: Single-photon sources as new quantum standards 4260 Quantum Measurement, Weak Measurement, Quantum Metrology, Single Photons EMPIR 2017: Fundamental MDPI AG 30 2076-3417 10.3390/app11094260 NA E.Rebufello F.Piacentini A.Avella R.Lussana F.Villa A.Tosi M.Gramegna G.Brida E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article PeruzziRPEBu2021 2057 Survey of subrange inconsistency of long-stem standard platinum resistance thermometers Metrologia 2021 4 14 58 3 18SIB02: Real-K: Realising the redefined kelvin 035009 platinum resistance thermometers (SPRTs), statistical test, fixed-point uncertainty propagation (PoU) https://iopscience.iop.org/article/10.1088/1681-7575/abe8c1/pdf EMPIR 2018: SI Broader Scope IOP Publishing
Bristol, United Kingdom
30 0026-1394, 1681-7575 10.1088/1681-7575/abe8c1 NA APeruzzi R LRusby J VPearce LEusebio JBojkovski VŽužek
article MoroshRNKiKPIMSBIKS2021 2017 Investigation into the performance of dose rate measurement instruments used in non-governmental networks Radiation Measurements 2021 4 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 106580 Dosimetry networks.Dose rate meters.Environmental Radiation.Geiger counter.Metrological evaluation EMPIR 2016: Environment Elsevier BV 30 1350-4487 10.1016/j.radmeas.2021.106580 NA V.Morosh A.Röttger S.Neumaier F.Krasniqi M.Živanović N.Kržanović G.Pantelić G.Iurlaro F.Mariotti L.Sperandio S.Bell S.Ioannidis M.Kelly M.Sangiorgi article JoBAFSWTDRGKPR2021 2125 Quantum Hall Valley Splitters and a Tunable Mach-Zehnder Interferometer in Graphene Physical Review Letters 2021 4 126 14 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 146803 Graphene, electron interferometer, Mach-Zehnder, Quantum Hall Valley Beam Splitter https://arxiv.org/abs/2011.04958 EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.126.146803 NA M.Jo P.Brasseur A.Assouline G.Fleury H-S.Sim K.Watanabe T.Taniguchi W.Dumnernpanich P.Roche D.C.Glattli N.Kumada F.D.Parmentier P.Roulleau article SzulcMCBG2021 2394 Nonreciprocal spin-wave dynamics in Pt/Co/W/Co/Pt multilayers Phys. Rev. B 2021 4 103 13 17FUN08: TOPS: Metrology for topological spin structures 134404 Spin Waves, Brillouin light scattering, interfacial Dzyaloshinskii-Moriya interaction https://arxiv.org/abs/2112.11206 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.103.134404 NA K. Szulc S. Mendisch F.Casoli M.Becherer G.Gubbiotti article ChaudharyMAOMPB2021 2656 Radiobiology Experiments With Ultra-high Dose Rate Laser-Driven Protons: Methodology and State-of-the-Art Frontiers in Physics 2021 4 9 1 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates protontherapy, cancer, radiobiology, laser-driven ions, particle accelerator, ultra-high dose rate EMPIR 2018: Health Frontiers Media SA 30 2296-424X 10.3389/fphy.2021.624963 NA P.Chaudhary G.Milluzzo H.Ahmed B.Odlozilik A.McMurray K.M.Prise M.Borghesi article GruberBALBPCPDTCFSQ2021 2028 Comparison of radon mapping methods for the delineation of radon priority areas – an exercise Journal of the European Radon Association 2021 3 31 2 2021 16ENV10: MetroRADON: Metrology for radon monitoring 1-14 radon, mapping, prediction, interpolation, radon priority areas, risk, hazard https://radonjournal.net/index.php/radon/article/view/5755 EMPIR 2016: Environment European Radon Association 30 2736-2272 10.35815/radon.v2.5755 NA V.Gruber S.Baumann O.Alber C.Laubichler P.Bossew E.Petermann G.Ciotoli A.Pereira F.Domingos F.Tondeur G.Cinelli A.Fernandez C.Sainz L.Quindos-Poncela article BukerSLWPM2021 2188 A unique test facility for calibration of domestic flow meters under dynamic flow conditions Flow Measurement and Instrumentation 2021 3 29 79 17IND13: Metrowamet: Metrology for real-world domestic water metering Test facility, Dynamic flow measurement, Domestic water meters, Calibration, Flow meter accuracy EMPIR 2017: Industry 30 0955-5986 10.1016/j.flowmeasinst.2021.101934 NA O.Büker K.Stolt K.Lindström P.Wennergren O.Penttinen K.Mattiasson article deKromBZMBiGFKHE2021 2071 Comparability of calibration strategies for measuring mercury concentrations in gas emission sources and the atmosphere Atmospheric Measurement Techniques 2021 3 25 14 3 19NRM03: SI-Hg: Metrology for traceable protocols for elemental and oxidised mercury concentrations 2317-2326 Mercury, Metrology, Calibration, SI-traceability, Environmental https://amt.copernicus.org/articles/14/2317/2021/amt-14-2317-2021.html EMPIR 2019: Pre-Co-Normative Copernicus GmbH 30 1867-8548 10.5194/amt-14-2317-2021 NA I.de Krom W.Bavius R.Ziel E.A.McGhee R.J.C.Brown I.Živković J.Gačnik V.Fajon J.Kotnik M.Horvat H.Ent article SchmidtGNBvZMBSHWR2021 2616 Bimodal behavior of microlasers investigated with a two-channel photon-number-resolving transition-edge sensor system Physical Review Research 2021 3 19 3 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 013263 microlaser, transition-edge sensor, photon statistics, photon counting, nanophotonics https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.3.013263 EMPIR 2017: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.3.013263 NA M.Schmidt I.H.Grothe S.Neumeier L.Bremer M.von Helversen W.Zent B.Melcher J.Beyer C.Schneider S.Höfling J.Wiersig S.Reitzenstein article EssBIMGV2021 2011 Optical and morphological properties of soot particles generated by the miniCAST 5201 BC generator Aerosol Science and Technology 2021 3 15 16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols 1-25 soot, miniCAST, morphology, optical properties, calibration aerosol, combustion generator https://www.tandfonline.com/doi/full/10.1080/02786826.2021.1901847 EMPIR 2016: Environment Informa UK Limited
London, United Kingdom
30 0278-6826, 1521-7388 10.1080/02786826.2021.1901847 NA M.N.Ess M.Bertò M.Irwin R.L.Modini M.Gysel-Beer K.Vasilatou
article EichstadtGVSBK2021 2301 Toward Smart Traceability for Digital Sensors and the Industrial Internet of Things Sensors 2021 3 12 21 6 17IND12: Met4FoF: Metrology for the Factory of the Future 2019 Internet of Things, calibration, measurement uncertainty, traceability, semantics, ontology, sensor network, digital sensors, redundancy EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s21062019 NA S.Eichstädt M.Gruber A.P.Vedurmudi B.Seeger T.Bruns G.Kok article IurlaroBCBFKMMMNNSVWi2021 2018 Study on the uncertainty of passive area dosimetry systems for environmental radiation monitoring in the framework of the EMPIR “Preparedness” project Radiation Measurements 2021 3 142 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 106543 Passive dosimetry systems, Uncertainty budget, Decision threshold, Detection limitEnvironmental radiation monitoring, Emergency preparedness EMPIR 2016: Environment Elsevier BV 30 1350-4487 10.1016/j.radmeas.2021.106543 NA G.Iurlaro Z.Baranowska L.Campani O.C.Bjelac P.Ferrari Ž.Knežević M.Majer F.Mariotti B.Morelli S.Neumaier M.Nodilo L.Sperandio F.A.Vittoria K.Wołoszczuk M.Živanović article FailleauFBRHH2021 1993 Metal-carbon eutectic high temperature fixed points for in-situ calibration of radiation thermometers High Temperatures-High Pressures 2021 3 50 2 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties 149-165 Thermal Diffusivity, High Temperature, Radiation Thermometry, Fixed-Point https://www.oldcitypublishing.com/journals/hthp-home/hthp-issue-contents/hthp-volume-50-number-2-2021/19302-2/ EMPIR 2017: Industry Old City Publishing 30 1472-3441 10.32908/hthp.v50.1013 NA G.Failleau N.Fleurence O.Beaumont R.Razouk J.Hameury B.Hay article RipaIGSGFBLDG2021 2645 Refractive index gas thermometry between 13.8 K and 161.4 K Metrologia 2021 3 58 2 18SIB02: Real-K: Realising the redefined kelvin 025008 refractive index gas thermometry, thermodynamic temperature, ITS-90,microwave resonator EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/abe249 NA D.M.Ripa D.Imbraguglio C.Gaiser P.P.M.Steur D.Giraudi M.Fogliati M.Bertinetti G.Lopardo R.Dematteis R.M.Gavioso article OkhapkinTSSBP2021 2227 The thorium-229 low-energy isomer and the nuclear clock Nature Reviews Physics 2021 2 25 3 4 17FUN07: CC4C: Coulomb Crystals for Clocks 238-248 Atomic and molecular interactions with photonsExperimental nuclear physics https://oar.ptb.de/resources/show/10.7795/120.20211006 EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2522-5820 10.1038/s42254-021-00286-6 NA M.V.Okhapkin J. Thielking T.Schumm T.Sikorsky K.Beeks E.Peik article XuLFPB2021 1914 Investigating the Trackability of Silicon Microprobes in High-Speed Surface Measurements Sensors 2021 2 24 21 5 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 1557 roughness measurement, piezoresistive microprobe, high-speed surface measurement EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s21051557 NA M.XU Z.Li M.Fahrbach E.Peiner U.Brand article ZuccaCBSLCTFP2021 1918 Assessment of the Overall Efficiency in WPT Stations for Electric Vehicles Sustainability 2021 2 24 13 5 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 2436 electric vehicles; inductive charging; measurement uncertainty; power system measurements EMPIR 2016: Energy MDPI AG 30 2071-1050 10.3390/su13052436 NA M.Zucca V.Cirimele J.Bruna D.Signorino E.Laporta J.Colussi M.A.A.Tejedor F.Fissore U.Pogliano article SeegerOCGSSOALGFGKB2021 2069 Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy Atmosphere 2021 2 21 12 3 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 309-326 TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS EMPIR 2019: Environment MDPI 30 EISSN 2073-4433 10.3390/atmos12030309 NA S.Seeger J.Osán O.Czömpöly A.Gross H.Stoßnach L.Stabile M.Ochsenkuehn-Petropoulou L.Areti Tsakanika T.Lymperopoulou S.Goddard M.Fiebig F.Gaie-Levrel Y.Kayser B.Beckhoff article SeegerOCGSSOALGFGKB20210 2069 Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy Atmosphere 2021 2 21 12 3 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 309-326 TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS EMPIR 2016: Environment MDPI 30 EISSN 2073-4433 10.3390/atmos12030309 NA S.Seeger J.Osán O.Czömpöly A.Gross H.Stoßnach L.Stabile M.Ochsenkuehn-Petropoulou L.Areti Tsakanika T.Lymperopoulou S.Goddard M.Fiebig F.Gaie-Levrel Y.Kayser B.Beckhoff article SeegerOCGSSOALGFGKB20211 2069 Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy Atmosphere 2021 2 21 12 3 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 309-326 TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS EMPIR 2019: Environment MDPI 30 EISSN 2073-4433 10.3390/atmos12030309 NA S.Seeger J.Osán O.Czömpöly A.Gross H.Stoßnach L.Stabile M.Ochsenkuehn-Petropoulou L.Areti Tsakanika T.Lymperopoulou S.Goddard M.Fiebig F.Gaie-Levrel Y.Kayser B.Beckhoff article WundrackMDSPMSSSSB2021 2491 Liquid metal intercalation of epitaxial graphene: Large-area gallenene layer fabrication through gallium self-propagation at ambient conditions Physical Review Materials 2021 2 19 5 2 17FUN08: TOPS: Metrology for topological spin structures graphene, epitaxy, intercalation, 2-dimensional systems, condensed matter https://arxiv.org/abs/1905.12438 EMPIR 2017: Fundamental American Physical Society (APS) 30 2475-9953 10.1103/PhysRevMaterials.5.024006 NA S.Wundrack D.Momeni W.Dempwolf N.Schmidt K.Pierz L.Michaliszyn H.Spende A.Schmidt H.W.Schumacher R.Stosch A.Bakin manual BrunaRomeroPLHFCBAZZG2021 1907 Best practice guide for the assessment of EMF exposure from vehicle Wireless Power Transfer systems 2021 2 17 16ENG08: MICEV: Metrology for inductive charging of electric vehicles Dosimetry, Guidelines, Magnetic field measurements, Magnetic field calculation, Numerical models, Uncertainty, Wireless Power Transfer, Electric Vehicle https://www.micev.eu/theme/inrim/assets/doc/BPG_Micev_2021.pdf EMPIR 2016: Energy INRIM 30 NA ISBN: 978-88-945324-1-8 J.Bruna Romero L.Pichon E.Laporta S.Harmon F.Freschi B.Clarke O.Bottauscio P.Ankarson L.Zilberti M.Zucca R.Guilizzoni article FernandezScarioniBCSHALRCKS2021 2055 Thermoelectric Signature of Individual Skyrmions Physical Review Letters 2021 2 16 126 7 17FUN08: TOPS: Metrology for topological spin structures 1-6/077202 Magnetism, Nernst effect, Skyrmions, Thermomagnetic effects EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.126.077202 NA A.Fernández Scarioni C.Barton H.Corte-León S.Sievers X.Hu F.Ajejas W.Legrand N.Reyren V.Cros O.Kazakova H.W.Schumacher article BenedictoOrenesMMW2021 2743 Criticality-enhanced quantum sensing in ferromagnetic Bose-Einstein condensates: Role of readout measurement and detection noise Physical Review A 2021 2 16 103 2 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems BEC, Detection noise, quantum sensing EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9926, 2469-9934 NA https://arxiv.org/abs/2010.13133 D.Benedicto Orenes S.S.Mirkhalaf M.W.Mitchell E.Witkowska article BuonincontriKKMGCDCCMFMGSRZ2021 1697 Three dimensional MRF obtains highly repeatable and reproducible multi-parametric estimations in the healthy human brain at 1.5T and 3T NeuroImage 2021 2 226 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers 117573 MRI, Quantitation, Relaxometry, Brain, MR fingerprinting, Three dimensional, 3D https://www.sciencedirect.com/science/article/pii/S1053811920310582?via%3Dihub EMPIR 2018: Health Elsevier BV 30 1053-8119 10.1016/j.neuroimage.2020.117573 NA G.Buonincontri J.W.Kurzawski J.D.Kaggie T.Matys F.A.Gallagher M.Cencini G.Donatelli P.Cecchi M.Cosottini N.Martini F.Frijia D.Montanaro P.A.Gómez R.F.Schulte A.Retico L.Zilberti article GarciaAsenjoBAG2021 1924 Development of a Submillimetric GNSS-Based Distance Meter for Length Metrology Sensors 2021 2 21 4 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 1145 Global Navigation Satellite Systems (GNSS), length; metrology, multipath https://www.mdpi.com/1424-8220/21/4/1145 EMPIR 2018: SI Broader Scope MDPI AG 30 1424-8220 10.3390/s21041145 NA L.García-Asenjo S.Baselga C.Atkins P.Garrigues article ModiniCBIBPFEHMLMG2021 2010 Detailed characterization of the CAPS single-scattering albedo monitor (CAPS PMssa) as a field-deployable instrument for measuring aerosol light absorption with the extinction-minus-scattering method Atmospheric Measurement Techniques 2021 2 14 2 16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols 819-851 miniCAST 5201 black carbon (BC) generator; particle morphology; nanostructure; optical properties; photoacoustic absorption coefficient EMPIR 2016: Environment Copernicus GmbH 30 1867-8548 10.5194/amt-14-819-2021 NA R.L.Modini J.C.Corbin B.T.Brem M.Irwin M.Bertò R.E.Pileci P.Fetfatzis K.Eleftheriadis B.Henzing M.M.Moerman F.Liu T.Müller M.Gysel-Beer article LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021 2093 Roadmap on quantum nanotechnologies Nanotechnology 2021 2 32 16 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 162003 Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap EMPIR 2017: Fundamental IOP Publishing 30 0957-4484, 1361-6528 10.1088/1361-6528/abb333 NA A.Laucht F.Hohls N.Ubbelohde M.Fernando Gonzalez-Zalba D.J.Reilly S.Stobbe T.Schröder P.Scarlino J.V.Koski A.Dzurak C-H.Yang J.Yoneda F.Kuemmeth H.Bluhm J.Pla C.Hill J.Salfi A.Oiwa J.T.Muhonen E.Verhagen M.D.LaHaye H.H.Kim A.W.Tsen D.Culcer A.Geresdi J.A.Mol V.Mohan P.K.Jain J.Baugh article KoutsourakisEKB2021 1948 High resolution linearity measurements of photovoltaic devices using digital light processing projection Measurement Science and Technology 2021 1 29 16ENG02: PV-Enerate: Advanced PV energy rating digital light processing projection EMPIR 2016: Energy IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/abe162 NA G. Koutsourakis T.D.Eales I.Kroeger J.Blakesley article ShalmZBSSMAAMAFOMNK2021 2736 Device-independent randomness expansion with entangled photons Nature Physics 2021 1 28 17 4 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 452-456 Bell inequality test, Entangled photons EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 1745-2473, 1745-2481 NA https://arxiv.org/abs/1912.11158 L.K.Shalm Y.Zhang J.C.Bienfang C.Schlager M.J.Stevens M.D.Mazurek C.Abellán W.Amaya M.W.Mitchell M.A.Alhejji H.Fu J.Ornstein R.P.Mirin S.W.Nam E.Knill article ArduinoZHZBCB2021 1867 Heating of hip joint implants in MRI: The combined effect of RF and switched‐gradient fields Magnetic Resonance in Medicine 2021 1 22 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations gradient coil heating, hip prosthesis, MRI safety, numerical simulation, radiofrequency heating EMPIR 2017: Industry Wiley 30 0740-3194, 1522-2594 10.1002/mrm.28666 NA A.Arduino U.Zanovello J.Hand L.Zilberti R.Brühl M.Chiampi O.Bottauscio article SeferiBMS2021 1934 A Novel Arc Detection Method for DC Railway Systems Energies 2021 1 15 14 2 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems 444 pantograph-catenary system; current collection quality; arc detection; predictive maintenance; railway electrical networks; Hilbert transform; rail transportation; power quality disturbance SEG EMPIR 2016: Energy MDPI AG 30 1996-1073 10.3390/en14020444 NA Y.Seferi S.M.Blair C.Mester B.G.Stewart article SteierDBTOCC2021 1871 Insights from Transient Absorption Spectroscopy into Electron Dynamics Along the Ga‐Gradient in Cu(In,Ga)Se2 Solar Cells Advanced Energy Materials 2021 1 14 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 2003446 CIGS, transient absorption spectroscopy EMPIR 2016: Energy Wiley 30 1614-6832, 1614-6840 10.1002/aenm.202003446 NA L.Steier J.R.Durrant C.Bozal‐Ginesta A.N.Tiwari M.Ochoa R.Carron Y‐H.Chang article JenningerABBDGISJKRSSSTTW2021 1775 Development of a design for an ionisation vacuum gauge suitable as a reference standard Vacuum 2021 1 183 16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge 109884 Ionisation gauge, Hot cathode, Sensitivity, Simulation, Reference standard EMPIR 2016: Pre-Co-Normative Elsevier BV 30 0042-207X 10.1016/j.vacuum.2020.109884 NA B.Jenninger J.Anderson M.Bernien N.Bundaleski H.Dimitrova M.Granovskij C.Illgen J.Šetina K.Jousten P.Kucharski C.Reinhardt F.Scuderi R.A.S.Silva A.Stöltzel O.M.N.D.Teodoro B.Trzpil-Jurgielewicz M.Wüest article BagherRENWMZDHBL2021 1796 Crosstalk between Mast Cells and Lung Fibroblasts Is Modified by Alveolar Extracellular Matrix and Influences Epithelial Migration International Journal of Molecular Sciences 2021 1 22 2 18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants 506 lung fibroblasts, mast cells, epithelial cells, extracellular matrix, IL-6; tryptase, vascular endothelial growth factor, hepatocyte growth factor, idiopathic pulmonary fibrosis EMPIR 2018: Health MDPI AG 30 1422-0067 10.3390/ijms22020506 NA M.Bagher O.Rosmark L.Elowsson Rendin A.Nybom S.Wasserstrom C.Müller X-H.Zhou G.Dellgren O.Hallgren L.Bjermer A-K.Larsson-Callerfelt article DorscherHSLBLSPL2021 1846 Optical frequency ratio of a 171Yb+ single-ion clock and a 87Sr lattice clock Metrologia 2021 1 58 1 18SIB05: ROCIT: Robust Optical Clocks for International Timescales 015005 optical clock, ion clock, ytterbium, optical lattice clock, strontium, optical clock comparison, frequency ratio EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/abc86f NA S.Dörscher N.Huntemann R.Schwarz R.Lange E.Benkler B.Lipphardt U.Sterr E.Peik C.Lisdat article PiliaNLBDL2021 1965 ECGdeli - An open source ECG delineation toolbox for MATLAB SoftwareX 2021 1 13 18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management 100639 ECG waveform boundary detectionECG delineation12 lead ECG processing EMPIR 2018: Health Elsevier BV 30 2352-7110 10.1016/j.softx.2020.100639 NA N.Pilia C.Nagel G.Lenis S.Becker O.Dössel A.Loewe article BescondOFGQTLO2021 2140 Method for Preparation of a Candidate Reference Material of PM10 and PM2.5 Airborne Particulate Filters Loaded with Incineration Ash-Inter Comparison Results for Metal Concentrations Atmosphere 2021 1 12 1 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 67 aerosol; ambient air; EU air quality directives; ICP-MS intercomparison; incineration ash; particulate matter (PM); PM10; PM2.5; heavy metal analysis https://www.mdpi.com/2073-4433/12/1/67 EMPIR 2019: Environment MDPI AG 30 2073-4433 10.3390/atmos12010067 NA A.Bescond C.Oster P.Fisicaro S.Goddard P.Quincey L-A.Tsakanika T.Lymperopoulou M.Ochsenkuehn-Petropoulou inbook BELLGAABSIDPSVRIWPNKSD2021 2552 A NEW EUROPEAN RADIATION PROTECTION NETWORK DEVELOPED BY THE SUPPORT BSS JOINT NETWORK PROJECT 2021 1 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation radiation protection, metrology, national regulation, European regulation, supportBSS, ENM for Radiation Protection https://vinar.vin.bg.ac.rs/bitstream/handle/123456789/10125/309-314.pdf EMPIR 2019: Support for Networks RADIATION PROTECTION SOCIETY OF SERBIA AND MONTENEGRO, PROCEEDINGS, XXXI SYMPOSIUM RPSSM, 2021 30 78-86-7306-161-0 NA S.Bell D.Glavič-Cindro J.ALVES C.Adam-Guillermin R.Bernat A.Sabeta M-R.Ioan M.DERLACINSKI M.Pinto V.Sochor A.Veres .A.RÖTTGER M.Živanović B.Wens L.Persson R.Nylund N.Kržanović S.STANKOVIĆ S.DIMOVIĆ article KrehlikSBSK2021 1850 Optical multiplexing of metrological time and frequency signals in a single 100 GHz-grid optical channel IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control 2021 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks Time and frequency transfer, fiber optics, optical interleavers, wavelength multiplexing, Optical fibers, Optical filters, Optical variables control, Optical fiber networks, Ultrafast optics, Optical reflection, Time-frequency analysis EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0885-3010, 1525-8955 10.1109/TUFFC.2021.3053430 NA P.Krehlik L.Śliwczyński L.Buczek H.Schnatz J.Kronjäger article BehrEBGHKKLPPS2020 1857 A four-terminal-pair Josephson impedance bridge combined with a graphene quantized Hall resistance Measurement Science and Technology 2021 18SIB07: GIQS: Graphene impedance quantum standard impedance measurement,quantized Hall resistor,coaxial impedance bridge,graphene,Josephson arbitrary waveform synthesizer https://iopscience.iop.org/article/10.1088/1361-6501/abcff3/pdf EMPIR 2018: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/abcff3 NA S.Bauer R.Elmquist R.Behr M.Goetz J.Herick O.F.Kieler M.Kruskopf J.Lee L.Palafox Y.Pimsut J.Schurr article LovenDBKTRWI2021 1897 Toxicological effects of zinc oxide nanoparticle exposure: an in vitro comparison between dry aerosol air-liquid interface and submerged exposure systems Nanotoxicology 2021 18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants Air-liquid interface; NACIVT, aerosol, cell response, toxicity https://www.tandfonline.com/doi/full/10.1080/17435390.2021.1884301 EMPIR 2018: Health 30 10.1080/17435390.2021.1884301 NA K. Lovén J.Dobric D.A. Bölükbas M.Kåredal S.Tas J.Rissler D.E. Wagner C. Isaxon article LagouanelleBPZ2021 1923 Impact of parameters variability on the level of human exposure due to inductive power transfer IEEE Transactions on Magnetics 2021 Early Acce ea 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 1-4 Inductive power transfer, stochastic methods, human exposure https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=9364997 EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9464, 1941-0069 10.1109/TMAG.2021.3062702 NA P.Lagouanelle O.Bottauscio L.Pichon M.Zucca article MagniBSSMKSLGKLO2021 2136 Spin Hall magnetoresistance and spin orbit torque efficiency in Pt/FeCoB bilayers IEEE Transactions on Magnetics 2021 17FUN08: TOPS: Metrology for topological spin structures 1-1 spin Hall magnetoresistance, spin Hall effect, spin orbit torque, FeCoB, Pt EMPIR 2017: Fundamental Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9464, 1941-0069 10.1109/TMAG.2021.3084866 NA A.Magni V.Basso A.Sola G.Soares N.Meggiato M.Kuepferling W.Skowronski S.Lazarski K.Grochot M.V.Khanjani J.Langer B.Ocker article FergusonFLBHPR2021 2378 Metrology and Standardization of High Speed Pluggable Optical Interconnects Proceedings of the 9th International Conference on Photonics, Optics and Laser Technology 2021 PHOTOPTICS PHOTOPTICS 19SIP05: TTPWC: Technology Transfer of Photonic Waveguide Characterisation 63-67 Electro Optical Circuit Board (EOCB), Polymer Waveguides, Attenuation, Encircled Flux, BER. https://zenodo.org/record/5777190 EMPIR 2019: Support for Impact SCITEPRESS - Science and Technology Publications 30 2184-4364 10.5220/0010171900630067 NA R.Ferguson I.Fatadin K-M.Liu I.Barbeito C.Hart R.Pitwon D.Robinson proceedings KhanbabaeeRBRFHZTLdBGGCA2021 2377 SUPPORT FOR A EUROPEAN METROLOGY NETWORK ON RELIABLE RADIATION PROTECTION: GAPS IN RADIATION PROTECTION AND RELATED METROLOGY RAD Conference Proceedings 2021 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation Activity standards, new operational quantities in radiation protection, type testing, calibration, radon,reference field, pulsed radiation, dosimetry, standards, radiological emergency response EMPIR 2019: Support for Networks RAD Centre Herceg Novi, Montenegro 9th international conference on Radiation in various fields of research 14-06-2021 to 18-06-2021 30 10.21175/RadProc.2021.04 NA B.Khanbabaee A.Röttger R.Behrens S.Röttger S.Feige O.Hupe H.Zutz P.Toroi P.Leonard L.de la Fuente Rosales P.Burgess V.Gressier J–L.Gutiérrez Villanueva R.Cruz Suárez D.Arnold article RehbehnRBBSKMGMSC2021 2408 Sensitivity to new physics of isotope-shift studies using the coronal lines of highly charged calcium ions Physical Review A 2021 103 4 17FUN07: CC4C: Coulomb Crystals for Clocks L040801 research areas, dark matter, electronic transitions, particle interactions, techniques, spectroscopy, nuclear physics, atomic, molecular and optical EMPIR 2017: Fundamental American Physical Society 30 ISSN 2469-9934 (online), 2469- 10.1103/PhysRevA.103.L040801 NA N-H.Rehbehn M.K.Rosner H.Bekker J.C.Berengut P.O.Schmidt S.A.King P.Micke M.F.Gu R.Müller A.Surzhykov J.R.Crespo López-Urrutia article StarkWBCDKRGNOSSLSKLMSPC2021 2407 An ultralow-noise superconducting radio-frequency ion trap for frequency metrology with highly charged ions AIP Review of Scientific Instruments 2021 92 8 17FUN07: CC4C: Coulomb Crystals for Clocks 083203 Radio frequency cavities, radio-frequency quadrupole EMPIR 2017: Fundamental 30 10.1063/5.0046569 NA J.Stark C.Warnecke S.Bogen S.Chen E.A.Dijck S.Kühn M. K.Rosner A.Graf J.Nauta J-H.Oelmann L.Schmöger M.Schwarz D.Liebert L.J.Spieß S.A.King T.Leopold P.Micke P.O.Schmidt T.Pfeifer J.R.Crespo López-Urrutia article BernienGIDKBJ2021 2648 Traceable low-current measurements for a novel ionization gauge suitable as reference standard Measurement: Sensors 2021 18 December 2 20SIP01: ISO Gauge: Developing an ISO Technical Specification "Characteristics for a stable ionisation vacuum gauge" 100202 Ionization vacuum gaugeSensitivityLow currentTraceable measurementsMetrology EMPIR 2020: Support for Impact Elsevier Ltd 30 2665-9174 10.1016/j.measen.2021.100202 NA M.Bernien M.Götz C.Illgen D.Drung C.Krause T.Bock K.Jousten article VicarJJIBJBBST2021 2647 Electrons on a straight path: A novel ionisation vacuum gauge suitable as reference standard VACUUM 2021 189 2021 20SIP01: ISO Gauge: Developing an ISO Technical Specification "Characteristics for a stable ionisation vacuum gauge" 110239 Ionisation vacuum gaugeHot cathodeSensitivitySecondary electronsIon induced secondary electron yield https://arxiv.org/abs/2103.03566 EMPIR 2020: Support for Impact Elsevier Ltd 30 0042-207X 10.1016/j.vacuum.2021.110239 NA M.Vicar G.Jönnson B.Jenninger C.Illgen N.Bundaleski K.Jousten F.Boineau M.Bernien J.Šetina O.Teodoro proceedings GogyanKBZ2021 2747 Theoretical Investigation of Superradiant Lasing in 2-or 3-Level Atoms in an Optical Lattice 2021 JOINT CONFERENCE OF THE EUROPEAN FREQUENCY AND TIME FORUM AND IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM 2021 1 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems superradiance 2-3 level atoms EMPIR 2017: Fundamental on line Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS) 09-07-2022 to 14-07-2022 30 NA https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip A.Gogyan G.Kazakov M.Bober M.Zawada proceedings SinghTNMKGBBWZ2021 2732 Towards a Continuous Active Optical Atomic Clock With Cold Strontium Atoms 2021 JOINT CONFERENCE OF THE EUROPEAN FREQUENCY AND TIME FORUM AND IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM (IEEE EFTF-IFCS 2021) 2021 1 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems Contiunous clock, https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip EMPIR 2017: Fundamental on line Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS) 09-07-2021 to 14-07-2021 30 978-1-6654-3935-0 NA 2327-1914 V.Singh A.Tonoyan M.Naroznik P.Morzyński D.Kovacic A.Gogyan S.Bilicki M.Bober M.Witkowski M.Zawada proceedings ClivatiRRTBCL2021 2740 INRIM Sr Optical Clock: An Optically Loaded Apparatus for High-Stability Metrology Proceedings EFTF 2021 2021 1 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems OLC, Sr, 2D-MOT EMPIR 2017: Fundamental on line Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS) 07-07-2022 to 16-07-2022 30 NA https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip C.Clivati M.Risaro F.Rullo M.G.Tarallo M.Barbiero D.Calonico F.Levi proceedings ClivatiRRTBCL2021_2 2740 INRIM Sr Optical Clock: An Optically Loaded Apparatus for High-Stability Metrology Proceedings EFTF 2021 2021 1 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems OLC, Sr, 2D-MOT EMPIR 2017: Fundamental on line Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS) 07-07-2022 to 16-07-2022 30 NA https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip C.Clivati M.Risaro F.Rullo M.G.Tarallo M.Barbiero D.Calonico F.Levi article ForssenSSJBHAZ2020 1786 A transportable refractometer for assessment of pressure in the kPa range with ppm level precision ACTA IMEKO 2020 12 31 9 5 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 287-292 Refractometry; Pressure; Gas Modulation, GAMOR; Transportable https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09%20%282020%29-05-59 EMPIR 2018: SI Broader Scope IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i5.986 NA C.Forssén I.Silander D.Szabo G.Jönsson M.Bjerling T.Hausmaninger O.Axner M.Zelan article SilvestriBOW2020 1831 Towards an improved helium-based refractometer for pressure measurements ACTA IMEKO 2020 12 31 9 5 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 305 refractometry, Fabry-Perot, pressure measurement, quantum pascal https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09%20%282020%29-05-62 EMPIR 2018: SI Broader Scope IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i5.989 NA Z.Silvestri D.Bentouati P.Otal J-P.Wallerand proceedings FurtadoPQSLMAARLBCLA2020 1898 First density comparison on viscoelastic samples by oscillation-type densimetry ACTA IMEKO 2020 12 31 9 5 17RPT02: rhoLiq: Establishing traceability for liquid density measurements 79 EMPIR rhoLiq Project; oscillation-type density meter; viscoelasticity; comparison EMPIR 2017: Research Potential IMEKO International Measurement Confederation - IMEKO TC3, TC5, TC16 and TC2 16-11-2020 to 18-11-2020 30 2221-870X 10.21014/acta_imeko.v9i5.943 NA A.Furtado J.Pereira R.Quendera M.Schiebl E.Lenard E.Malejczyk A.Alic S.Alisic J.Rauch F.Lorenz A.Bescupschii A.Ciubara B.Laky R.Amsüss article ChouhanJHBGSBH2020 2033 Emerging tri‐s‐triazine‐based graphitic carbon nitride: A potential signal‐transducing nanostructured material for sensor applications Nano Select 2020 12 30 2 4 16ENV01: MercOx: Metrology for oxidised mercury 712-743 sorbent traps, tri‐s‐triazine‐based graphitic carbon nitride, nanostructured material, sonsors, mercury EMPIR 2016: Environment Wiley 30 2688-4011, 2688-4011 10.1002/nano.202000228 NA R.S.Chouhan I.Jerman D.Heath S.Bohm S.Gandhi V.Sadhu S.Baker M.Horvat article NaccaratoTMMMZPAPNMWSMMSBPSW2020 2035 A field intercomparison of three passive air samplers for gaseous mercury in ambient air Atmospheric Measurement Techniques 2020 12 29 16ENV01: MercOx: Metrology for oxidised mercury atmnospheric gaseous mercury, passive samplers, intercomparison EMPIR 2016: Environment Copernicus GmbH 30 10.5194/amt-2020-455 NA A.Naccarato A.Tassone M.Martino S.Moretti A.Macagnano E.Zampetti P.Papa J.Avossa N.Pirrone M.Nerentorp J.Munthe I.Wängberg G.W.Stupple C.P.J.Mitchell A.R.Martin A.Steffen D.Babi E.M.Prestbo F.Sprovieri F.Wania article YrjanaSIKLB2020 2182 Potentiometric Carboxylate Sensors Based on Carbazole-Derived Acyclic and Macrocyclic Ionophores Chemosensors 2020 12 24 9 1 17FUN09: UnipHied: Realisation of a Unified pH Scale 4 ion-selective electrodesanion receptorsionophorescarboxylateelectrode shell material EMPIR 2017: Fundamental MDPI AG 30 2227-9040 10.3390/chemosensors9010004 NA V.Yrjänä I.Saar M.Ilisson S.A.Kadam I.Leito J.Bobacka article DrAmatoVMBMBM2020 1874 Spectroscopic Techniques versus Pitot Tube for the Measurement of Flow Velocity in Narrow Ducts Sensors 2020 12 21 20 24 16ENV08: IMPRESS 2: Metrology for air pollutant emissions 7349 laser flow meter; Pitot tube; flow speed; time of flight; dilution method; flow simulation; flow turbulence; gas sensing applications EMPIR 2016: Environment MDPI AG 30 1424-8220 10.3390/s20247349 NA F.D’Amato S.Viciani A.Montori M.Barucci C.Morreale S.Bertagna G.Migliavacca article BowdenVHSH2020 2729 Improving the Q Factor of an Optical Atomic Clock Using Quantum Nondemolition Measurement Physical Review X 2020 12 15 10 4 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems Atomic and Molecular Physics EMPIR 2017: Fundamental American Physical Society (APS) 30 2160-3308 10.1103/PhysRevX.10.041052 NA W.Bowden A.Vianello I.R.Hill M.Schioppo R.Hobson article OlbrichSBSOS2020 1677 Identification of coherent structures in horizontal slug flow Flow Measurement and Instrumentation 2020 12 76 16ENG07: MultiFlowMet II: Multiphase flow reference metrology 101814 Slug flow, Coherent structures, Snapshot POD EMPIR 2016: Energy Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101814 NA M.Olbrich E.Schmeyer M.Bär M.Sieber K.Oberleithner S.Schmetler article DitaliaTchernijLCSPTBCPPDMAOSMGF2020 1730 Fluorine-based color centers in diamond Scientific Reports 2020 12 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 21537 Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-78436-6 NA S.Ditalia Tchernij T.Lühmann E.Corte F.Sardi F.Picollo P.Traina M.Brajković A.Crnjac S.Pezzagna Ž.Pastuović I.P.Degiovanni E.Moreva P.Aprà P.Olivero Z.Siketić J.Meijer M.Genovese J.Forneris article SchmelterKOFB2020 1764 On the influence of inlet perturbations on slug dynamics in horizontal multiphase flow – a computational study Metrologia 2020 12 16ENG07: MultiFlowMet II: Multiphase flow reference metrology multiphase flow, two-phase flow, gas-liquid flow, slug flow, computational fluid dynamics (CFD), inlet perturbation, random perturbation EMPIR 2016: Energy IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/abd1c9 NA S.Schmelter S.Knotek M.Olbrich A.Fiebach M.Baer article DitaliaTchernijLCSPTBCPPDMAOSMGF2020_2 1806 Fluorine-based color centers in diamond Scientific Reports 2020 12 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-78436-6 NA S.Ditalia Tchernij T.Lühmann E.Corte F.Sardi F.Picollo P.Traina M.Brajković A.Crnjac S.Pezzagna Ž.Pastuović I.P.Degiovanni E.Moreva P.Aprà P.Olivero Z.Siketić J.Meijer M.Genovese J.Forneris article BukerSdMM2020 1822 Investigations on pressure dependence of Coriolis Mass Flow Meters used at Hydrogen Refueling Stations Flow Measurement and Instrumentation 2020 12 76 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 101815 Hydrogen, Coriolis Mass Flow Meter, Flow metering, High pressure, Hydrogen Refueling Station EnG EMPIR 2016: Energy Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101815 NA O.Büker K.Stolt M.de Huu M.MacDonald R.Maury article SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020 1841 The European Joint Research Project UHDpulse – Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates Physica Medica 2020 12 80 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 134-150 Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project EMPIR 2018: Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2020.09.020 NA A.Schüller S.Heinrich C.Fouillade A.Subiel L.De Marzi F.Romano P.Peier M.Trachsel C.Fleta R.Kranzer M.Caresana S.Salvador S.Busold A.Schönfeld M. McEwen F.Gomez J.Solc C.Bailat V.Linhart J.Jakubek J.Pawelke M.Borghesi R-P.Kapsch A.Knyziak A.Boso V.Olsovcova C.Kottler D.Poppinga I.Ambrozova C-S.Schmitzer S.Rossomme M-C.Vozenin article HancockDBLBTDBHBM2020 1894 Arbitrarily large tomography with iterative algorithms on multiple GPUs using the TIGRE toolbox Journal of Parallel and Distributed Computing 2020 12 146 1 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 52-63 Computed TomographyIterative reconstructionSoftwaremulti-GPU https://arxiv.org/abs/1905.03748 EMPIR 2017: Industry Elsevier BV 30 0743-7315 10.1016/j.jpdc.2020.07.004 NA S.Hancock M.Dosanjh A.Biguri R.Lindroos R.Bryll H.Towsyfyan H.Deyhle T.Blumensath I.E.K.Harrane R.Boardman M.Mavrogordato inbook IoanRZTB2020 2624 Proiecte nationale si europene de metrologia radiatiilor, suport pentru implementarea Directivei 2013/59, in sanatate si protectia mediului 2020 12 19ENV02: RemoteALPHA: Remote and real-time optical detection of alpha-emitting radionuclides in the environment Remote detection, optical detection, alpha particles https://srrp.ro/wp-content/uploads/2020/12/Conf.Nat_._SRRp_-2020-A4-ver.12.pdf EMPIR 2019: Environment Conferinta Nationala Aniversara a Societatii Romane de Radioprotectie –„SRRp-30” 30 978-973-1985-64-0 NA 978-973-1985-64-0 M-R.Ioan I.Radulescu M.Zadehrafi L.Tugulan C.Barna article KrauseBNLS2020 2733 Simple and compact diode laser system stabilized to Doppler-broadened iodine lines at 633  nm Applied Optics 2020 11 30 59 34 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 10808 Iodine cell, laser system EMPIR 2017: Fundamental The Optical Society 30 1559-128X, 2155-3165 10.1364/AO.409308 NA F.Krause E.Benkler C.Nölleke P.Leisching U.Sterr article LopezMPSGBSCDK2020 1731 A study to develop a robust method for measuring the detection efficiency of free-running InGaAs/InP single-photon detectors EPJ Quantum Technology 2020 11 25 7 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 14 Quantum technologyQuantum radiometryDetection efficiencySingle-photon detectorsSingle-photon sourcesMetrology EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2662-4400, 2196-0763 10.1140/epjqt/s40507-020-00089-1 NA M.López A.Meda G.Porrovecchio R.A.Starkwood M.Genovese G.Brida M.Smid C.J.Chunnilall I.P.Degiovanni S.Kück article BuarMSPSi2020 1830 Statistics of a Sharp GP2Y Low-Cost Aerosol PM Sensor Output Signals Sensors 2020 11 24 20 23 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 6707 low-cost sensors; aerosol sensors; air quality sensors EMPIR 2019: Environment MDPI AG 30 1424-8220 10.3390/s20236707 NA K.Bučar J.Malet L.Stabile J.Pražnikar S.Seeger M.Žitnik article BuarMSPSi20200 1830 Statistics of a Sharp GP2Y Low-Cost Aerosol PM Sensor Output Signals Sensors 2020 11 24 20 23 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 6707 low-cost sensors; aerosol sensors; air quality sensors EMPIR 2016: Environment MDPI AG 30 1424-8220 10.3390/s20236707 NA K.Bučar J.Malet L.Stabile J.Pražnikar S.Seeger M.Žitnik article BarreQSDBTESdA2020 2036 Comparison of the Isotopic Composition of Hg and Pb in Two Atmospheric Bioaccumulators in a Pyrenean Beech Forest (Iraty Forest, Western Pyrenees, France/Spain) Frontiers in Environmental Chemistry 2020 11 23 1 16ENV01: MercOx: Metrology for oxidised mercury isotopic composition, mercury, biomonitoring EMPIR 2016: Environment Frontiers Media SA 30 2673-4486 10.3389/fenvc.2020.582001 NA J.P.G.Barre S.Queipo-Abad C.Sola-Larrañaga G.Deletraz S.Bérail E.Tessier D.Elustondo Valencia J.M.Santamaría A.de Diego D.Amouroux article FinizioWMHLBBMR2020 2380 Time-resolved visualization of the magnetization canting induced by field-like spin–orbit torques Applied Physics Letters 2020 11 23 117 21 17FUN08: TOPS: Metrology for topological spin structures 212404 X-ray microscopy, Ferromagnetic materials, Time resolved imaging, Spin-orbit interactions, Spin Hall effect EMPIR 2017: Fundamental AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0029816 NA S.Finizio S.Wintz S.Mayr A.J.Huxtable M.Langer J.Bailey G.Burnell C.H.Marrows J.Raabe article SachsePVSRBBHKSKH2020 1704 Assessing Optical and Electrical Properties of Highly Active IrOx Catalysts for the Electrochemical Oxygen Evolution Reaction via Spectroscopic Ellipsometry ACS Catalysis 2020 11 20 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 14210-14223 spectroscopic ellipsometry, electrocatalysis, oxygen evolution reaction, mesoporous iridium oxidefilms, non-destructive ambient analysis, intrinsic OER activity, complementary methodology and metrology EMPIR 2016: Energy American Chemical Society (ACS) 30 2155-5435, 2155-5435 10.1021/acscatal.0c03800 NA R.Sachse M.Pflüger J-J.Velasco-Vélez M.Sahre J.Radnik M.Bernicke D.Bernsmeier V-D.Hodoroaba M.Krumrey P.Strasser R.Kraehnert A.Hertwig article LodewyckLPBKK2020 1834 Universal formalism for data sharing and processing in clock comparison networks Physical Review Research 2020 11 20 2 4 18SIB05: ROCIT: Robust Optical Clocks for International Timescales 043269 atomic clocks, frequency comparison, frequency combs https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.2.043269 EMPIR 2018: SI Broader Scope American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.2.043269 NA J.Lodewyck R.Le Targat P-E.Pottie E.Benkler S.Koke J.Kronjäger article AqeelSTMMBBGPB2020 2388 Microwave Spectroscopy of the Low-Temperature Skyrmion State in Cu2OSeO3 Physical Review Letters 2020 11 17 126 1 17FUN08: TOPS: Metrology for topological spin structures 017202-1 - 017202-7 Lattice dynamics, Magnetic order, Magnetism, Magnetization dynamics, Skyrmions, Spin waves https://arxiv.org/abs/2011.07826 EMPIR 2017: Fundamental American Physical Society 30 1079-7114 10.1103/PhysRevLett.126.017202 NA A.Aqeel J. Sahliger T.Taniguchi S.Mändl D.Mettus H.Berger A.Bauer M.Garst C.Pfleiderer C.H.Back article KokurewiczSBSKHMKJ2020 1842 Dosimetry for New Radiation Therapy Approaches Using High Energy Electron Accelerators Frontiers in Physics 2020 11 13 8 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates Dosimetry, FLASH beams, Absorbed dose, ultra-high pulse dose rates, High Energy Electron Accelerators EMPIR 2018: Health Frontiers Media SA 30 2296-424X 10.3389/fphy.2020.568302 NA K.Kokurewicz A.Schüller E.Brunetti A.Subiel R.Kranzer T.Hackel M.Meier R-P.Kapsch D.A.Jaroszynsk article HeeringBS2020 1699 Glass electrode half-cells for measuring unified pH in ethanol–water mixtures Journal of Sensors and Sensor Systems 2020 11 11 9 2 17FUN09: UnipHied: Realisation of a Unified pH Scale 383-389 unified pH, pHabs, water-ethanol mixtures, glass electrode half-cells, ionic liquid, [N2225][NTf2] EMPIR 2017: Fundamental Copernicus GmbH 30 2194-878X 10.5194/jsss-9-383-2020 NA A.Heering F.Bastkowski S.Seitz article FerreroBCPPPSSVM2020 1740 An insight into the present capabilities of national metrology institutes for measuring sparkle Metrologia 2020 11 11 57 6 16NRM08: BiRD: Bidirectional reflectance definitions 065029 sparkle, texture, reflectance, contrast threshold, gonio-spectrophotometry EMPIR 2016: Pre-Co-Normative IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/abb0a3 NA A.Ferrero N.Basic J.Campos M.Pastuschek E.Perales G.Porrovecchio M.Smid A.Schirmacher J.L. Velázquez F.Martínez-Verdú proceedings MeisnerGSHSEGRMLBOGS2020 1922 Support for standardisation of high voltage testing with composite and combined wave shapes VDE High Voltage Technology 2020, ETG-Symposium 2020 11 11 19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes Electricity grids, high voltage testing, traceability, combined wave shapes, composite wave shapes, universal dividers, calibration SEG https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215 EMPIR 2019: Pre-Co-Normative VDE online VDE High Voltage Technology 2020 09-11-2020 to 11-11-2020 30 NA https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215 J.Meisner E.Gockenbach H.Saadeddine J.Havunen U.Schichler A-P.Elg F.Garnacho P.E.Roccato A.Merev K.Lahti K.Backhaus A.Orrea M.Gamlin T.Steiner article HeeringBS2020_2 2181 Glass electrode half-cells for measuring unified pH in ethanol–water mixtures Journal of Sensors and Sensor Systems 2020 11 11 9 2 17FUN09: UnipHied: Realisation of a Unified pH Scale 383-389 Glass electrode half-cells unified pHethanol–water mixtures EMPIR 2017: Fundamental Copernicus GmbH 30 2194-878X 10.5194/jsss-9-383-2020 NA A.Heering F.Bastkowski S.Seitz article HonickeWWKB2020 1688 Towards a calibration of laboratory setups for grazing incidence and total-reflection X-ray fluorescence analysis Spectrochimica Acta Part B: Atomic Spectroscopy 2020 11 174 17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques 106009 Gracing incidence X-ray fluorescenceLaboratory setupSolid angle characterization https://arxiv.org/abs/2003.05192 EMPIR 2017: Support for Impact Elsevier BV 30 0584-8547 10.1016/j.sab.2020.106009 NA P.Honicke U.Waldschläger T.Wiesner M.Krämer B.Beckhoff article IllgenJTBF2020 1695 Influence of ion induced secondary electron emission on the stability of ionisation vacuum gauges Vacuum 2020 11 16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge 109907 Ion induced secondary electron emissionIonisation vacuum gaugesXPS https://arxiv.org/abs/2011.08568 EMPIR 2016: Pre-Co-Normative Elsevier BV 30 0042-207X 10.1016/j.vacuum.2020.109907 NA C.Illgen K.Jousten O.M.N.D.Teodoro N.Bundaleski I.Figueiredo article BlakesleyKDHTMSA2020 1949 Effective Spectral Albedo from Satellite Data for Bifacial Gain Calculations of PV Systems 37th European Photovoltaic Solar Energy Conference and Exhibition 2020 11 16ENG02: PV-Enerate: Advanced PV energy rating 1292 - 1297 Albedo, Bificial PV Module https://zenodo.org/record/4055920 EMPIR 2016: Energy 30 NA 3-936338-73-6 J.C.Blakesley G. Koutsourakis S.Douglas J.K.L.Holder J.Torry F.Mukadam A.Schmid R.S.J.Abrams article BourgouinSHKPKM2020 1840 Calorimeter for Real-Time Dosimetry of Pulsed Ultra-High Dose Rate Electron Beams Frontiers in Physics 2020 10 30 8 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates ultra-high pulse dose rates, dosimetry, metrology, FLASH radiation therapy, calorimetry EMPIR 2018: Health Frontiers Media SA 30 2296-424X 10.3389/fphy.2020.567340 NA A.Bourgouin A.Schüller T.Hackel R.Kranzer D.Poppinga R-P.Kapsch M. McEwen article HuggettBBGHKKMMNPSSVVWZ2020 1862 Cautionary Note on Contamination of Reagents Used for Molecular Detection of SARS-CoV-2 Clinical Chemistry 2020 10 30 66 11 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis 1369-1372 SARS-CoV-2, RT-qPCR, contamination, false positive, molecular diagnosis https://academic.oup.com/clinchem/article/66/11/1369/5902447 EMPIR 2018: Health Oxford University Press (OUP) 30 0009-9147, 1530-8561 10.1093/clinchem/hvaa214 NA J.F.Huggett V.Benes S.A.Bustin J.A.Garson K.Harris M.Kammel M.Kubista T.D.McHugh J.Moran-Gilad T.Nolan M.W.Pfaffl M.Salit G.Shipley P.M.Vallone J.Vandesompele C.Wittwer H.Zeichhardt article SeferiBMS2020 1933 Power Quality Measurement and Active Harmonic Power in 25 kV 50 Hz AC Railway Systems Energies 2020 10 30 13 21 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems 5698 railway electrical networks; traction converter; power quality analysis; active power; harmonic power; electric energy meters EMPIR 2016: Energy MDPI AG 30 1996-1073 10.3390/en13215698 NA Y.Seferi S.M.Blair C.Mester B.G.Stewart article AlveseSousaGFFMMBA2020 1674 Calibration of Syringe Pumps Using Interferometry and Optical Methods International Journal of Biomedical and Biological Engineering 2020 10 23 14 10 18HLT08: MEDDII: Metrology for drug delivery 10011517 Calibration, interferometry, syringe pump, optical method, uncertainty https://publications.waset.org/10011517/pdf EMPIR 2018: Health WASET 30 ISNI:0000000091950263 NA ISNI:0000000091950263 J.Alves e Sousa I.Godinho M. do C.Ferreira A.Furtado R.Mendes R.Martins E.Batista M.Alvares article DorscherABSHSL2020 1719 Dynamical decoupling of laser phase noise in compound atomic clocks Communications Physics 2020 10 20 3 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 1-8 optical atomic clocks,dynamic decoupling,coherence time,decoherence EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2399-3650 10.1038/s42005-020-00452-9 NA S.Dörscher A.Al-Masoudi M.Bober R.Schwarz R.Hobson U.Sterr C.Lisdat article FurstYKKDLBHPM2020 1650 Coherent Excitation of the Highly Forbidden Electric Octupole Transition in Yb+172 Physical Review Letters 2020 10 16 125 16 18SIB05: ROCIT: Robust Optical Clocks for International Timescales 163001 Atomic spectra, Optical clocks, Coherent control, Cooling & trapping, Laser spectroscopy, Trapped Ions https://link.aps.org/doi/10.1103/PhysRevLett.125.163001 EMPIR 2018: SI Broader Scope American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.125.163001 NA H.A.Fürst C.H.Yeh D.Kalincev A.P.Kulosa L.S.Dreissen R.Lange E.Benkler N.Huntemann E.Peik T.E.Mehlstäubler article MantouvalouJSMKWHWGBGD2020 1689 Laboratory grazing-incidence X-ray fluorescence spectroscopy as an analytical tool for the investigation of sub-nanometer CrSc multilayer water window optics Spectrochimica Acta Part B: Atomic Spectroscopy 2020 10 10 174 17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques 105995 GIXRFMultilayer characterization https://arxiv.org/abs/2006.12198 EMPIR 2017: Support for Impact Elsevier BV 30 0584-8547 10.1016/j.sab.2020.105995 NA I.Mantouvalou P.Jonnard V.Szwedowski-Rammert E.Meltchakov B.Kanngießer M.Wu P.Honicke U.Waldschläger A.Gross J.Baumann G.Goetzke F.Delmotte article BergstrandJH2020 1643 Quantifying errors in GNSS antenna calibrations Journal of Geodesy 2020 10 94 10 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 105 Antenna, Calibration, GNSS, Local tie, Phase center offset, Phase center variation, Terrestrial reference frame, PCC, PCO, PCV, TRF EMPIR 2018: SI Broader Scope Springer Science and Business Media LLC 30 0949-7714, 1432-1394 10.1007/s00190-020-01433-0 NA S.Bergstrand P.Jarlemark M.Herbertsson article BremerWFTSKRHSPMGR2020 1803 Quantum dot single-photon emission coupled into single-mode fibers with 3D printed micro-objectives APL Photonics 2020 10 5 10 17FUN06: SIQUST: Single-photon sources as new quantum standards 106101 Quantum dot single-photon emission EMPIR 2017: Fundamental AIP Publishing 30 2378-0967 10.1063/5.0014921 NA L.Bremer K.Weber S.Fischbach S.Thiele M.Schmidt A.Kaganskiy S.Rodt A.Herkommer M.Sartison S.L.Portalupi P.Michler H.Giessen S.Reitzenstein article RomanoSMLPTMMBMAFGS2020 1839 Challenges in dosimetry of particle beams with ultra-high pulse dose rates Journal of Physics: Conference Series 2020 10 1662 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 012028 ultra-high pulse dose rates, dosimetry, metrology, electrons EMPIR 2018: Health IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1662/1/012028 NA F.Romano A.Subiel M.McManus N. D.Lee H.Palmans R.Thomas S.McCallum G.Milluzzo M.Borghesi A.McIlvenny H.Ahmed W.Farabolini A.Gilardi A.Schüller article SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI2020 1664 Intercontinental comparison of optical atomic clocks through very long baseline interferometry Nature Physics 2020 10 18SIB05: ROCIT: Robust Optical Clocks for International Timescales Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology http://hdl.handle.net/11696/64130 EMPIR 2018: SI Broader Scope Springer Science and Business Media LLC 30 1745-2473, 1745-2481 10.1038/s41567-020-01038-6 NA M.Sekido K.Takefuji H.Ujihara H.Hachisu N.Nemitz M.Tsutsumi T.Kondo E.Kawai R.Ichikawa K.Namba Y.Okamoto R.Takahashi J.Komuro C.Clivati F.Bregolin P.Barbieri A.Mura E.Cantoni G.Cerretto F.Levi G.Maccaferri M.Roma C.Bortolotti M.Negusini R.Ricci G.Zacchiroli J.Roda J.Leute G.Petit F.Perini D.Calonico M.Pizzocaro T.Ido article SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI20200 1664 Intercontinental comparison of optical atomic clocks through very long baseline interferometry Nature Physics 2020 10 17IND14: WRITE: Precision Time for Industry Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology http://hdl.handle.net/11696/64130 EMPIR 2017: Industry Springer Science and Business Media LLC 30 1745-2473, 1745-2481 10.1038/s41567-020-01038-6 NA M.Sekido K.Takefuji H.Ujihara H.Hachisu N.Nemitz M.Tsutsumi T.Kondo E.Kawai R.Ichikawa K.Namba Y.Okamoto R.Takahashi J.Komuro C.Clivati F.Bregolin P.Barbieri A.Mura E.Cantoni G.Cerretto F.Levi G.Maccaferri M.Roma C.Bortolotti M.Negusini R.Ricci G.Zacchiroli J.Roda J.Leute G.Petit F.Perini D.Calonico M.Pizzocaro T.Ido article SikorskyGHKGEMRDWBRSKSF2020 1642 Measurement of the Th229 Isomer Energy with a Magnetic Microcalorimeter Physical Review Letters 2020 9 28 125 14 17FUN07: CC4C: Coulomb Crystals for Clocks Th229 Isomer Energy, Magnetic Microcalorimeter https://arxiv.org/abs/2005.13340 EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.125.142503 NA T.Sikorsky J.Geist D.Hengstler S.Kempf L.Gastaldo C.Enss C.Mokry J.Runke C.E.Düllmann P.Wobrauschek K.Beeks V.Rosecker J.H.Sterba G.Kazakov T.Schumm A.Fleischmann article WelshvBCHLLLvNTWWJ2020 1707 Towards defining reference materials for measuring extracellular vesicle refractive index, epitope abundance, size and concentration Journal of Extracellular Vesicles 2020 9 24 9 1 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses 1816641 Calibration; exosomes; extracellular vesicles; microvesicles; optical analysis; reference materials; standardization; quality control; validation EMPIR 2018: Health 30 2001-3078 10.1080/20013078.2020.1816641 NA J.A. Welsh E.van der Pol B.A. Bettin D.R.F. Carter A.Hendrix M.Lenassi M-A. Langlois A.Llorente A.S.van de Nes R.Nieuwland V.Tang L.Wang K.W. Witwer J.C. Jones article deKromBZMBiGFKHE2020 2032 Comparability of calibration strategies for measuring mercury concentrations in gas emission sources and the atmosphere Atmospheric Measuremnt Techniques Discussion 2020 9 21 16ENV01: MercOx: Metrology for oxidised mercury Mercury, emissions, calibration, traceability EMPIR 2016: Environment Copernicus GmbH 30 10.5194/amt-2020-314 NA I.de Krom W.Bavius R.Ziel E.A.McGhee R.J.C.Brown I.Živković J.Gačnik V.Fajon J.Kotnik M.Horvat H.Ent article ZilbertiZABZ2020 1668 RF‐induced heating of metallic implants simulated as PEC: Is there something missing? Magnetic Resonance in Medicine 2020 9 16 85 2 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 583-586 MR safetyMedical implantsRF-induced heatingMagnetic Resonance ImagingSpecific Absorption Rate https://onlinelibrary.wiley.com/doi/full/10.1002/mrm.28512 EMPIR 2017: Industry Wiley 30 0740-3194, 1522-2594 10.1002/mrm.28512 NA L.Zilberti U.Zanovello A.Arduino O.Bottauscio L.Zilberti article IliBL2020 2152 Stability of AC current measurements using AC-DC shunts and the AC Quantum Voltmeter Proceedings 24rd IMEKO TC 4 International Symposium 2020 9 16 17RPT03: DIG-AC: A digital traceability chain for AC voltage and current AC-DC shunt, AC Quantum Voltmeter, low-frequency AC current, traceability EMPIR 2017: Research Potential 30 NA https://www.imeko.org/publications/tc4-2020/IMEKO-TC4-2020-69.pdf D.Ilić R.Behr J.Lee article WinterSVMRPKHLHDBBBBBBKSR2020 1950 Results of the Bifacial PV Cells and PV Modules Power Measurement Round Robin Activity of the PV-Enerate Project 37th European Photovoltaic Solar Energy Conference and Exhibition 2020 9 11 16ENG02: PV-Enerate: Advanced PV energy rating 877 - 882 Testing, PV Module, Bifacial PV EMPIR 2016: Energy 30 NA https://zenodo.org/record/4055707 S.Winter H.Sträter A.Vegas R.R.Molinero S.Riechelmann D.Pavanello R.Kenny W.Herrmann J.Lopez-Garcia D.Hinken S.Dittmann J.Bonilla M. Bliss K.Bothe J.C.Blakesley T.R.Betts G.Bellenda G. Koutsourakis A.Schmid M.Rauer article OlbrichBOS2020 1628 Statistical Characterization of Horizontal Slug Flow Using Snapshot Proper Orthogonal Decomposition International Journal of Multiphase Flow 2020 9 16ENG07: MultiFlowMet II: Multiphase flow reference metrology 103453 slug flowcharacterizationproper orthogonal decomposition EMPIR 2016: Energy Elsevier BV 30 0301-9322 10.1016/j.ijmultiphaseflow.2020.103453 NA M.Olbrich M.Bär K.Oberleithner S.Schmelter article GunkelDHLKRUBT2020 1684 Phonon‐Enhanced Near‐Field Spectroscopy to Extract the Local Electronic Properties of Buried 2D Electron Systems in Oxide Heterostructures Advanced Functional Materials 2020 9 30 46 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 2004767 2D electron systems, electronic properties, LaAlO/SrTiO, near-field spectroscopy, oxide heterostructure EMPIR 2016: Energy Wiley 30 1616-301X, 1616-3028 10.1002/adfm.202004767 NA F.Gunkel R.Dittmann A.Hoehl M.Lewin B.Kästner M‐A.Rose G.Ulrich J.Barnett T.Taubner article BrabH2020 1763 Ab initio calculation of the electron capture spectrum of 163Ho: Auger–Meitner decay into continuum states New Journal of Physics 2020 9 22 9 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters 093018 electron capture spectrum,line width,continuum,Auger Meitner,163Ho EMPIR 2017: Fundamental Maurits W. Haverkort 30 1367-2630 10.1088/1367-2630/abac72 NA M.Braβ M.W.Haverkort proceedings ChenMBR2020 1765 Development of a Wideband Current-to-Voltage Transformer Set for Currents up to 2 kA 2020 Conference on Precision Electromagnetic Measurements 2020 8 24 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation Wideband, current transformers, calibration, measurement uncertainty, instrument transformer SEG EMPIR 2017: Industry Zenodo Denver (Aurora), CO, USA, USA 2020 Conference on Precision Electromagnetic Measurements 24-08-2020 to 28-08-2020 30 NA https://zenodo.org/record/4348461 Y.Chen E.Mohns H.Badura P.Raether article CainSTLWKBLF2020 1615 In Situ Electric-Field Study of Surface Effects in Domain Engineered Pb(In1/2Nb1/2)O3-Pb(Mg1/3Nb2/3)O3-PbTiO3 Relaxor Crystals by Grazing Incidence Diffraction Crystals 2020 8 20 10 9 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 728 - https://electrosciences.co.uk/2020/08/27/grazing_incidence/ EMPIR 2016: Energy MDPI AG 30 2073-4352 10.3390/cryst10090728 NA M.G.Cain M.Staruch P.Thompson C.Lucas D.Wermeille Y.Kayser B.Beckhoff S.E.Lofland P.Finkel article ClivatiABBDDMMMNLPRRSSSTC2020 1773 Common-clock very long baseline interferometry using a coherent optical fiber link Optica 2020 8 20 7 8 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 1031 fiber links, coherent phase transfer, frequency dissemination with fibers, VLBI EMPIR 2018: SI Broader Scope The Optical Society 30 2334-2536 10.1364/OPTICA.393356 NA C.Clivati R.Aiello G.Bianco C.Bortolotti P.De Natale V.Di Sarno P.Maddaloni G.Maccaferri A.Mura M.Negusini F.Levi F.Perini R.Ricci M.Roma L.Santamaria Amato M.Siciliani de Cumis M.Stagni A.Tuozzi C.Clivati article SchinkePHWBKNW2020_2 1604 Calibrating spectrometers for measurements of the spectral irradiance caused by solar radiation Metrologia 2020 8 17 16ENG02: PV-Enerate: Advanced PV energy rating spectral irradiance, solar radiation, measurement uncertainty analysis, spectrometer, spectroradiometer, calibration, solar simulator EMPIR 2016: Energy IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/abafc5 NA C.Schinke H.Pollex D.Hinken M.Wolf K.Bothe I.Kroeger S.Nevas S.Winter article deKromBZEvvvvHvDCE2020 1994 Primary mercury gas standard for the calibration of mercury measurements Measurement 2020 8 16 169 2021 16ENV01: MercOx: Metrology for oxidised mercury 108351 Mercury, Metrology, Primary gas standard, Calibration, SI-traceability, Environmental EMPIR 2016: Environment Elsevier 30 0263-2241 10.1016/j.measurement.2020.108351 NA I.de Krom W.Bavius R.Ziel E.Efremov D.van Meer P.van Otterloo I.van Andel D.van Osselen M.Heemskerk A.M.H.van der Veen M.A.Dexter W.T.Corns H.Ent article GomezCGSPHFPTMB2020 1698 Rapid three-dimensional multiparametric MRI with quantitative transient-state imaging Scientific Reports 2020 8 13 10 1 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers Magnetic Resonance Imaging (MRI)Quantitative MRIMagnetic Resonance Fingerprinting https://www.nature.com/articles/s41598-020-70789-2 EMPIR 2018: Health Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-70789-2 NA P.A.Gómez M.Cencini M.Golbabaee R.F.Schulte C.Pirkl I.Horvath G.Fallo L.Peretti M.Tosetti B.H.Menze G.Buonincontri article KrehlikSB2020 1738 Electrical regeneration for long-haul fiber-optic time and frequency distribution systems Transactions on Ultrasonics, Ferroelectrics, and Frequency Control 2020 8 13 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks Time and frequency transfer, fiber optics, optical-electrical-optical regeneration https://ieeexplore.ieee.org/document/9166557 EMPIR 2018: SI Broader Scope IEEE 30 10.1109/TUFFC.2020.3016610 NA P.Krehlik Ł.Śliwczyński Ł.Buczek article SchwarzDABLSWRLL2020 1570 Long term measurement of the 87Sr clock frequency at the limit of primary Cs clocks Physical Review Research 2020 8 11 2 3 18SIB05: ROCIT: Robust Optical Clocks for International Timescales 033242 Atomic spectra, optical clocks, gravitation EMPIR 2018: SI Broader Scope American Physical Society (APS)
Ricklinger Stadtweg 4c
30 10.1103/PhysRevResearch.2.033242 NA RSchwarz SDörscher AAl-Masoud EBenkler TLegero USterr SWeyers JRahm BLipphardt CLisdat
article MauryADdBM2020 1818 Hydrogen refuelling station calibration with a traceable gravimetric standard Flow Measurement and Instrumentation 2020 8 74 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 101743 Refuelling station; Hydrogen; Primary standard; Uncertainties; High pressure EnG EMPIR 2016: Energy Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101743 NA R.Maury C.Auclercq C.Devilliers M.de Huu O.Büker M.MacDonald article SignorinoGMGFBQDB2020 1935 Dataset of measured and commented pantograph electric arcs in DC railways Data in Brief 2020 8 31 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems 105978 Electric arcMeasurement of electrical quantitiesPantographPower qualityRailwaysRolling stock EMPIR 2016: Energy Elsevier BV 30 2352-3409 10.1016/j.dib.2020.105978 NA D.Signorino D.Giordano A.Mariscotti D.Gallo A.D.Femine F.Balic J.Quintana L.Donadio A.Biancucci article RuutelYKSIDHHTBL2020 2185 Design, synthesis and application of carbazole macrocycles in anion sensors Beilstein Journal of Organic Chemistry 2020 8 16 2020 17FUN09: UnipHied: Realisation of a Unified pH Scale 1901-1914 anion sensors; carboxylates;ionophores; acrocycles; sensor prototype EMPIR 2017: Fundamental Beilstein Institut 30 1860-5397 10.3762/bjoc.16.157 NA A.Rüütel V.Yrjänä S.A.Kadam I.Saar M.Ilisson A.Darnell K.Haav T.Haljasorg L.Toom J.Bobacka I.Leito article PeiPBL2020 1892 Uncertainty quantification in the design of wireless power transfer systems Open Physics 2020 7 30 18 1 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 391-396 EMC, wireless transfer, uncertainty quantification, shielding, efficiency https://www.degruyter.com/document/doi/10.1515/phys-2020-0174/html EMPIR 2016: Energy Walter de Gruyter GmbH 30 2391-5471 10.1515/phys-2020-0174 NA Y.Pei L.Pichon M.Bensetti Y.Le-Bihan article BatistaGMMR2020 1571 Development of an experimental setup for microflow measurement using interferometry Flow measurement instrumentation 2020 7 29 75 18HLT08: MEDDII: Metrology for drug delivery 101789 Microflow measurement, Interferometry, Calibration, Measurement uncertainty EMPIR 2018: Health Elsevier 30 10.1016/j.flowmeasinst.2020.101789 NA ElsaBatista IsabelGodinho RuiMartins RicardoMendes JoãoRobarts article BiguriLBTDBMDHB2020 1885 Arbitrarily large iterative tomographic reconstruction on multiple GPUs using the TIGRE toolbox Journal of Parallel and Distributed Computing 2020 7 29 146 2020 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 52-63 Computed Tomography, multi GPU computing, iterative reconstruction EMPIR 2017: Industry Elsevier 30 NA https://arxiv.org/abs/1905.03748 A.Biguri R.Lindroos R.Bryll H.Towsyfyan H.Deyhle R.Boardman M.Mavrogordato M.Dosanjh S.Hancock T.Blumensath article ivkoviBKJH2020 2030 Traceable Determination of Atmospheric Mercury Using Iodinated Activated Carbon Traps Atmosphere 2020 7 24 11 8 16ENV01: MercOx: Metrology for oxidised mercury 780 Mercury, sorbent traps, atmosphere, traceability EMPIR 2016: Environment MDPI AG 30 2073-4433 10.3390/atmos11080780 NA I.Živković S.Berisha J.Kotnik M.Jagodic MilenaHorvat article FerreroBCRFM2020 1858 Goniochromatic assessment of gray scales for color change Journal of the Optical Society of America A 2020 7 22 37 8 IND52: xDReflect: Multidimensional reflectometry for industry 1266 Color, gray scale, goniochromatism https://digital.csic.es/bitstream/10261/227636/1/Goniochromatic%20assessment.pdf EMRP A169: Call 2012 Metrology for Industry (II) The Optical Society 30 1084-7529, 1520-8532 10.1364/JOSAA.394170 NA A.Ferrero B.Bernad J.Campos N.Richard C.Fernández-Maloigne M.Melgosa article MayerBTOPAGMIMSK2020 1600 Flexible numerical simulation framework for dynamic PET-MR data Physics in Medicine & Biology 2020 7 21 65 14 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers 145003 PET-MR,motion correction,simulation,image registration,open source EMPIR 2018: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/ab7eee NA J.Mayer R.Brown K.Thielemans E.Ovtchinnikov E.Pasca D.Atkinson A.Gillman P.Marsden M.Ippoliti M.Makowski T.Schaeffter C.Kolbitsch article BodermannBZMKSDHDK2020 1559 Quasi-bound states in the continuum for deep subwavelength structural information retrieval for DUV nano-optical polarizers Optics Express 2020 7 20 28 16 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 23122 quasi-bound states EMPIR 2017: Fundamental The Optical Society 30 1094-4087 10.1364/OE.396044 NA B.Bodermann S.Burger U.Zeitner J.Meyer T.Käseberg T.Siefke W.Dickmann C.B.R.Hurtado J.Dickmann S.Kroker article FretwellLBKDLMPRSF2020 1539 Direct Measurement of the 7Be L/K Capture Ratio in Ta-Based Superconducting Tunnel Junctions Physical Review Letters 2020 7 14 125 3 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters 032701 7Be, Electron captures, Cryogenic detectors, Theoretical calculations EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 NA https://arxiv.org/abs/2003.04921 S.Fretwell K.G.Leach C.Bray G.B.Kim J.Dilling A.Lennarz X.Mougeot F.Ponce C.Ruiz J.Stackhouse S.Friedrich article AlKhafajiGWBV2020 1714 Particle Size Distribution of Bimodal Silica Nanoparticles: A Comparison of Different Measurement Techniques Materials 2020 7 11 13 14 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses 3101 silica nanoparticle; size distribution; light scattering; small-angle X-ray scattering; microfluidic resistive pulse sensing EMPIR 2018: Health MDPI AG 30 1996-1944 10.3390/ma13143101 NA M.A.Al-Khafaji A.Gaál A.Wacha A.Bóta Z.Varga article HeeringSCANNQRBBNSLLURVSDRKL2020 1554 Symmetric Potentiometric Cells for the Measurement of Unified pH Values Symmetry 2020 7 12 7 17FUN09: UnipHied: Realisation of a Unified pH Scale 1150 unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid EMPIR 2017: Fundamental MDPI AG 30 2073-8994 10.3390/sym12071150 NA AgnesHeering DanielaStoica FilomenaCamões BárbaraAnes DánielNagy ZsófiaNagyné Szilágyi RaquelQuendera LuisRibeiro FrankBastkowski RasmusBorn JaakNerut JaanSaame SilvieLainela LokmanLiv EmrahUysal MatildaRoziková MartinaVičarová AlanSnedden LisaDeleebeeck ValentinRadtke IngoKrossing IvoLeito article LindgrenBRLGBIM2020 1856 Review of road surface photometry methods and devices – Proposal for new measurement geometries Lighting REsearch and technology 2020 7 1 16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting 1-17 SURFACE, road surface, asphalt, luminance coefficient, measurement geometries EMPIR 2016: Pre-Co-Normative SAGE 30 1477-0938 10.1177/1477153520958454 NA M.Lindgren P.Blattner J.Reber S.Liandrat F.GREFFIER J.Bernasconi P.Iacomussi V.Muzet article BogoalecKosirCKGZM2020 2145 Digital PCR method for detection and quantification of specific antimicrobial drug-resistance mutations in human cytomegalovirus Journal of Virological Methods 2020 7 281 / 15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance 113864 Digital PCR, Antimicrobial-Drug resistance, HCMV, Polymerase chain reaction, Viruses EMPIR 2015: Health Elsevier BV 30 0166-0934 10.1016/j.jviromet.2020.113864 NA A.Bogožalec Košir T.Cvelbar M.Kammel H-P.Grunert H.Zeichhardt M.Milavec article SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020 1522 Determination of consensus kQ values for megavoltage photon beams for the update of IAEA TRS-398 Physics in Medicine and Biology 2020 6 22 65 9 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 095011 TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo EMPIR 2016: Pre-Co-Normative Institute of Physics
London
30 10.5281/zenodo.3903294 NA J.Seuntjens L.A.de Prez M.Pinto M.Pimpinella C.P.Oliver J.Ojala B.Muir L.Mirzakhanian M.D.Hanlon P.Francescon F.Delaunay J.Borbinha F.Ballester C.E.Andersen S.Vatnitsky M. McEwen R.P.Kapsch D.T.Burns P.Andreo L.Sommier P.Teles J.Tikkanen J.Vijande K.Zink
article dePooterBdDKKvW2020 1629 Reference dosimetry in MRI-linacs: evaluation of available protocols and data to establish a code of practice Physics in Medicine & Biology 2020 6 22 1 1 19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy 1 Reference dosimetry, MRI linac, Monte Carlo simulation, MR guided radiotherapy EMPIR 2019: Pre-Co-Normative IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ab9efe NA J.A.de Pooter I.Billas L.A.de Prez S.Duane R-P.Kapsch C.P.Karger B.van Asselen J.W.H.Wolthaus article SixOMLLJHBBLHYTYM2020 1577 What can we learn from N2O isotope data? - Analytics, processes and modelling Rapid Communications in Mass Spectrometry 2020 6 16 34 20 16ENV06: SIRS: Metrology for stable isotope reference standards 14/e8858 nitrous oxide, isotopic composition, isotope ratio mass spectrometry, laser spectroscopy https://www.dora.lib4ri.ch/empa/islandora/object/empa:22957 EMPIR 2016: Environment John Wiley & Sons 30 10.1002/rcm.8858 NA LongfeiYu ElizaHarris DominikaLewicka‐Szczebak MattiBarthel MargaretaBlomberg Stephen J.Harris Matthew S.Johnson Moritz F.Lehmann JesperLiisberg ChristophMüller Nathaniel E.Ostrom JohanSix SakaeToyoda NaohiroYoshida JoachimMohn article BloklandSRB2020 1517 Capacitive and Infrared Gas Sensors for the Assessment of the Methane Number of LNG Fuels Sensors 2020 6 12 20 12 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 3345 energy transition; Methane Number; gas composition sensor; capacitive sensor array; interdigitated electrodes; responsive coatings; tunable filter infrared spectrometer; LNG; biogas EnG EMPIR 2016: Energy MDPI AG 30 1424-8220 10.3390/s20123345 NA J.Sweelssen H.Blokland T.Rajamaki A.Boersma article SetinaTIBBJVW2020 1519 A review on hot cathode ionisation gauges with focus on a suitable design for measurement accuracy and stability Vacuum 2020 6 10 179 16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge Ionisation gauge, Hot cathode, Sensitivity, Secondary electrons, Electron stimulated desorption EMPIR 2016: Pre-Co-Normative Elsevier
Munich
30 0042-207X 10.1016/j.vacuum.2020.109545 NA K.Jousten F.Boineau N.Bundaleski C.Illgen J.Šetina O.M.N.D.Teodoro M.Vicar M.Wüest
article BossewCCCDEGPT2020 1837 Development of a Geogenic Radon HazardIndex—Concept, History, Experiences International Journal of Environmental Research and Public Health 2020 6 10 17 11 16ENV10: MetroRADON: Metrology for radon monitoring 4134 geogenic radon hazard index, geogenic radon potential, European map of geogenic radon EMPIR 2016: Environment MDPI 30 EISSN 1660-4601 10.3390/ijerph17114134 NA P.Bossew G.Cinelli G.Ciotoli Q.G.Crowley M.De Cort J.Elío Medina V.Gruber E.Petermann T.Tollefsen article BatistaTB2020 1478 Traceability of pulsed flow rates consisting of constant delivered volumes at given time interval Flow Measurement and Instrumentation 2020 6 73 18HLT08: MEDDII: Metrology for drug delivery 101729 Traceability, pulsed flow rate, volume EMPIR 2018: Health Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101729 NA H.Bissig M.Tschannen Mde Huu article BoudaoudCO2020 1493 Development of an optical measurement method for “sampled” micro-volumes and nano-flow rates Flow Measurement and Instrumentation 2020 6 73 18HLT08: MEDDII: Metrology for drug delivery 101746 Optical Method, volume, microflow EMPIR 2018: Health Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101746 NA F.Ogheard P.Cassette A.Boudaoud article HarmonFBAGBLZ2020 1514 Assessment of Exposure to Electric Vehicle Inductive Power Transfer Systems: Experimental Measurements and Numerical Dosimetry Sustainability 2020 6 12 11 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 4573 basic restrictions; electric vehicle; exposure; guidelines; inductive power transfer (IPT); magnetic field measurements; numerical dosimetry EMPIR 2016: Energy MDPI AG 30 2071-1050 10.3390/su12114573 NA I.Liorni O.Bottauscio R.Guilizzoni P.Ankarson J.Bruna A.Fallahi S.Harmon M.Zucca article KolovouGCBL2020 1524 Procedures to Measure Mean Ambient Dose Equivalent Rates Using Electret Ion Chambers Radiation Protection Dosimetry 2020 6 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident electret ion chambers,ambient dose equivalent rates EMPIR 2016: Environment Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncaa061 NA F.Leontaris A.Boziari A.Clouvas M.Kolovou J.Guilhot article SamantarayRB2020 1596 Single-phase and correlated-phase estimation with multiphoton annihilated squeezed vacuum states: An energy-balancing scenario Physical Review A 2020 6 101 6 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 063810 quantum optics, quantum metrology, non-gaussian states https://arxiv.org/abs/1809.10706 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.101.063810 NA N.Samantaray I.Ruo-Berchera I.Berchera article SchmelterOSB2020 1627 Numerical simulation, validation, and analysis of two-phase slug flow in large horizontal pipes Flow Measurement and Instrumentation 2020 6 73 16ENG07: MultiFlowMet II: Multiphase flow reference metrology 101722 Multiphase flow, slug flow, CFD, frequency analysis EMPIR 2016: Energy Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101722 NA S.Schmelter M.Olbrich E.Schmeyer M.Bär proceedings BosseEZCBOYBMRF2020 1665 AdvManuNet: a networking project on metrology for advanced manufacturing Proceedings 20th euspen International Conference and Exhibition 2020 6 2020 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing Advanced Manufacturing, Key Enabling Technology (KET), Strategic Research Agenda (SRA), European Metrology Network (EMN) EMPIR 2019: Support for Networks Online Conference 20th euspen International Conference and Exhibition 08-06-2020 to 12-06-2020 30 978-0-9957751-7-6 NA https://www.euspen.eu/knowledge-base/ICE20374.pdf H.Bosse A.Evans V.Zelený D.Czulek A.Balsamo D.O'Connor T.Yandayan D.Billington F.Meli C.Ragusa O.Flys proceedings BehleB2020 1654 Mode analysis for long, undamped cantilevers with added diamond tips of varying length for fast roughness measurements SMSI 2020 - Sensors and Instrumentation 2020 6 Chapter P2 2020 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 238-239 FEM, Mode analysis, diamond tips, piezoresistive Si-cantilever, roughness measurements EMPIR 2017: Industry AMA Association for Sensors and Measurement Nuremberg, Germany SMSI 2020 22-06-2020 to 25-06-2020 30 978-3-9819376-2-6 NA https://www.ama-science.org/proceedings/details/3729 H.Behle U.Brand proceedings ReuterRFPBHR2020 1653 Applications of Tactile Microprobes for Surface Metrology SMSI 2020 - Sensors and Instrumentation 2020 6 Chapter A6 2020 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 87-88 piezoresistive cantilever, MEMS, atomic force microscopy, contact resonance, surfaceroughness EMPIR 2017: Industry AMA Association for Sensors and Measurement Nuremberg, Germany SMSI 2020 22-06-2020 to 25-06-2020 30 978-3-9819376-2-6 NA https://www.ama-science.org/proceedings/details/3655 C.Reuter A.Reum M.Fahrbach E.Peiner U.Brand M. Hofmann I.Rangelow article LucasCTDABLYSMPF2020 1611 Dynamic piezoelectric response of relaxor single crystal under electrically driven inter-ferroelectric phase transformations Applied Physics Letters 2020 6 116 22 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 222903 - https://livrepository.liverpool.ac.uk/3091334/ EMPIR 2016: Energy AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0007820 NA C.A.Lucas M.G.Cain P.B.J.Thompson D.Damjanovic L.Antonelli F.Blackmon S.E.Lofland S.Young M.Staruch B.R.Matis E.A.Patterson P.Finkel article BlakesleyHMGFBH2020 1733 Accuracy, cost and sensitivity analysis of PV energy rating Solar Energy 2020 6 203 16ENG02: PV-Enerate: Advanced PV energy rating 91-100 Photovoltaics, Energy rating, Uncertainty EMPIR 2016: Energy Elsevier BV 30 0038-092X 10.1016/j.solener.2020.03.088 NA J.C.Blakesley T.Huld H.Müllejans A.Gracia-Amillo G.Friesen T.R.Betts W.Hermann proceedings BircherMKT2020 1758 METAS-CT: Metrological X-ray computed tomography at sub-micrometre precision Proceedings 20th euspen International Conference and Exhibition 2020 6 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry Industrial X-ray computed tomography, dimensional metrology, high-resolution, microtechnology, micro-parts, additive manufacturing https://www.euspen.eu/knowledge-base/ICE20131.pdf EMPIR 2017: Industry Online Conference 20th euspen International Conference and Exhibition 08-06-2020 to 12-06-2020 30 NA https://www.euspen.eu/knowledge-base/ICE20131.pdf B.Bircher F.Meli A.Küng R.Thalmann article deHuuTBSBMMNPR2020 1819 Design of gravimetric primary standards for field-testing of hydrogen refuelling stations Flow Measurement and Instrumentation 2020 6 73 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 101747 Hydrogen calibration, Hydrogen dispenser, Gravimetric method EnG EMPIR 2016: Energy Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101747 NA M.de Huu M.Tschannen H.Bissig P.Stadelmann O.Büker M.MacDonald R.Maury P.T.Neuvonen H.T.Petter K.RASMUSSEN article HarrisLXWZYBWKCBSM2020 1578 N2O isotopocule measurements using laser spectroscopy: analyzer characterization and intercomparison Atmospheric Measurement Techniques 2020 5 28 13 - 16ENV06: SIRS: Metrology for stable isotope reference standards 2797–2831 nitrous oxide, isotopic composition, laser spectroscopy, spectral interference, matrix effect https://www.dora.lib4ri.ch/empa/islandora/object/empa%3A22186 EMPIR 2016: Environment Copernicus Gesellschaft mbH
Göttingen
30 10.5194/amt-13-2797-2020 NA Stephen J.Harris JesperLiisberg LonglongXia JingWei KerstinZeyer LongfeiYu MattiBarthel BenjaminWolf Bryce F. J.Kelly Dioni I.Cendón ThomasBlunier JohanSix JoachimMohn
article WagnerSBKLSS2020 1968 PTB-XL, a large publicly available electrocardiography dataset Scientific Data 2020 5 25 7 1 18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management electrocardiography, cardiovascular system, 12 lead electrocardiography, presence of co-occurring diseases EMPIR 2018: Health Springer Science and Business Media LLC 30 2052-4463 10.1038/s41597-020-0495-6 NA P.Wagner N.Strodthoff R-D.Bousseljot D.Kreiseler F.I.Lunze W.Samek T.Schaeffter article MorevaBTSTFPBPDOG2020 1710 Practical Applications of Quantum Sensing: A Simple Method to Enhance the Sensitivity of Nitrogen-Vacancy-Based Temperature Sensors Physical Review Applied 2020 5 22 13 5 17FUN06: SIQUST: Single-photon sources as new quantum standards 054057 color centers, diamond, quantum sensing https://arxiv.org/abs/1912.10887 EMPIR 2017: Fundamental American Physical Society (APS)
1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States
30 2331-7019 10.1103/PhysRevApplied.13.054057 NA E.Moreva E.Bernardi P.Traina A.Sosso S.D.Tchernij J.Forneris F.Picollo G.Brida Ž.Pastuović I. P.Degiovanni P.Olivero M.Genovese
article MorevaBTSTFPBPDOG20200 1710 Practical Applications of Quantum Sensing: A Simple Method to Enhance the Sensitivity of Nitrogen-Vacancy-Based Temperature Sensors Physical Review Applied 2020 5 22 13 5 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 054057 color centers, diamond, quantum sensing https://arxiv.org/abs/1912.10887 EMPIR 2017: Fundamental American Physical Society (APS)
1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States
30 2331-7019 10.1103/PhysRevApplied.13.054057 NA E.Moreva E.Bernardi P.Traina A.Sosso S.D.Tchernij J.Forneris F.Picollo G.Brida Ž.Pastuović I. P.Degiovanni P.Olivero M.Genovese
article YamakawaBATBSNKYD2020 2039 Hg isotopic composition and total Hg mass fraction in NIES Certified Reference Material No. 28 Urban Aerosols Analytical and Bioanalytical Chemistry 2020 5 18 412 19 16ENV01: MercOx: Metrology for oxidised mercury 4483-4493 Hg isotopic composition, Certified Reference Material, Urban Aerosols EMPIR 2016: Environment Springer Science and Business Media LLC 30 1618-2642, 1618-2650 10.1007/s00216-020-02691-9 NA A.Yamakawa S.Bérail D.Amouroux E.Tessier J.Barre T.Sano K.Nagano S.Kanwal J.Yoshinaga O.F.X.Donard article BilousBBSvTPLP2020 1541 Electronic Bridge Excitation in Highly Charged Th229 Ions Physical Review Letters 2020 5 12 124 19 17FUN07: CC4C: Coulomb Crystals for Clocks highly charged Ionshigh-intensity optical laserHighly Charged 229Th Ions EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.124.192502 NA P.V.Bilous H.Bekker J.C.Berengut B.Seiferle L.von der Wense P.G.Thirolf T.Pfeifer J.R.C.López-Urrutia A.Pálffy article CouplandPBDLTSL2020 1523 Lens aberration compensation in interference microscopy Optics and Lasers in Engineering 2020 5 128 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 106015 Lens aberration interference microscopy EMPIR 2015: SI Broader Scope Elsevier BV
Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands
30 0143-8166 10.1016/j.optlaseng.2020.106015 NA R.Su M.Thomas M.Liu J.Drs Y.Bellouard C.Pruss J.Coupland R.Leach
article OsanBCDGSH2020 1569 Experimental evaluation of the in-the-field capabilities of total-reflection X-ray fluorescence analysis to trace fine and ultrafine aerosol particles in populated areas Spectrochimica Acta Part B: Atomic Spectroscopy 2020 5 167 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 105852 Atmospheric aerosols, Ultrafine particles, Cascade impactor, TXRF, Elemental size distribution EMPIR 2016: Environment Elsevier BV
Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands
30 0584-8547 10.1016/j.sab.2020.105852 NA JánosOsán EndreBörcsök OttóCzömpöly CsengeDian VeronikaGroma LucaStabile GarryHensey
article KasebergSKB2020 1595 Inverted plasmonic lens design for nanometrology applications Measurement Science and Technology 2020 5 31 7 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 074013 Plasmonics, Metrology, Plasmonic lens, Microscopy, Nanostructures, Finite Element Method EMPIR 2017: Fundamental IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab7e6b NA T.Käseberg T.Siefke S.Kroker B.Bodermann proceedings CrottiGDFGLLLBMP2020 1727 Measurement of Dynamic Voltage Variation Effect on Instrument Transformers for Power Grid Applications 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 2020 5 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation Instrument transformers, power grid, power quality, phasor measurement unit, uncertainty SEG https://zenodo.org/record/4154617#.X9DyOthKguU EMPIR 2017: Industry IEEE Dubrovnik, Croatia, Croatia 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 25-05-2020 to 28-05-2020 30 10.5281/zenodo.4154617 NA G.Crotti D.Giordano G.D'Avanzo A.D.Femine D.Gallo C.Landi M.Luiso P.S.Letizia L.Barbieri P.Mazza D.Palladini article PollathLLZZB2020 1761 Spin structure relation to phase contrast imaging of isolated magnetic Bloch and Néel skyrmions Ultramicroscopy 2020 5 212 17FUN08: TOPS: Metrology for topological spin structures 112973 SkyrmionLorentz TEMPhase contrastMagnetic imaging https://arxiv.org/pdf/2002.12469.pdf EMPIR 2017: Fundamental Elsevier BV 30 0304-3991 10.1016/j.ultramic.2020.112973 NA S.Pöllath T.Lin N.Lei W.Zhao J.Zweck C.H.Back article ArrheniusBFPM2020 1821 Development and evaluation of a novel analyser for ISO14687 hydrogen purity analysis Measurement Science and Technology 2020 5 31 7 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 075010 hydrogen, hydrogen purity, analyser, OFCEAS, gas chromatography EnG EMPIR 2016: Energy IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab7cf3 NA K.Arrhenius O.Büker A.Fischer S.Persijn A.Murugan proceedings CipollettaFGLLGPBFGG2020 1939 Monitoring a DC Train Supplied by a Reversible Substation 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 2020 5 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Railway system, DC Reversible Substations, Inverting Substations, DC Power Quality, Energy measurement, Energy Savings, Power System Measurement https://zenodo.org/record/4570008#.YESU4WhKiCo EMPIR 2016: Energy IEEE Dubrovnik, Croatia 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 25-05-2020 to 28-05-2020 30 978-1-7281-4461-0 2642-2077 10.1109/I2MTC43012.2020.9128644 NA G.Cipolletta A.D.Femine D.Gallo C.Landi M.Luiso A.Gallo L.Pastena F.Balic J.Q.Fernandez D.Giordano DomenicoGiordano article FinizioWMHLBBMR2020_2 2379 Current-induced dynamical tilting of chiral domain walls in curved microwires Applied Physics Letters 2020 5 116 18 17FUN08: TOPS: Metrology for topological spin structures 182404 domain wall, spin-orbit torque, x-ray microscopy EMPIR 2017: Fundamental AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0005186 NA S.Finizio S.Wintz S.Mayr A.J.Huxtable M.Langer J.Bailey G.Burnell C.H.Marrows J.Raabe article GomezMMBPM2020 2738 Bose-Einstein Condensate Comagnetometer Physical Review Letters 2020 4 29 124 17 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems Comagnetometer, BEC EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 NA https://arxiv.org/abs/1910.06642 P.Gomez F.Martin C.Mazzinghi D.Benedicto Orenes S.Palacios M.W.Mitchell article MartinezABNVJHKVKL2020 1488 Step height standards based on self-assembly for 3D metrology of biological samples Measurement Science and Technology 2020 4 23 15SIB09: 3DNano: Traceable three-dimensional nanometrology nanometrology, transfer standard, calibration, CSI, SWLI, AFM, traceability EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab8c6a NA V.Heikkinen I.Kassamakov T.Viitala M.Järvinen T.Vainikka A.Nolvi C.Bermudez R.Artigas P.Martinez V.Korpelainen A.Lassila miscellaneous SilvaALSCRMBS_2 1486 EMUE-D6-4-Mobile Optical Measurement 2020 4 18 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Calibration; Mobile optical measurement system EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3756658 NA M.A.Silva M.C.Almeida D.Loureiro J.A.Sousa M.G.Cox A.S.Ribeiro L.L.Martins R.Brito A.C.Soares article RonnbergBGMK2020 1492 Comparison of Measurement Methods for the Frequency Range 2–150 kHz (Supraharmonics) Based on the Present Standards Framework IEEE Access 2020 4 15 8 18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods 77618-77630 Distortion measurement, electromagnetic compatibility, measurement standards, powerquality, supraharmonics, frequency domain analysis https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=9067844 EMPIR 2018: Pre-Co-Normative Institute of Electrical and Electronics Engineers (IEEE) 30 2169-3536 10.1109/ACCESS.2020.2987996 NA V.Khokhlov J.Meyer A.Grevener T.Busatto S.Ronnberg miscellaneous SilvaALSCRMBS 1484 EMUE-D1-3-Single Burning Item 2020 4 1 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Measurement model; SBI – Single Burning Item; Reaction to fire test EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3736602 NA M.A.Silva M.C.Almeida D.Loureiro J.A.Sousa M.G.Cox A.S.Ribeiro L.L.Martins R.Brito A.C.Soares article AlveseSousaTNGBFPFBO2020 1468 New EMPIR project – Metrology for Drug Delivery Flow Measurement and Instrumentation 2020 4 72 Special Is 18HLT08: MEDDII: Metrology for drug delivery 101716 Microflow, drug delivery, calibration, health EMPIR 2018: Health Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101716 NA E.Batista A.Furtado J.Pereira M.Ferreira H.Bissig E.Graham A.Niemann A.Timmerman J.A.Sousa F.Ogheard article SliwczynskiKIESPB2020 1851 Fiber-Based UTC Dissemination Supporting 5G Telecommunications Networks IEEE Communications Magazine 2020 4 58 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 67-73 time transfer, frequency transfer, fiber optic, 5G, network synchronization, synchronization supervision EMPIR 2018: SI Broader Scope IEEE 30 10.5281/zenodo.3903158 NA L.Śliwczyński P.Krehlik H.Imlau H.Ender H.Schnatz D.Piester A.Bauch article OjalaBTPZTSGP2020 1496 Calculated beam quality correction factors for ionization chambers in MV photon beams Physics in Medicine & Biology 2020 3 26 65 7 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 075003 kQ factors, radiotherapy dosimetry, Monte Carlo EMPIR 2016: Pre-Co-Normative IOP Publishing 30 1361-6560 10.1088/1361-6560/ab7107 NA J.Tikkanen K.Zink M.Pimpinella P.Teles J.Borbinha J.Ojala T.Siiskonen C.Gomà M.Pinto miscellaneous SousaPvCFDBKE 1467 EMUE-D1-2-Bayesian Mass Calibration 2020 3 25 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Bayesian statistics, measurement uncertainty, prior knowledge, calibration EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3726908 NA J.A.Sousa O.Pellegrino A.M.H.van der Veen M.G.Cox N.Fischer S.Demeyer A.Bošnjakovic V.Karahodžić C.Elster article KueraKPBV2020 1607 Characterization of a precision modular sinewave generator Measurement Science and Technology 2020 3 17 31 6 17RPT04: VersICaL: A versatile electrical impedance calibration laboratory based on digital impedance bridges 064002 signal generator, synthesizer, voltage, calibration, metrology, impedance,AC Josephson effect EMPIR 2017: Research Potential IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab6f2e NA J.Kucera J.Kováč L.Palafox R.Behr L.Vojáčková article BaumannBKEZ2020 1497 Monte Carlo calculation of beam quality correction factors in proton beams using TOPAS/GEANT4 Physics in Medicine & Biology 2020 3 65 5 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 055015 radiotherapy dosimetry, protons EMPIR 2016: Pre-Co-Normative IOP Publishing 30 1361-6560 10.1088/1361-6560/ab6e53 NA K-S.Baumann S.Kaupa C.Bach R.Engenhart-Cabillic K.Zink article TangSLKNBMSCKMKBNMKKSSDPvM2020 1473 Clinical quantitative cardiac imaging for the assessment of myocardial ischaemia Nature Reviews Cardiology 2020 2 24 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion cardiac imaging, myocardial ischaemia EMPIR 2015: Health Springer Science and Business Media LLC 30 1759-5002, 1759-5010 10.1038/s41569-020-0341-8 NA M.Dewey M.Siebes M.Kachelrieß K.F.Kofoed P.Maurovich-Horvat K.Nikolaou W.Bai A.Kofler R.Manka S.Kozerke A.Chiribiri T.Schaeffter F.Michallek F.Bengel S.Nekolla P.Knaapen M.Lubberink R.Senior M-X.Tang J.J.Piek T.van de Hoef J.Martens L.Schreiber article GogyanKBZ2020 1481 Characterisation and feasibility study for superradiant lasing in 40Ca atoms Optics Express 2020 2 24 28 5 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 6881 optical clock, superradiance EMPIR 2017: Fundamental The Optical Society 30 1094-4087 10.1364/OE.381991 NA A.Gogyan G.Kazakov M.Bober M. Zawada article BehlerU2020 2542 Activation in human auditory cortex in relation to the loudness and unpleasantness of low-frequency and infrasound stimuli PLOS ONE 2020 2 21 15 2 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources e0229088 loudness, infrasound, functional resonance imaging, annoyance EMPIR 2015: Health Public Library of Science (PLoS) 30 1932-6203 10.1371/journal.pone.0229088 NA O.Behler S.Uppenkamp techreport WeberHSRDBMHKMENHSW2020 1431 Document specifying rules for the secure use of DCC covering legal aspects of metrology Zenodo 2020 2 12 17IND02: SmartCom: Communication and validation of smart data in IoT-networks digital calibration certificate (DCC) cryptography minimum requirements data communication IoT-communication IoT-networking SmartCom https://zenodo.org/record/3664211#.XlO2QTFKhaR EMPIR 2017: Industry Zenodo 30 10.5281/zenodo.3664211 NA H.Weber D.Hutzschenreuter I.Smith S.Rhodes J.Dawkins C.Brown O.Maennel K.Hovhannisyan P.Kuosmanen T.Mustapää T.Elo P.Nikander W.Heeren S.Schönhals Th.Wiedenhöfer article HuynhMOKABKI2020 1432 Measurement setup for differential spectral responsivity of solar cells Optical Review 2020 2 12 16ENG02: PV-Enerate: Advanced PV energy rating Radiometry, Solar cell, Spectral responsivity, Efficacy, Electricity, Bifacial https://link.springer.com/article/10.1007%2Fs10043-020-00584-x EMPIR 2016: Energy Springer Science and Business Media LLC 30 1340-6000, 1349-9432 10.1007/s10043-020-00584-x NA P.Kärhä H.Baumgartner J.Askola K.Kylmänen B.Oksanen K.Maham V.Huynh E.Ikonen article BeyerKP2020 1356 An unfolding algorithm for high resolution microcalorimetric beta spectrometry Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment 2020 2 953 15SIB10: MetroBeta: Radionuclide beta spectra metrology 163128 Beta spectrometry, Unfolding, Deconvolution, Microcalorimeter, Monte Carlo Simulation, Bremsstrahlung EMPIR 2015: SI Broader Scope Elsevier BV 30 0168-9002 10.1016/j.nima.2019.163128 NA M.Paulsen K.Kossert J.Beyer proceedings ObatonKRMBACD2020 1759 Reference standards for XCT measurements of additively manufactured parts  Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020 2020 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 152 X-ray computed tomography (XCT), dimensional metrology, reference standards, additive manufacturing https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf EMPIR 2017: Industry Wels, Austria 10th Conference on Industrial Computed Tomography (iCT 2020) 04-02-2020 to 07-02-2020 30 NA https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf A.Obaton C. Klingaa C.Rivet K.Mohaghegh S.Baier J.Andreasen L.Carli L.De Chiffre proceedings BircherMT2020 1757 X-ray source tracking to compensate focal spot drifts for dimensional CT measurements Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020 2020 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 110 industrial CT, X-ray tube, focal spot drift, CT geometry compensation, dimensional metrology https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id110.pdf EMPIR 2017: Industry Wels, Austria 10th Conference on Industrial Computed Tomography (iCT 2020) 04-02-2020 to 07-02-2020 30 NA https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id110.pdf B.Bircher F.Meli R.Thalmann manual PearceABEdIKS2020 1766 Guidelines on the Calibration of Thermocouples: EURAMET Calibration Guide No. 8 2020 2 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 Thermocouples, calibration, thermoelectric, thermometry, ITS-90, EMPRESS 2 https://www.euramet.org/publications-media-centre/calibration-guidelines/ EMPIR 2017: Industry EURAMET
Braunschweig
30 ISBN 978-3-942992-57-2 N/A NA ISBN 978-3-942992-57-2 J.Pearce N.Arifovic J.Bojkovski F.Edler M.de Groot G.G.Izquierdo M.Kalemci R.Strnad
article BiaekVGAGFU2020 1904 Monte Carlo–Based Quantification of Uncertainties in Determining Ocean Remote Sensing Reflectance from Underwater Fixed-Depth Radiometry Measurements Journal of Atmospheric and Oceanic Technology 2020 2 37 2 16ENV03: MetEOC-3: Further metrology for earth observation and climate 177-196 Monte Carlo, Ocean colour, Uncertainty evaluation, Radiometry EMPIR 2016: Environment American Meteorological Society 30 0739-0572, 1520-0426 10.1175/JTECH-D-19-0049.1 NA A.Białek V.Vellucci B.Gentil D.Antoine J.Gorroño N.Fox C.Underwood proceedings IurlaroSMIBMCFMIPD2020 2019 DOSE RATE DATA OF MEASURING INSTRUMENTS USED IN NONGOVERNMENTAL NETWORKS (MINNs) IN THE FRAMEWORK OF PREPAREDNESS EMPIR PROJECT EUROSAFE 2020 2 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident dose rate, measuring instruments, non-governmental networks, preparedness http://www.etson.eu/sites/default/files/eurosafes/2019/EUROSAFE2019_Proceedings.pdf EMPIR 2016: Environment Cologne EUROSAFE 2019 04-11-2019 to 05-11-2019 30 978-3-947685-51-6 NA 978-3-947685-51-6 G.Iurlaro L.Sperandio V.Morosh M.ŽIivanovic S.Bell F.Mariotti L.Campani P.Ferrari B.Morelli S.Ioannidis G.Pantelić M.De Cort article OverneyPBKBJ2020 1546 Load compensation bridge for Josephson arbitrary waveform synthesizers Measurement Science and Technology 2020 1 31 31 5 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 055004 Load compensation bridge for Josephson arbitrary EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab62c7 NA F.Overney Y.Pimsut S.Bauer O.Kieler R.Behr B.Jeanneret article WiekhorstLMSJB2020 1504 Quantitative 2D Magnetorelaxometry Imaging of Magnetic Nanoparticles Using Optically Pumped Magnetometers Sensors 2020 1 29 20 3 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 753 magnetic nanoparticles; optically pumped magnetometers; magnetorelaxometry imaging https://www.mdpi.com/1424-8220/20/3/753/htm EMPIR 2016: Pre-Co-Normative MDPI AG 30 1424-8220 10.3390/s20030753 NA A.Jaufenthaler P.Schier T.Middelmann M.Liebl F.Wiekhorst D.Baumgarten article SchwarzSSBKLMCS2020 1540 Coherent laser spectroscopy of highly charged ions using quantum logic Nature 2020 1 29 578 7793 17FUN07: CC4C: Coulomb Crystals for Clocks 60-65 spectroscopy highly charged ions atomic clocks3 https://arxiv.org/abs/2010.15984 EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 0028-0836, 1476-4687 10.1038/s41586-020-1959-8 NA M.Schwarz L.Schmöger L.J.Spieß E.Benkler S.A.King T.Leopold P.Micke J.R.Crespo López-Urrutia P.O.Schmidt article HatanoMKTIGFTHGGB2020 1394 Spectroscopic investigations of negatively charged tin-vacancy centres in diamond New Journal of Physics 2020 1 23 22 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 013048 colour centres, diamond, tin-vacancy centre, single photons,Fourier-limited Emission lines,electron–Phonon scattering https://iopscience.iop.org/article/10.1088/1367-2630/ab6631/pdf EMPIR 2017: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ab6631 NA J.Görlitz D.Herrmann G.Thiering P.Fuchs M.Gandil T.Iwasaki T.Taniguchi M.Kieschnick J.Meijer M.Hatano A.Gali C.Becher article BurnellLRvHBNSRMHBFZM2020 1425 Diameter-independent skyrmion Hall angle observed in chiral magnetic multilayers Nature Communications 2020 1 22 11 1 17FUN08: TOPS: Metrology for topological spin structures skyrmion motion, spin-orbit torque EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-019-14232-9 NA K.Zeissler S.Finizio C.Barton A.J.Huxtable J.Massey J.Raabe A.V.Sadovnikov S.A.Nikitov R.Brearton T.Hesjedal G.van der Laan M.C.Rosamond E.H.Linfield G.Burnell C.H.Marrows article SetionoBNXFKUDFSWP2020 2362 In-Plane and Out-of-Plane MEMS Piezoresistive Cantilever Sensors for Nanoparticle Mass Detection Sensors 2020 1 22 20 3 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 618 MEMS piezoresistive cantilever sensors, dynamic mode, carbon nanoparticle, particle mass measurement EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s20030618 NA A.Setiono M.Bertke W.O.Nyang’au J.Xu M.Fahrbach I.Kirsch E.Uhde A.Deutschinger E.J.Fantner C. H.Schwalb H.S.Wasisto E.Peiner article SarjonenRBSB2020 1391 A Versatile Capacitive Sensing Platform for the Assessment of the Composition in Gas Mixtures Micromachines 2020 1 21 11 2 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 116 energy  transition;  gas  composition  sensor;  capacitive  sensor  array;  interdigitated  electrodes; responsive coatings; tunable filter infrared spectrometer; LNG; biogas EnG https://www.mdpi.com/2072-666X/11/2/116/pdf EMPIR 2016: Energy MDPI AG
Postfach Basel CH-4005 Switzerland
30 2072-666X 10.3390/mi11020116 NA J.Sweelssen H.Blokland T.Rajamaki R.Sarjonen A.Boersma
article FortmeierSLMSHBBKSE2020 1374 Round robin comparison study on the form measurement of optical freeform surfaces Journal of the European Optical Society-Rapid Publications 2020 1 16 1 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses Freeform optical surfaces, Metrology, Interlaboratory comparison EMPIR 2015: SI Broader Scope Springer Science and Business Media LLC 30 1990-2573 10.1186/s41476-019-0124-1 NA I.Fortmeier R.Schachtschneider V.Lédl O.Matoušek J.Siepmann A.Harsch R.Beisswanger Y.Bitou Y.Kondo M.Schulz C.Elster article MinkMFMZSBSMNAAL2020 1399 Experimental Low-Latency Device-Independent Quantum Randomness Physical Review Letters 2020 1 124 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems quantum randomness EMPIR 2017: Fundamental American Physical Society (APS)
1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States
30 0031-9007, 1079-7114 10.1103/PhysRevLett.124.010505 NA https://arxiv.org/abs/1812.07786 Y.Zhang L.K.Shalm J.C.Bienfang M.J.Stevens M.D.Mazurek S.W.Nam C.Abellán W.Amaya M.W.Mitchell H.Fu C.A.Miller A.Mink E.Knill
article LeviBTCLL2020 1397 Sideband-Enhanced Cold Atomic Source for Optical Clocks Physical Review Applied 2020 1 13 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 014013 Optical Lattice Clock,cold atomic sources EMPIR 2017: Fundamental American Physical Society (APS)
1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States
30 2331-7019 10.1103/PhysRevApplied.13.014013 NA https://arxiv.org/abs/1909.05810 M.Barbiero M.G.Tarallo D.Calonico F.Levi G.Lamporesi G.Ferrari
article ZilbertiKLGCBAZ2020 1334 Accuracy Assessment of Numerical Dosimetry for the Evaluation of Human Exposure to Electric Vehicle Inductive Charging Systems IEEE Transactions on Electromagnetic Compatibility 2020 ea ea 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 1-12 Basic restrictions, electric vehicles, electro-magnetic fields, inductive charging, numerical dosimetry, safety EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9375, 1558-187X 10.1109/TEMC.2019.2954111 NA A.Arduino O.Bottauscio M.Chiampi L.Giaccone I.Liorni N.Kuster L.Zilberti M.Zucca article GoenagaInfantePRdBAC2020 1417 The accurate determination of number concentration of inorganic nanoparticles using spICP-MS with the dynamic mass flow approach Journal of Analytical Atomic Spectrometry 2020 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements nanoparticles, nanoparticle number concentration, spICP-MS, inorganic nanoparticles, Au nanoparticles, TiO2 nanoparticles https://pubs.rsc.org/en/content/articlepdf/2020/ja/c9ja00415g EMPIR 2017: Pre-Co-Normative Royal Society of Chemistry (RSC) 30 10.1039/c9ja00415g NA S.Cuello-Nuñez I.Abad-Álvaro D.Bartczak M.E. del Castillo Busto D.A.Ramsay F.Pellegrino H.Goenaga-Infante article GuoPBGPKHU2020 1494 Interaction of nanoparticle properties and X-ray analytical techniques Journal of Analytical Atomic Spectrometry 2020 35 5 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 1022-1033 X-ray Standing Wavefield, GIXRF, TXRF, NEXAFS, Core-Shell Nanoparticles https://arxiv.org/abs/2004.02955 EMPIR 2016: Environment Royal Society of Chemistry (RSC) 30 0267-9477, 1364-5544 10.1039/D0JA00049C NA R.Unterumsberger P.Honicke Y.Kayser B.Pollakowski-Herrmann S.Gholhaki Q.Guo R.E.Palmer B.Beckhoff article BinkowskiBCHZB2020 1557 Quasinormal mode expansion of optical far-field quantities Physical Review B 2020 102 3 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 035432 near field to far field transformation, numerical simulation https://arxiv.org/abs/2003.11305 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.102.035432 NA F.Binkowski F.Betz R.Colom M.Hammerschmidt L.Zschiedrich S.Burger article FlierlRBMS2020 1598 Absolute isotope ratios of carbon dioxide – a feasibility study Journal of Analytical Atomic Spectrometry 2020 16ENV06: SIRS: Metrology for stable isotope reference standards Gas Metrology, SI traceability, Carbon Dioxide refrence maerial https://pubs.rsc.org/is/content/articlelanding/2020/ja/d0ja00318b#!divAbstract EMPIR 2016: Environment Royal Society of Chemistry (RSC) 30 0267-9477, 1364-5544 10.1039/d0ja00318b NA L.Flierl O.Rienitz P.J.Brewer H.A.J.Meijer F.M.Steur article ArrheniusFBAELR2020 1602 Analytical methods for the determination of oil carryover from CNG/biomethane refueling stations recovered in a solvent RSC Advances 2020 10 20 16ENG05: Biomethane: Metrology for biomethane 11907-11917 Biomethane oilcarryoveranaytical method EnG EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 2046-2069 10.1039/D0RA01399D NA K.Arrhenius A.Fischer O.Büker H.Adrien A.El Masri F.Lestremau T.Robinson article BurkeUK2020 1644 A psychoacoustical study to investigate the perceived unpleasantness of infrasound combined with audio-frequency sound Acta Acustica 2020 4 5 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources 20 Infrasound / Unpleasantness / Psychoacoustic scaling methods / Detection threshold EMPIR 2015: Health EDP Sciences 30 2681-4617 10.1051/aacus/2020019 NA E.Burke S.Uppenkamp C.Koch article WanslebenVWBHBK2020 1685 Speciation of iron sulfide compounds by means of X-ray emission spectroscopy using a compact full-cylinder von Hamos spectrometer Journal of Analytical Atomic Spectrometry 2020 35 11 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 2679-2685 - https://arxiv.org/abs/2005.09509 EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 0267-9477, 1364-5544 10.1039/D0JA00244E NA M.Wansleben J.Vinson A.Wählisch K.Bzheumikhova P.Honicke B.Beckhoff Y.Kayser article PetriniMBTTCDG2020 1713 Is a Quantum Biosensing Revolution Approaching? Perspectives in NV‐Assisted Current and Thermal Biosensing in Living Cells Advanced Quantum Technologies 2020 17FUN06: SIQUST: Single-photon sources as new quantum standards 2000066 color centers, diamond, biosensing EMPIR 2017: Fundamental Wiley 30 10.1002/qute.202000066 NA G.Petrini E.Moreva E.Bernardi P.Traina G.Tomagra V.Carabelli I.P.Degiovanni M.Genovese article BernardiMTPDFPDOG2020 1712 A biocompatible technique for magnetic field sensing at (sub)cellular scale using Nitrogen-Vacancy centers EPJ Quantum Technology 2020 7 17FUN06: SIQUST: Single-photon sources as new quantum standards 13 NV centers, Quantum sensing, Magnetic measurements EMPIR 2017: Fundamental 30 10.1140/epjqt/s40507-020-00088-2 NA E.Bernardi E.Moreva P.Traina G.Petrini S.Ditalia Tchernij J.Forneris Ž.Pastuović I.P.Degiovanni P.Olivero M.Genovese article HorenzTBNAGV2020 1716 A Study on the Analysis of Particle Size Distribution for Bimodal Model Nanoparticles by Electron Microscopy Microscopy and Microanalysis 2020 26 S2 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements 2282 nanoparticles, size traceability, bi-modal distribution, silica, gold, electron microscoopy https://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/study-on-the-analysis-of-particle-size-distribution-for-bimodal-model-nanoparticles-by-electron-microscopy/B9157A370AC198219A734770694340F3 EMPIR 2017: Pre-Co-Normative Cambridge University Press
Cambridge
30 1435-8115 10.1017/S1431927620021054 NA C.Hörenz O.Tache D.Bartczak S.Nunez I.Abad Alvaro H.Goenaga-Infante V-D.Vasile-Dan Hodoroaba
proceedings HahtelaKLMMPYBGKMMPP2020 1810 Coulomb Blockade Thermometry on a Wide Temperature Range Proceedings of 2020 Conference on Precision Electromagnetic Measurements (CPEM 2020) 2020 18SIB02: Real-K: Realising the redefined kelvin Temperature measurement, thermometers, cryogenics, nanoelectronics, tunneling, single electron devices EMPIR 2018: SI Broader Scope IEEE Denver (Aurora), CO, USA 2020 Conference on Precision Electromagnetic Measurements (CPEM 2020) 24-08-2020 to 28-08-2020 30 NA https://arxiv.org/abs/2101.03932 O.M.Hahtela A.Kemppinen J.Lehtinen A.J.Manninen E.Mykkänen M.Prunnila N.Yurttagül F.Blanchet M.Gramich B.Karimi E.T.Mannila J.Muhojoki J.T.Peltonen J.P.Pekola article CuelloNunezABdRPG2020 1848 The accurate determination of number concentration of inorganic nanoparticles using spICP-MS with the dynamic mass flow approach Journal of Analytical Atomic Spectrometry 2020 35 9 18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration 1832-1839 number concentration, spICP-MS, nanoparticle EMPIR 2018: Support for Impact Royal Society of Chemistry (RSC) 30 0267-9477, 1364-5544 10.1039/C9JA00415G NA S.Cuello-Nuñez I.Abad-Álvaro D.Bartczak M.E.Del Castillo Busto D.A.Ramsay F.Pellegrino H.Goenaga-Infante article CaraMSGRCDHKBMZCLBF2020 1829 Towards a traceable enhancement factor in surface-enhanced Raman spectroscopy Journal of Materials Chemistry C 2020 8 46 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 16513-16519 Raman spectroscopy (SERS) EMPIR 2016: Environment Royal Society of Chemistry (RSC) 30 2050-7526, 2050-7534 10.1039/D0TC04364H NA E.Cara L.Mandrile A.Sacco A.M.Giovannozzi A.M.Rossi F.Celegato N.De Leo P.Honicke Y.Kayser B.Beckhoff D.Marchi A.Zoccante M.Cossi M.Laus L.Boarino F.Ferrarese Lupi article OchoaBTC2020 1870 Challenges and opportunities for an efficiency boost of next generation Cu(In,Ga)Se2 solar cells: prospects for a paradigm shift Energy & Environmental Science 2020 13 7 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 2047-2055 CIGS, metrology EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 1754-5692, 1754-5706 10.1039/D0EE00834F NA M.Ochoa S.Buecheler A.N.Tiwari R.Carron article SachseBSHHKNL2020 2015 Colloidal bimetallic platinum–ruthenium nanoparticles in ordered mesoporous carbon films as highly active electrocatalysts for the hydrogen evolution reaction Catalysis Science & Technology 2020 10 7 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 2057-2068 Hydrogen, Nanoparticles, Hyrdrogen evolution reaction (HER) https://pubs.rsc.org/en/content/articlelanding/2020/CY/C9CY02285F#!divAbstract EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 2044-4753, 2044-4761 10.1039/C9CY02285F NA R.Sachse D.Bernsmeier R.Schmack I.Häusler A.Hertwig K.Kraffert J.Nissen H.Lewis article BernardiMTPDFPDOG20200 1712 A biocompatible technique for magnetic field sensing at (sub)cellular scale using Nitrogen-Vacancy centers EPJ Quantum Technology 2020 7 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 13 NV centers, Quantum sensing, Magnetic measurements EMPIR 2017: Fundamental 30 10.1140/epjqt/s40507-020-00088-2 NA E.Bernardi E.Moreva P.Traina G.Petrini S.Ditalia Tchernij J.Forneris Ž.Pastuović I.P.Degiovanni P.Olivero M.Genovese article BurkeUK2020_2 2543 A psychoacoustical study to investigate the perceived unpleasantness of infrasound combined with audio-frequency sound Acta Acustica 2020 4 5 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources 20 annoyance, infrasound, unpleaseantness, hearing experiment EMPIR 2015: Health EDP Sciences 30 2681-4617 10.1051/aacus/2020019 NA E.Burke S.Uppenkamp C.Koch proceedings ZhangHLBAJN2019 1422 Deep Learning Applied to Attractor Images Derived from ECG Signals for Detection of Genetic Mutation 2019 Computing in Cardiology Conference (CinC) 2019 12 30 46 18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management 097 Symmetric Projection Attractor Reconstruction, ECG signals, transfer learning http://www.cinc.org/archives/2019/pdf/CinC2019-097.pdf EMPIR 2018: Health Computing in Cardiology Singapore Computing in Cardiology 08-09-2019 to 11-09-2019 30 2325-887X 10.22489/CinC.2019.097 NA P.Aston J.Lyle E.Bonet-Luz C.Huang Y.Zhang K.Jeevaratnam M.Nandi article ArrheniusBBdHM2019 1820 Hydrogen Purity Analysis: Suitability of Sorbent Tubes for Trapping Hydrocarbons, Halogenated Hydrocarbons and Sulphur Compounds Applied Sciences 2019 12 23 10 1 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 120 hydrogen; fuel cells; hydrogen vehicle; sorbent; thermal desorption; hydrogen quality EnG EMPIR 2016: Energy MDPI AG 30 2076-3417 10.3390/app10010120 NA KarineArrhenius HalehBohlen OliverBüker Irisde Krom DitaHeikens ArulMurugan article BrunoGCBPL2019 1400 Narrowband photon pairs with independent frequency tuning for quantum light-matter interactions Optics Express 2019 12 18 27 26 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 38463 Parametric Down-conversion, Photon correlation, photon entnglement EMPIR 2017: Fundamental The Optical Society 30 1094-4087 10.1364/OE.382474 NA V.Prakash Lorena C.Bianchet M.T.Cuairan P.Gomez N.Bruno M.W.Mitchell article ZilbertiCBBA2019 1328 In silico evaluation of the thermal stress induced by MRI switched gradient fields in patients with metallic hip implant Physics in Medicine & Biology 2019 12 13 64 24 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 245006 dosimetry, magnetic resonance imaging (MRI), MR safety, gradient coils, medical implants, prostheses, numerical simulation EMPIR 2017: Industry IOP Publishing 30 1361-6560 10.1088/1361-6560/ab5428 NA A.Arduino O.Bottauscio R.Brühl M.Chiampi L.Zilberti article SchinkeFBN2019 1641 Implementation and uncertainty evaluation of spectral stray light correction by Zong’s method Applied Optics 2019 12 13 58 36 16ENG02: PV-Enerate: Advanced PV energy rating 9998 spectral stray light, spectrometer, measurement uncertainty analysis EMPIR 2016: Energy The Optical Society 30 1559-128X, 2155-3165 10.1364/AO.58.009998 NA C.Schinke M.Franke K.Bothe S.Nevas article KungBM2019 1762 Low-Cost 2D Index and Straightness Measurement System Based on a CMOS Image Sensor Sensors 2019 12 11 19 24 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 5461 2D position sensor, 2D index sensor, straightness sensor, machine tool geometry correction EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s19245461 NA A.Küng B.A.Bircher F.Meli article GomezFGLDBMFMMGARPABCDH2019 1260 Hydrogen fuel quality from two main production processes: Steam methane reforming and proton exchange membrane water electrolysis Journal of Power Sources 2019 12 444 15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications 227170 Fuel cell electrical vehicles, ISO14687, Gas analysis, Hydrogen production, Hydrogen quality https://www.sciencedirect.com/science/article/pii/S0378775319311632 EMPIR 2015: Pre-Co-Normative Elsevier BV 30 0378-7753 10.1016/j.jpowsour.2019.227170 NA T.Bacquart K.Arrhenius S.Persijn A.Rojo F.Auprêtre B.Gozlan N.Moore A.Morris A.Fischer A.Murugan S.Bartlett G.Doucet F.Laridant E.Gernot T. E.Fernández C.Gómez M.Carré G.De Reals F.Haloua article TrusheimFGBA2019 1315 Quantum nanophotonics with group IV defects in diamond Nature Communications 2019 12 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 5625 diamond, photonics, quantum optics, color centers, quantum technologies https://www.nature.com/articles/s41467-019-13332-w EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-019-13332-w NA C.Bradac W.Gao J.Forneris M. E.Trusheim I.Aharonovich article LeviHVBH2019 1398 Cavity-enhanced non-destructive detection of atoms for an optical lattice clock Optics Express 2019 12 27 26 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 37099 Non destructive measurement, Optical Lattice Clocks EMPIR 2017: Fundamental The Optical Society 30 1094-4087 10.1364/OE.27.037099 NA R.Hobson W.Bowden A.Vianello I.R.Hill P.Gill article BenklerLPWRS2019 1661 End-to-end topology for fiber comb based optical frequency transfer at the 10−21 level Optics Express 2019 12 27 25 18SIB05: ROCIT: Robust Optical Clocks for International Timescales 36886 optical frequency combs, stability transfer EMPIR 2018: SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.27.036886 NA E.Benkler B.Lipphardt T.Puppe R.Wilk F.Rohde U.Sterr article RanitzschABBBEKKLMNPRW2019 1729 MetroMMC: Electron-Capture Spectrometry with Cryogenic Calorimeters for Science and Technology Journal of Low Temperature Physics 2019 12 199 1-2 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters 441-450 Electron-capture decay, Metallic magnetic calorimeter, Radionuclide metrology EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 0022-2291, 1573-7357 10.1007/s10909-019-02278-4 NA P.C-O.Ranitzsch D.Arnold J.Beyer L.Bockhorn J.J.Bonaparte C.Enss K.Kossert S.Kempf M.Loidl R.Mariam O. J.Nähle M.Paulsen M.Rodrigues M.Wegner article BockhornPBKLNRR2019 1355 Improved Source/Absorber Preparation for Radionuclide Spectrometry Based on Low-Temperature Calorimetric Detectors Journal of Low Temperature Physics 2019 11 30 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters Beta spectrometry, Preparation techniques, Low-temperature detectors EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 0022-2291, 1573-7357 10.1007/s10909-019-02274-8 NA L.Bockhorn M.Paulsen J.Beyer K.Kossert M.Loidl O. J.Nähle P. C.-O.Ranitzsch M.Rodrigues article RibeiroPBAM2019 1427 Method selection to evaluate measurement uncertainty in microflow applications Journal of Physics: Conference Series 2019 11 29 1379 18HLT08: MEDDII: Metrology for drug delivery 012033 Uncertainty, microflow, Monte Carlo method, Bayesian method https://iopscience.iop.org/article/10.1088/1742-6596/1379/1/012033/pdf EMPIR 2018: Health IOP science 30 17426588 10.1088/1742-6596/1379/1/012033 NA J.A.Sousa E.Batista O.Pellegrino Á.Ribeiro L.Martins article GeislerNBHSRKWHTHMSU2019 1316 Determining the Thickness and Completeness of the Shell of Polymer Core–Shell Nanoparticles by X-ray Photoelectron Spectroscopy, Secondary Ion Mass Spectrometry, and Transmission Scanning Electron Microscopy The Journal of Physical Chemistry C 2019 11 26 17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses Nanoparticles, core-shell, XPS, SIMS, T-SEM, polymer EMPIR 2017: Support for Impact American Chemical Society (ACS) 30 1932-7447, 1932-7455 10.1021/acs.jpcc.9b09258 NA A.Müller T.Heinrich S.Tougaard W. S. M.Werner M.Hronek V.Kunz J.Radnik J. M.Stockmann V-D.Hodoroaba S.Benemann N.Nirmalananthan-Budau D.Geißler K.Sparnacci W. E. S Unger article KashcheyevsFBJLSGFRK2019 1312 Continuous-variable tomography of solitary electrons Nature Communications 2019 11 22 10 1 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements Single electron, Electron wave packet, Tomography EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-019-13222-1 NA J. D.Fletcher N.Johnson E.Locane P.See J. P.Griffiths I.Farrer D. A.Ritchie P. W.Brouwer V.Kashcheyevs M.Kataoka article BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019 2340 The Metrological Traceability, Performance and Precision of European Radon Calibration Facilities International Journal of Environmental Research and Public Health 2019 11 21 16ENV10: MetroRADON: Metrology for radon monitoring radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability EMPIR 2016: Environment 30 10.3390/ijerph182212150 NA T.R.Beck A.Antohe F.Cardellini A.Cucoş E.Fialova C.Grossi K.Hening J.Jensen D.Kastratović M.Krivošík P.Lobner A.Luca F.J.Maringer N.Michielsen P.P.S.Otahal L.Quindos D.Rabago C.Sainz L.Szücs T.Teodorescu C.Tolinsson C.L.Tugulan T.Turtiainen A.Vargas J.Vosahlik G.Vukoslavovic H.Wiedner K.Wołoszczuk article GeorgievMDBD2019 1560 Partition Coefficients and Diffusion Lengths of 222Rn in Some Polymers at Different Temperatures International Journal of Environmental Research and Public Health 2019 11 15 16 22 16ENV10: MetroRADON: Metrology for radon monitoring 4523 Partition Coefficients and Diffusion Lengths of 222Rn in Some Polymers at Different Temperatures EMPIR 2016: Environment MDPI AG
Postfach Basel CH-4005 Switzerland
30 1660-4601 10.3390/ijerph16224523 NA StrahilGeorgiev KrasimirMitev ChavdarDutsov TatianaBoshkova IvelinaDimitrova
manual SmithHWB2019 1448 Document describing a universal and flexible structure for digital calibration certificates (DCC) 2019 11 11 17IND02: SmartCom: Communication and validation of smart data in IoT-networks digital calibration certificate (DCC), data communication, IoT-communication, IoT-networking SmartCom, minimum requirements EMPIR 2017: Industry SmartCom 30 10.5281/zenodo.3696567 NA I.Smith D.Hutzschenreuter T.Wiedenhöfer C.Brown article RanitzschPNMKKEBBLRS2019 1234 Beta spectrometry with metallic magnetic calorimeters in the framework of the European EMPIR project MetroBeta Applied Radiation and Isotopes 2019 11 153 15SIB10: MetroBeta: Radionuclide beta spectra metrology 108830 Beta spectrometry; Metallic magnetic calorimeter; Ionizing radiation metrology EMPIR 2015: SI Broader Scope Elsevier BV 30 0969-8043 10.1016/j.apradiso.2019.108830 NA M.Loidl J.Beyer L.Bockhorn C.Enss S.Kempf K.Kossert R.Mariam O.Nähle M.Paulsen P.Ranitzsch M.Rodrigues M.Schmidt article IkonenKOB2019 1286 Optical Characterization of III-V Multijunction Solar Cells for Temperature-Independent Band Gap Features IEEE Journal of Photovoltaics 2019 11 9 6 16ENG02: PV-Enerate: Advanced PV energy rating 1631-1636 Band gap, light-emitting diode (LED), spectral response, temperature, III-V solar cells EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 2156-3381, 2156-3403 10.1109/JPHOTOV.2019.2933190 NA H.Baumgartner B.Oksanen P.Kärhä E.Ikonen article KlenovskyBMASS2019 1361 Optical response of (InGa)(AsSb)/GaAs quantum dots embedded in a GaP matrix Physical Review B 2019 11 100 19 17FUN06: SIQUST: Single-photon sources as new quantum standards electronic structure, quantum dot https://arxiv.org/abs/1906.09842 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.100.195407 NA P.Steindl E.M.Sala B.Alén D.F.Marrón D.Bimberg P.Klenovský article KipperHLBPHLV2019 1406 Retention of acidic and basic analytes in reversed phase column using fluorinated and novel eluent additives for liquid chromatography-tandem mass spectrometry Journal of Chromatography A 2019 11 in press in press 17FUN09: UnipHied: Realisation of a Unified pH Scale 460667 Eluent additivesHFIPHFTBPPNFTBRetention mechanisms https://www.sciencedirect.com/search/advanced?qs=Retention%20of%20acidic%20and%20basic&pub=Journal%20of%20Chromatography%20A&cid=271409&volumes=0&lastSelectedFacet=volumes EMPIR 2017: Fundamental Elsevier BV 30 0021-9673 10.1016/j.chroma.2019.460667 NA R.Veigure K.Lossmann M.Hecht E.Parman R.Born I.Leito K.Herodes K.Kipper article RibeiroPBSM2019 1419 Method selection to evaluate measurement uncertainty in microflow applications Journal of Physics: Conference Series 2019 11 1379 2019 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards 012033 microflow, medicine, neonatology, oncology, measurement uncertainty, GUM, Monte Carlo EMPIR 2017: Pre-Co-Normative IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1379/1/012033 NA J.A.Sousa E.Batista O.Pellegrino A.S.Ribeiro L.L.Martins manual EloKnKALSZSFRBSHWHHHNHMMHP2019 1433 SmartCom Digital System of Units (D-SI) Guide for the use of the metadata-format used in metrology for the easy-to-use, safe, harmonised and unambiguous digital transfer of metrological data 2019 11 17IND02: SmartCom: Communication and validation of smart data in IoT-networks Digital-SI (D-SI) metrology data digital exchange format SmartCom data communication IoT-networking IoT-communication https://zenodo.org/record/3522631#.XlTbaTFKhaQ EMPIR 2017: Industry Zenodo 30 10.5281/zenodo.3522631 NA T.Elo P.Kuosmanen T. Mustapää R.Klobucar B.Acko I.Linkeová J.Sýkora V.Zelený I.Smith A.Forbes S.Rhodes C.Brown A.Scheibner S.G.Hackel T.Wiedenhöfer W.Heeren F.Haertig D.Hutschenreuter P.Nikander K.Hovhannisyan O.Maennel B.Muller L.Heindorf V.Paciello techreport SmithWHHB2019 1434 D-SI in Short - Digital brochure on establishing the use of units in digitalised communication Zenodo 2019 11 1 17IND02: SmartCom: Communication and validation of smart data in IoT-networks Digital-SI (D-SI) data communication IoT-communication IoT-networking metrology data SmartCom digital exchange format https://zenodo.org/record/3522074#.XlTiRTFKhaQ EMPIR 2017: Industry SmartCom 30 10.5281/zenodo.3522074 NA I.Smith T.Wiedenhöfer F.Haertig D.Hutschenreuter C.Brown article AlveseSousaMB2019 1426 Calibration of insulin pumps Journal of Diabetes and Treatment 2019 11 4 3 18HLT08: MEDDII: Metrology for drug delivery 1075 Calibration, measurement, microflow, insulin pump, gravimetry, optical method EMPIR 2018: Health Gavin Publishers 30 2574-7568 NA https://www.gavinpublishers.com/assets/articles_pdf/1575449809article_pdf938882132.pdf J.A.Sousa R.Martins E.Batista thesis Bogen2019 1367 Frequenz-, Leistungs- und Positionsstabilisierung von UV-Lasersystemen fur Frequenzmetrologie mit hochgeladenen Ionen, Master Thesis, Ruprecht-Karls-Universitat, Heidelberg (2019) 2019 10 28 17FUN07: CC4C: Coulomb Crystals for Clocks Optical ClockTrapped Ions https://pure.mpg.de/rest/items/item_3175862_1/component/file_3175863/content EMPIR 2017: Fundamental Ruprecht-Karls-Universität, Heidelberg 30 NA http://hdl.handle.net/21.11116/0000-0005-1733-8 S.Bogen article BinghamWSTMFZSRKH2019 1353 Formation of Néel-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy Physical Review B 2019 10 25 100 14 17FUN08: TOPS: Metrology for topological spin structures 144435 Skyrmions, DMI, spin waves https://arxiv.org/abs/1910.04515 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.100.144435 NA S.Saha M.Zelent S.Finizio M.Mruczkiewicz S.Tacchi A. K.Suszka S.Wintz N. S.Bingham J.Raabe M.Krawczyk L. J.Heyderman article CalonicoLRBBP2019 1443 Absolute frequency measurement of the1S0 –3P0 transition of171Yb with a link to International Atomic Time Metrologia 2019 10 24 18SIB05: ROCIT: Robust Optical Clocks for International Timescales optical lattice clock, SI second, frequency metrology EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab50e8 NA M.Pizzocaro F.Bregolin P.Barbieri .Rauf F.Levi D.Calonico article KayserUWBWHH2019 1269 Experimental determination of line energies, line widths and relative transition probabilities of the Gadolinium L x-ray emission spectrum Metrologia 2019 10 21 56 6 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 065007 x-ray spectrometry, von Hamos spectrometer, rare earth metal, x-ray metrology, HAPG, gadolinium, atomic fundamental parameters https://arxiv.org/abs/1903.08085 EMPIR 2016: Environment IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab40d2 NA M.Wansleben Y.Kayser P.Honicke I.Holfelder A.Wählisch R.Unterumsberger B.Beckhoff article MarcqMHGFCBBTBMWW2019 1248 RadCalNet: A Radiometric Calibration Network for Earth Observing Imagers Operating in the Visible to Shortwave Infrared Spectral Range Remote Sensing 2019 10 16 11 2401 16ENV03: MetEOC-3: Further metrology for earth observation and climate 20 RadCalNet, CEOS, radiometric calibration, SI-traceable, surface reflectance, network, instrument https://doi.org/10.3390/rs11202401  EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs11202401 NA M.Bouvet K.Thome B.Berthelot A.Bialek J.Czapla-Myers N.Fox P.Goryl P.Henry L.Ma S.Marcq A.Meygret B.Wenny E.Woolliams article PfleidererRRLBAPWB2019 1313 Ferromagnetic Resonance with Magnetic Phase Selectivity by Means of Resonant Elastic X-Ray Scattering on a Chiral Magnet Physical Review Letters 2019 10 14 123 16 17FUN08: TOPS: Metrology for topological spin structures Skyrmions, X-ray scattering, Ferromagnetic resonance https://arxiv.org/abs/1909.08293 EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.123.167201 NA S.Pöllath A.Aqeel A.Bauer C.Luo H.Ryll F.Radu C.Pfleiderer G.Woltersdorf C. H.Back article AlvesBLLPB2019 1401 Maltese cross coupling to individual cold atoms in free space Optics Express 2019 10 11 27 21 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 31042 Sub-Pissonian statistics, photon anti bounching EMPIR 2017: Fundamental The Optical Society
2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States
30 1094-4087 10.1364/OE.27.031042 NA NataliaBruno Lorena C.Bianchet VindhiyaPrakash NanLi NatáliaAlves M.W.Mitchell
article BochudNHLJJ2019 1231 Development and validation of a double focalizing magnetic spectrometer for beta spectrum measurements Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment 2019 10 942 21 October 15SIB10: MetroBeta: Radionuclide beta spectra metrology 162384 magnetic spectrometer, beta shape measurement, acquisition system, Cl-36 https://reader.elsevier.com/reader/sd/pii/S0168900219309684?token=9907411027790E1C7A6500A4337D2D10E57E40E772BECF66298808C0FD62E4F989D02F38F9DA80F8EEB0FCC5EF556A53 EMPIR 2015: SI Broader Scope Elsevier BV 30 0168-9002 10.1016/j.nima.2019.162384 NA F.Juget F.Juget G.Lorusso G.Haefeli Y.Nedjadi F.Bochud article BurgerHZB2019 1249 Modal analysis for nanoplasmonics with nonlocal material properties Physical Review B 2019 10 100 15 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 155406 Nanophotonics, Plasmonic, Drude model, Electromagnetic wave theory, Finite-element method https://arxiv.org/abs/1906.01941 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.100.155406 NA F.Binkowski L.Zschiedrich M.Hammerschmidt S.Burger article LaihoSSKHSBWR2019 2617 Photon-number parity of heralded single photons from a Bragg-reflection waveguide reconstructed loss-tolerantly via moment generating function New Journal of Physics 2019 10 21 10 17FUN06: SIQUST: Single-photon sources as new quantum standards 103025 factorial moment of photon number, photon-number parity, moment generating function, parametric down-conversion, Bragg-reflection waveguide, transition-edge sensor https://iopscience.iop.org/article/10.1088/1367-2630/ab42ae EMPIR 2017: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ab42ae NA K.Laiho M.Schmidt H.Suchomel M.Kamp S.Höfling C.Schneider J.Beyer G.Weihs S.Reitzenstein proceedings BagciHYTAGD2019 1325 Improvement of dynamic pressure standard for calibration of dynamic pressure transducers 19th International Congress of Metrology (CIM2019) 2019 9 23 2019 17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures dynamic pressure, measurement, calibration, drop mass, dynamic calibration machine EMPIR 2017: Industry EDP Sciences
17 av. du Hoggar PA de Courtaboeuf BP 112 PA de Courtaboeuf BP 112 Les Ulis cedex A 91944 France
Paris 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201927009 NA Y.Durgut O.Ganioglu B.Aydemir A.Turk R.Yilmaz A.Hamarat E.Bağcı
proceedings CucciaSBLvAMCVSBPCT2019 1781 Development of standardized methods for the analysis of amines, terpenes and ammonia in biomethane 19th International Congress of Metrology (CIM2019) 2019 9 23 16ENG05: Biomethane: Metrology for biomethane biomethane, terpenes, amines, ammonia EnG EMPIR 2016: Energy EDP Sciences Paris 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201906001 NA L.Cuccia B.Sanz D.Ballestas Castro J.Li A.M.H.van der Veen E.Amico di Meane S.Moreno L.P.Culleton D.Vorin C.Senné F.Bougueroua L.Pyrée Y.Courtois C.Tastard article HohlsBL2019 1310 Time-energy filtering of single electrons in ballistic waveguides New Journal of Physics 2019 9 19 21 9 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 093042 Single electrons, time-energy filtering EMPIR 2017: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ab3fbb NA E.Locane P.W.Brouwer V.Kashcheyevs article BurgerHSGSR2019 1291 Benchmarking Five Global Optimization Approaches for Nano-optical Shape Optimization and Parameter Reconstruction ACS Photonics 2019 9 17 6 11 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 2726-2733 shape optimization, parameter reconstruction, machine learning, global optimization, Bayesian optimization https://arxiv.org/abs/1809.06674 EMPIR 2017: Fundamental ACS 30 2330-4022, 2330-4022 10.1021/acsphotonics.9b00706 NA P.I.Schneider X.Garcia Santiago Vi.Soltwisch M.Hammerschmidt S.Burger C.Rockstuhl article MayrBWHFMRWZ2019 1370 Deterministic Field-Free Skyrmion Nucleation at a Nanoengineered Injector Device Nano Letters 2019 9 17 19 10 17FUN08: TOPS: Metrology for topological spin structures 7246-7255 Skyrmion; nanomagnetism, spin-orbit torque https://arxiv.org/abs/1902.10435 EMPIR 2017: Fundamental American Chemical Society (ACS)
CAS, a division of the American Chemical Society 2540 Olentangy River Road Contract #: 19-0000016470-01 PO #: 6000110532 Columbus Ohio 43210 United States
30 1530-6984, 1530-6992 10.1021/acs.nanolett.9b02840 NA S.Finizio K.Zeissler S.Wintz S.Mayr T.Weßels A.J.Huxtable G.Burnell C.H.Marrows J.Raabe
article BlakesleyK2019 1951 Energy Rating for Evaluating Performance of Perovskite and Perovskite-on-Silicon Tandem Devices in Real-World Conditions 36th European Photovoltaic Solar Energy Conference and Exhibition 2019 9 13 16ENG02: PV-Enerate: Advanced PV energy rating 623 - 628 Energy Rating Perovskite Based Photovoltaics https://zenodo.org/record/4055579 EMPIR 2016: Energy 30 NA 3-936338-60-4 J.C.Blakesley G. Koutsourakis article BremerFPRSHW2019 1804 Cesium‐Vapor‐Based Delay of Single Photons Emitted by Deterministically Fabricated Quantum Dot Microlenses Advanced Quantum Technologies 2019 9 12 3 2 17FUN06: SIQUST: Single-photon sources as new quantum standards 1900071 atomic vapors delays deterministic fabrication quantum dots single‐photon sources EMPIR 2017: Fundamental Wiley 30 2511-9044, 2511-9044 10.1002/qute.201900071 NA L.Bremer S.Fischbach S‐I.Park S.Rodt J‐Dong.Song T.Heindel N.Weber article PalonenOKBLGG2019 1293 Laser Spectroscopy for Monitoring of Radiocarbon in Atmospheric Samples Analytical Chemistry 2019 9 10 91 19 16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities 12315-12320 Radiocarbon, Laser spectroscopy https://pubs.acs.org/doi/10.1021/acs.analchem.9b02496 EMPIR 2016: Environment American Chemical Society (ACS) 30 0003-2700, 1520-6882 10.1021/acs.analchem.9b02496 NA G.Genoud G.Genoud J.Lehmuskoski S.Bell V.Palonen M.Oinonen M.L.Koskinen-Soivi proceedings ChiampiBAZ2019 1271 Uncertainty propagation in phaseless electric properties tomography 2019 International Conference on Electromagnetics in Advanced Applications (ICEAA) 2019 9 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers magnetic resonance imaging (MRI), phaseless contrast source inversion (CSI), electric properties tomography (EPT), uncertainty propagation, Monte Carlo method https://arxiv.org/abs/1911.02809 EMPIR 2018: Health IEEE Granada 2019 International Conference on Electromagnetics in Advanced Applications 09-09-2019 to 13-09-2019 30 10.1109/ICEAA.2019.8879147 NA AlessandroArduino O.Bottauscio M.Chiampi L.Zilberti article Bossew2019 1289 Radon Priority Areas and Radon Extremes – Initial Statistical Considerations Radiation Environment and Medicine 2019 9 8 2 16ENV10: MetroRADON: Metrology for radon monitoring 94-104 radon priority area, anomaly, extreme EMPIR 2016: Environment Hirosaki University press 30 2423-9097 NA http://crss.hirosaki-u.ac.jp/wp-content/files_mf/1568795052Web_REMVol828_PeterBossew.pdf P.Bossew proceedings KrokerWSKB2019 1282 Sub-Wavelength Features in Spectroscopic Mueller Matrix Ellipsometry Deutsche Gesellschaft für angewandte Optik Proceedings 2019 2019 9 120 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits Gratings, Measurement Technology, Scatterometry https://www.dgao-proceedings.de/download/120/120_p9.pdf EMPIR 2017: Fundamental Deutsche Gesellschaft für angewandte Optik e.V. (DGaO) Darmstadt 120. Jahrestagung der Deutschen Gesellschaft für angewandte Optik 11-06-2019 to 15-06-2019 30 1614-8436 NA StefanieKroker MatthiasWurm ThomasSiefke TimKäseberg BerndBodermann proceedings BermbachSHTL2019 1294 Guards and Watchdogs in One-Way Synchronization with Delay-Related Authentication Mechanisms 2019 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS) 2019 9 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 1-6 Synchronization, Protocols, Servers, Cryptography, Clocks, Global navigation satellite system SEG https://doi.org/10.1109/ISPCS.2019.8886633 EMPIR 2017: Industry IEEE Portland (Oregon) United States International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication 22-09-2019 to 27-09-2019 30 978-1-5386-7607-3, 978-1-5386- 1949-0313, 1949-0305 NA https://oar.ptb.de/resources/show/10.7795/EMPIR.17IND06.CA.20191126 R.Bermbach D.Sibold K.Heine K.Teichel M.Langer proceedings LuisoRBCM2019 1295 Setup and Characterisation of Reference Current-to-Voltage Transformers for Wideband Current Transformers Calibration up to 2 kA 2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS) 2019 9 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 64-69 wideband, current transformers, calibration, measurement uncertainty, instrument transformers, power quality SEG https://doi.org/10.1109/AMPS.2019.8897759 EMPIR 2017: Industry IEEE Aachen, Germany 2019 IEEE 10th International Workshop on Applied Measurements for Power Systems 25-09-2019 to 27-09-2019 30 978-1-7281-0075-3, 978-1-7281- 2475-2304, 2473-1315 NA https://doi.org/10.1109/AMPS.2019.8897759 M.Luiso P.Rather H.Badura Y.Chen E.Mohns article ReitzensteinSZBRDDDMWPOMKSSGSMoU2019 1363 Method for direct coupling of a semiconductor quantum dot to an optical fiber for single-photon source applications Optics Express 2019 9 27 19 17FUN06: SIQUST: Single-photon sources as new quantum standards 26772 semiconductor quantum dot, single-photon source https://www.osapublishing.org/DirectPDFAccess/08FE2392-996C-94FE-814D27FFE5E6D46E_418606/oe-27-19-26772.pdf?da=1&id=418606&seq=0&mobile=no EMPIR 2017: Fundamental The Optical Society 30 1094-4087 10.1364/OE.27.026772 NA K.Żołnacz A.Musiał N.Srocka J.Große M.J.Schlösinger P-I.Schneider O.Kravets M.Mikulicz J.Olszewski K.Poturaj G.Wójcik P.Mergo K.Dybka M.Dyrkacz M.Dłubek S.Rodt S.Burger L.Zschiedrich G.Sęk S.Reitzenstein W.Urbańczyk article RietveldKvWB2019 1377 Detection Methods for Current Signals Causing Errors in Static Electricity Meters 2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE 2019 9 Not Applic Not Applic 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters 6 Power Quality Electricity Meters Short Time Fourier Transform Wavelet Transform Multiresolution Signal Decomposition Wavelets Smart Meters https://zenodo.org/record/3582153#.XiGzUXu7KUm EMPIR 2017: Pre-Co-Normative IEEE 30 10.1109/EMCEurope.2019.8872120 NA F.Barakou P.S.Wright H.E.van den Brom G.J.PKok G.Rietveld proceedings MarrowsKGDCCBSK2019 1428 Measuring Interfacial Dzyaloshinskii-Moriya Interaction: A Review Proceedings 2019 9 26 1 17FUN08: TOPS: Metrology for topological spin structures 41 Dzyaloshinskii-Moriya interaction EMPIR 2017: Fundamental MDPI AG Ferrara XXXVII International Symposium on Dynamical Properties of Solids 08-09-2019 to 12-09-2019 30 2504-3900 10.3390/proceedings2019026041 NA C.Back G.Carlotti A.Casiraghi G.Durin F.Garcia-Sanchez M.Kuepferling C.Marrows G.Soares S.Tacchi article KellmanMRSBXORNIRMGNPC2019 1474 Simultaneous 13N-Ammonia and gadolinium first-pass myocardial perfusion with quantitative hybrid PET-MR imaging: a phantom and clinical feasibility study European Journal of Hybrid Imaging 2019 9 3 1 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion myocardial perfusion, hybrid PET-MR EMPIR 2015: Health Springer Science and Business Media LLC 30 2510-3636 10.1186/s41824-019-0062-6 NA M.S.Nazir S-M.Gould X.Milidonis E.Reyes T.F.Ismail R.Neji S.Roujol J.O’Doherty H.Xue S.F.Barrington T.Schaeffter R.Razavi P.Marsden P.Kellman S.Plein A.Chiribiri thesis Barbiero2019 1812 Novel techniques for a Strontium Optical Lattice Clock 2019 9 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems Sr OLC, Laser cooling, http://hdl.handle.net/11583/2750550 EMPIR 2017: Fundamental Politecnico Torino Politecnico di Torino 30 NA http://hdl.handle.net/11583/2750550 M.Barbiero proceedings SeferiCBMS2019 1964 Power Quality Event Analysis in 25 kV 50 Hz AC Railway System Networks 2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS) 2019 9 1 1 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Railway transportation power systems, power quality, power system transients, voltage interruption https://strathprints.strath.ac.uk/70058/ EMPIR 2016: Energy IEEE Aachen, Germany International Workshop on Applied Measurements for Power Systems (AMPS) 25-09-2019 to 27-09-2012 30 978-1-7281-0075-3 2475-2304g 10.1109/AMPS.2019.8897765 NA Y.Seferi P.Clarkson S.M.Blair A.Mariscotti B.G. Stewart proceedings LuisoLGFSGCBD2019 1946 Monitoring Energy and Power Quality On Board Train 2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS) 2019 9 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Power and Energy measurement, Railway system, Energy saving, Reversible Substation, DC Power Quality https://zenodo.org/record/4598462 EMPIR 2016: Energy IEEE Dubrovnik, Croatia 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 25-05-2020 to 28-05-2020 30 978-1-7281-0075-3 2475-2304 10.1109/AMPS.2019.8897794 NA M.Luiso C.Landi D.Gallo A.D.Femine D.Signorino D.Giordano G.Crotti A.Biancucci L.Donadio proceedings SauzayRJBBWS2019 1302 Estimating Uncertainty in Loss Measurement of Power Transformers Proceedings of the 21st International Symposium on High Voltage Engineering 2019 8 30 17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors power transformers, losses, measurement, uncertainty. SEG EMPIR 2017: Pre-Co-Normative Budapest 21st International Symposium on High Voltage Engineering 26-08-2019 to 30-08-2019 30 10.5281/zenodo.3559837 NA M.Sauzay G.Rietveld B.Jönsson A.Bergman A.Bergman J.Walmsley J-B.Sund proceedings KaramanDMEBHHRGG2019 1186 Comparison of PD calibration capabilities in four National Metrology Institutes down to 0.1 pC Proceedings of ISH2019 2019 8 26 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients partial discharge, calibration EMPIR 2015: Pre-Co-Normative Budapest, Hungary 21st International Symposium on High Voltage Engineering 26-08-2019 to 30-08-2019 30 10.5281/zenodo.3243449 NA J.Hällström J.Havunen A.E.Bergman A-P.Elg A.Merev S.Dedeoğlu I.Karaman J.Rovira T.Garcia F.Garnacho inbook RuttingerPGCPSKBJSBSWWS2019 1193 European Research on Magnetic Nanoparticles for Biomedical Applications: Standardisation Aspects 2019 8 23 Advances i 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 316-326 magnetic nanoparticles, standardisation European research https://arxiv.org/abs/1905.08791 EMPIR 2016: Pre-Co-Normative Springer International Publishing
Cham
Current Trends in Biomedical Engineering and Bioimages Analysis. PCBEE 2019. 30 978-3-030-29884-5 10.1007/978-3-030-29885-2_29 NA PeterSchier CraigBarton SimoSpassov ChristerJohansson DanielBaumgarten OlgaKazakova PaulSouthern QuentinPankhurst MarcoCoisson CordulaGrüttner AlexPrice RomanRüttinger FrankWiekhorst JamesWells UweSteinhoff
proceedings VentreMDBCFPPRSTBASSGHBZFDKL2019 1200 Metrology for Inductive Charging of Electric Vehicles (MICEV) 2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE) 2019 8 19 Electrical 2019 AEIT 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 6 pages Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety SEG http://arxiv.org/abs/1908.11108 EMPIR 2016: Energy IEEE Turin (Italy) 2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE) 02-07-2019 to 04-07-2019 30 978-8-8872-3743-6 0018-9219 10.23919/EETA.2019.8804498 NA M.Zucca O.Bottauscio S.Harmon R.Guilizzoni F.Schilling M.Schmidt P.Ankarson T.Bergsten K.Tammi P.Sainio J.B.Romero E.L.Puyal L.Pichon F.Freschi V.Cirimele P.Bauer J.Dong A.Maffucci S.Ventre N.Femia G.Di Capua N.Kuster I.Liorni article GomaZHB2019 1331 Comparison of PENH, FLUKA and Geant4/TOPAS for absorbed dose calculations in air cavities representing ionization chambers in high‐energy photon and proton beams Medical Physics 2019 8 19 46 10 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 4639-4653 beam quality correction factors, dosimetry, high‐energy photon and proton radiation, Monte Carlo simulation, radiation therapy EMPIR 2016: Pre-Co-Normative Wiley 30 0094-2405, 2473-4209 10.1002/mp.13737 NA K.‐S.Baumann F.Horst K.Zink C.Gomà article WendischPMWIBABOKK2019 1057 Optical Pulse-Drive for the Pulse-Driven AC Josephson Voltage Standard IEEE Transactions on Applied Superconductivity 2019 8 29 5 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 1200205 Optical pulses, Optical fibers, Optical distortion, High-speed optical techniques, Optical attenuators, Optical crosstalk https://ieeexplore.ieee.org/document/8643521 EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 1051-8223, 1558-2515, 2378-707 10.1109/TASC.2019.2899851 NA O.Kieler B.Karlsen P.A.Ohlckers E.Bardalen M.N.Akram R.Behr J.Ireland J.Williams H.Malmbekk L.Palafox R.Wendisch article NahleMLKKEBBPRR2019 1235 Development of a beta spectrometry setup using metallic magnetic calorimeters Journal of Instrumentation 2019 8 14 08 15SIB10: MetroBeta: Radionuclide beta spectra metrology P08012-P08012 Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers EMPIR 2015: SI Broader Scope IOP Publishing 30 1748-0221 10.1088/1748-0221/14/08/P08012 NA M.Paulsen J.Beyer L.Bockhorn C.Enss S.Kempf K.Kossert M.Loidl R.Mariam O.Nähle P.Ranitzsch M.Rodrigues article NahleMLKKEBBPRR20190 1235 Development of a beta spectrometry setup using metallic magnetic calorimeters Journal of Instrumentation 2019 8 14 08 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters P08012-P08012 Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers EMPIR 2017: Fundamental IOP Publishing 30 1748-0221 10.1088/1748-0221/14/08/P08012 NA M.Paulsen J.Beyer L.Bockhorn C.Enss S.Kempf K.Kossert M.Loidl R.Mariam O.Nähle P.Ranitzsch M.Rodrigues article ChouhaniFiPBJVH2019 2041 A Unique Interactive Nanostructure Knitting based Passive Sampler Adsorbent for Monitoring of Hg2+ in Water Sensors 2019 8 19 15 16ENV01: MercOx: Metrology for oxidised mercury 3432 Nanostructure Knitting based Passive Sampler , Hg2+, Water EMPIR 2016: Environment MDPI AG 30 1424-8220 10.3390/s19153432 NA R.S.Chouhan G.Žitko V.Fajon I.Živković M.Pavlin S.Berisha I.Jerman A.Vesel M.Horvat article BausiKBC2019 1736 High-speed digital light source photocurrent mapping system Measurement Science and Technology 2019 7 30 30 9 16ENG02: PV-Enerate: Advanced PV energy rating 095902 High-speed digital light source photocurrent mapping system EMPIR 2016: Energy IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab1f40 NA F.Bausi G. Koutsourakis J.C.Blakesley F.A.Castro article GennserCPBBMCKCRMBJDH2019 1311 Quantum tomography of electrical currents Nature Communications 2019 7 29 10 1 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements Electronic wavefunction, Quantum tomography EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-019-11369-5 NA R.Bisognin A.Marguerite B.Roussel M.Kumar C.Cabart C.Chapdelaine A.Mohammad-Djafari J.-M.Berroir E.Bocquillon B.Plaçais A.Cavanna U.Gennser Y.Jin P.Degiovanni G.Fève article SOCHOROVARLLKFDCCBBT2019 1285 Activity measurements and determination of nuclear decay data of 166Ho in the MRTDosimetry project Applied Radiation and Isotopes 2019 7 20 153 November 2 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy 1-11 Ho166, Activity standardization, gamma-spectrometry, Half-life measurements, Molecular radiotherapy, MRTDosimetry EMPIR 2015: Health Elsevier 30 10.1016/j.apradiso.2019.108826 NA C.Bobin J.BOUCHARD V.CHISTE S.COLLINS P.Dryák A.FENWICK J.Keightley M.C.Lépy V.Lourenco A.Robinson J.Sochorová C.THIAM article RedshawQPMIHGEDBSRY2019 1232 Direct determination of the La138β-decay Q value using Penning trap mass spectrometry Physical Review C 2019 7 11 100 1 15SIB10: MetroBeta: Radionuclide beta spectra metrology 014308 138La, high-precision Q-values, mass spectrometry, Penning trap https://arxiv.org/abs/1904.12076v2 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2469-9985, 2469-9993 10.1103/PhysRevC.100.014308 NA R.Sandler G.Bollen J.Dissanayake M.Eibach K.Gulyuz A.Hamaker C.Izzo X.Mougeot D.Puentes F. G. A.Quarati M.Redshaw R.Ringle I.Yandow article CalonicoLPCB2019 1229 Spectral purity transfer with 5 × 10−17 instability at 1 s using a multibranch Er:fiber frequency comb Metrologia 2019 7 56 4 15SIB05: OFTEN: Optical frequency transfer - a European network 045008 optical frequency comb, multibranch Er:fiber comb, spectral purity transfer,ultrastable laser EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab2b0f NA P.Barbieri C.Clivati M.Pizzocaro F.Levi D.Calonico article PollakowskiMKNDHB2019 1267 Reference-free grazing incidence x-ray fluorescence and reflectometry as a methodology for independent validation of x-ray reflectometry on ultrathin layer stacks and a depth-dependent characterization Journal of Vacuum Science & Technology A 2019 7 37 4 17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques 041502 XRR, GIXRF, nanolayers https://arxiv.org/abs/1903.01196 EMPIR 2017: Support for Impact American Vacuum Society 30 0734-2101, 1520-8559 10.1116/1.5094891 NA P.Honicke B.Detlefs E.Nolot Y.Kayser U.Mühle B.Pollakowski B.Beckhoff article SchmidtCOHBMLK2019 1340 A cryogenic radio-frequency ion trap for quantum logic spectroscopy of highly charged ions Review of Scientific Instruments 2019 7 90 7 17FUN07: CC4C: Coulomb Crystals for Clocks 073201 Optical ClocksTrapped Ions EMPIR 2017: Fundamental AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.5100594 NA T.Leopold S. A.King P.Micke A.Bautista-Salvador J. C.Heip C.Ospelkaus J. R.Crespo López-Urrutia P. O.Schmidt article HonickeKMBPD2019 1270 Reference-free grazing incidence x-ray fluorescence and reflectometry as a methodology for independent validation of x-ray reflectometry on ultrathin layer stacks and a depth-dependent characterization Journal of Vacuum Science & Technology A 2019 7 37 4 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 041502 nanolayer stacks https://arxiv.org/abs/1903.01196 EMPIR 2016: Environment American Vacuum Society 30 0734-2101, 1520-8559 10.1116/1.5094891 NA P.Honicke B.Detlefs Y.Kayser U.Mühle B.Pollakowski B.Beckhoff proceedings HoffmannVQZB2019 1610 Fabrication and Measurements of Inductive Devices for Scanning Microwave Microscopy 2019 IEEE 19th International Conference on Nanotechnology (IEEE-NANO) 2019 7 2019 - 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 1-4 calibration, doping profiles, inductors, scanning probe microscopy, silicon compounds https://zenodo.org/record/4275929 EMPIR 2016: Energy IEEE Macao IEEE Nano 22-07-2019 to 26-07-2019 30 Electronic ISBN: 978-1-7281-28 Electronic ISSN: 1944-9380 Pri NA https://zenodo.org/record/4275929 J.Hoffmann D.Vasyukov T. L.Quang F.Ziade A.Buchter article MurugandBvAtH2019 1816 Measurement challenges for hydrogen vehicles International Journal of Hydrogen Energy 2019 7 44 35 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 19326-19333 Hydrogen; Fuel cell; Vehicles; ISO 14687; Metrology; Measurement; Flow metering; Quality control EnG EMPIR 2016: Energy Elsevier BV 30 0360-3199 10.1016/j.ijhydene.2019.03.190 NA A.Murugan M.de Huu T.Bacquart J.van Wijk K.Arrhenius I.te Ronde D.Hemfrey article KoutsourakisBC2019 1735 Signal Amplification Gains of Compressive Sampling for Photocurrent Response Mapping of Optoelectronic Devices Sensors 2019 6 28 19 13 16ENG02: PV-Enerate: Advanced PV energy rating 2870 non-destructive testing, current mapping, digital micromirror device, compressed sensing EMPIR 2016: Energy MDPI AG 30 1424-8220 10.3390/s19132870 NA G. Koutsourakis J.C.Blakesley F.A.Castro article DRONNEAUFBMG2019 1275 Use Of An Imaging Luminance Measuring Device To Evaluate Road Lighting Performance At Different Angles Of Observation PROCEEDINGS OF the 29th Quadrennial Session of the CIE 2019 6 24 16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting road lighting, dynamic luminance measurements, Imaging Luminance Measuring Device (ILMD), moving observer, angles of observation, 16NRM02 EMPIR 2016: Pre-Co-Normative International Commission on Illumination, CIE 30 10.25039/x46.2019.OP75 NA F.GREFFIER V.Muzet V.BOUCHER F.FOURNELA R.DRONNEAU article BrinkmannMSBLI2019 1322 3D nonrigid motion correction for quantitative assessment of hepatic lesions in DCE‐MRI Magnetic Resonance in Medicine 2019 6 22 82 5 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion 1753-1766 quantification, nonrigid motion correction, hepatic lesions, DCE-MRI EMPIR 2015: Health Wiley 30 0740-3194, 1522-2594 10.1002/mrm.27867 NA M.Ippoliti M.Lukas W.Brenner T.Schaeffter M. R.Makowski C.Kolbitsch proceedings KrokerWSDKB2019 1281 Mueller matrix ellipsometry for enhanced optical form metrology of sub-lambda structures Modeling Aspects in Optical Metrology VII 2019 6 21 11057 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 155-165 Plasmonics, Ellipsometry, Scanning electron microscopy, Numerical simulations, Metrology, Nanostructures, Near field optics EMPIR 2017: Fundamental SPIE Munich International Society for Optics and Photonics Optical Metrology 24-06-2019 to 27-06-2019 30 10.1117/12.2527419 NA T.Käseberg J.Dickmann T.Siefke M.Wurm S.Kroker B.Bodermann article MottonenRKBYFGK2019 1110 Evidence for universality of tunable-barrier electron pumps Metrologia 2019 6 13 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere Single electron pumps, electrical metrology, quantum electrical standards https://arxiv.org/abs/1901.05218 EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab29a5 NA S.Giblin A.Fujiwara G.Yamahata M.H.Bae N.Kim A.Rossi M.Möttönen M.Kataoka article BeckerGKDS2019 1104 Electrometer Calibration With Sub-Part-Per-Million Uncertainty IEEE Transactions on Instrumentation and Measurement 2019 6 68 6 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 1887-1894 Ammeters, calibration, current measurement, measurement standards, measurement uncertainty, precisionmeasurements EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2019.2900129 NA H.Scherer D.Drung C.Krause M.Götz U.Becker article vandenBromHHBKWI2019 1154 An Optoelectronic Pulse Drive for Quantum Voltage Synthesizer IEEE Transactions on Instrumentation and Measurement 2019 6 68 6 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 2066-2071 Josephson arbitrary waveform synthesizer, Josephson arrays, measurement, metrology, optoelectronics, voltage measurement EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2018.2877562 NA J.Ireland J.Williams O.Kieler R.Behr E.Houtzager R.Hornecker H.E.van den Brom article BursikovaKC2019 1250 Fast mechanical model for probe–sample elastic deformation estimation in scanning probe microscopy Ultramicroscopy 2019 6 201 15SIB09: 3DNano: Traceable three-dimensional nanometrology 18-27 Scanning Probe Microscopy,Uncertainty,Elastic deformation https://www.sciencedirect.com/science/article/pii/S0304399118302638 EMPIR 2015: SI Broader Scope Elsevier BV 30 0304-3991 10.1016/j.ultramic.2019.03.010 NA P.Klapetek A.Charvátová Campbell V. Buršíková article TeodoroFBS2019 1265 3D-Simulation of a Bayard Alpert ionisation gauge using SIMION program Vacuum 2019 6 164 16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge 300-307 Vacuum measurementIonisation gaugeSimulationGauge sensitivity EMPIR 2016: Pre-Co-Normative Elsevier BV 30 0042-207X 10.1016/j.vacuum.2019.03.039 NA R.Silva N.Bundaleski A.L.Fonseca O.Teodoro article KorpelainenBDS2019 1297 Tip wear and tip breakage in high-speed atomic force microscopes Ultramicroscopy 2019 6 201 15SIB09: 3DNano: Traceable three-dimensional nanometrology 28-37 Atomic force microscopy (AFM), High-speed AFM, Tip wear, Tip breakage, Tip characterization, Tip-sample interaction EMPIR 2015: SI Broader Scope Elsevier BV 30 0304-3991 10.1016/j.ultramic.2019.03.013 NA T.Strahlendorff G.Dai D.Bergmann R.Tutsch proceedings Buermann2019 1323 Steps Towards Personalized Dosimetry in Computed Tomography Book of Extended Synopses 2019 6 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion 216-217 dosimetry, personalised medicine, CT EMPIR 2015: Health International Atomic Energy Agency Vienna, Austria International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry (IDOS 2019) 18-06-2019 to 21-06-2019 30 NA https://www.iaea.org/sites/default/files/19/06/cn-273-book-extended-synopses.pdf L.Büermann article IvanovGWRBBR2019 1128 Complete dissolution of solid matrices using automated borate fusion in support of nuclear decommissioning and production of reference materials Journal of Radioanalytical and Nuclear Chemistry 2019 5 28 321 1 16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities 183-196 Fusion, dissolution, radionuclide, decommissioning, reference material, characterisation https://link.springer.com/article/10.1007/s10967-019-06572-z EMPIR 2016: Environment Springer Science and Business Media LLC
233 Spring St. New York NY 10013 United States
30 0236-5731, 1588-2780 10.1007/s10967-019-06572-z NA E.Braysher B.Russell S.Woods M.García-Miranda P.Ivanov B.Bouchard D.Read
article MainzBGWSZW2019 1206 Photon flux determination of a liquid-metal jet X-ray source by means of photon scattering Journal of Analytical Atomic Spectrometry 2019 5 23 16ENG03: HyMet: Hybrid metrology for thin films in energy applications Liquid-metal jet, X-ray sources, photon flux determination, elastic and inelastic photon scattering https://arxiv.org/abs/1903.06024 EMPIR 2016: Energy 30 10.1039/C9JA00127A NA M.Wansleben C.Zech C.Streeck J.Weser C.Genzel B.Beckhoff R.Mainz article OliveroBOFCJGSPBFHBER2019 1261 Quantum Micro–Nano Devices Fabricated in Diamond by Femtosecond Laser and Ion Irradiation Advanced Quantum Technologies 2019 5 20 2 5-6 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1900006 diamond, ion‐beam irradiation, nitrogen vacancies ,NV magnetometry, quantum sensing, ultrafast laser writing EMPIR 2017: Fundamental Wiley 30 2511-9044, 2511-9044 10.1002/qute.201900006 NA http://hdl.handle.net/2318/1704485 S.M.Eaton J.P.Hadden V.Bharadwaj J.Forneris F.Picollo F.Bosia B.Sotillo A.N.Giakoumaki O.Jedrkiewicz A.Chiappini M.Ferrari R.Osellame P.E.Barclay P.Olivero R.Ramponi article TibertoCCBMF2019 1266 Infuence of shape, size and magnetostatic interactions on the hyperthermia properties of permalloy nanostructures Scientific Reports 2019 4 29 9 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 6591 Magnetic nanostructures, Hysteresis losses, Micromagnetic modelling https://www.nature.com/articles/s41598-019-43197-4 EMPIR 2015: SI Broader Scope Springer Nature 30 2045-2322 (online) 10.1038/s41598-019-43197-4 NA R.Ferrero A.Manzin G.Barrera F.Celegato M.Coïsson P.Tiberto article MartinezVerduVVBP2019 1014 Graininess characterization by multidimensional scaling Journal of Modern Optics 2019 4 67 1 16NRM08: BiRD: Bidirectional reflectance definitions 1-10 graininess, special-effect pigments, multidimensional scaling algorithm, psychophysical experiment https://www.tandfonline.com/doi/full/10.1080/09500340.2019.1589006 EMPIR 2016: Pre-Co-Normative Taylor & Francis 30 1362-3044 10.1080/09500340.2019.1589006 NA E.Perales F.J.Burgos M.Vilaseca V.Viqueira F.M.Martínez-Verdú article BergstenSSM2019 1076 Four-Terminal Pair Digital Sampling Impedance Bridge up to 1MHz IEEE Transactions on Instrumentation and Measurement 2019 4 68 6 15RPT04: TracePQM: Traceability routes for electrical power quality measurements 1860 - 1869 Bridge circuits, Impedance, Topology, Uncertainty, Standards, Calibration, Multiplexing, impedance measurement, phase comparators, sampling methods, shunts (electrical) EMPIR 2015: Research Potential IEEE 30 0018-9456 10.1109/TIM.2019.2908649 NA S.Maslan M.Šíra T.Skalicka T.Bergsten article BuechelerTSALWCW2019 1241 Time-resolved photoluminescence on double graded Cu(In,Ga)Se2 – Impact of front surface recombination and its temperature dependence Science and Technology of Advanced Materials 2019 4 20 1 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 313-323 time-resolved photoluminescence EMPIR 2016: Energy Informa UK Limited 30 1468-6996, 1878-5514 10.1080/14686996.2019.1586583 NA T.P.Weiss R.Carron M.H.Wolter J.Löckinger E.Avancini S.Siebentritt S.Buecheler A.N.Tiwari article MehlstaublerOBID2019 1040 946-nm Nd:YAG digital-locked laser at 1.1 × 10−16 in 1  s and transfer-locked to a cryogenic silicon cavity Optics Letters 2019 3 29 44 7 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 1781 Ultra-stable laser; Nd:YAG; Fabry-Perot cavity; time and frequency metrology; optical clock; https://arxiv.org/abs/1902.07012 EMPIR 2015: SI Broader Scope The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.44.001781 NA A.Didier S.Ignatovich E.Benkler M.Okhapkin T.E.Mehlstäubler article TiwariBCFBW2019 1240 Bulk and surface recombination properties in thin film semiconductors with different surface treatments from time-resolved photoluminescence measurements Scientific Reports 2019 3 29 9 1 16ENG03: HyMet: Hybrid metrology for thin films in energy applications thin filmsemiconductor EMPIR 2016: Energy Springer Nature 30 2045-2322 10.1038/s41598-019-41716-x NA T.P.Weiss B.Bissig T.Feurer R.Carron S.Buecheler A.N.Tiwari article RosendahlBBKSKS2019 1550 CT beam dosimetric characterization procedure for personalized dosimetry Physics in Medicine & Biology 2019 3 29 64 7 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion 075009 CT beam dosimetric characterization procedure for personalized dosimetry EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/ab0e97 NA S.Rosendahl L.Büermann M.Borowski M.Kortesniemi V-M.Sundell A.Kosunen T.Siiskonen article BurgerZB2019 1058 An auxiliary field approach for computing optical resonances in dispersive media Journal of the European Optical Society-Rapid Publications 2019 3 27 15 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 3 Maxwell’s equations, Material dispersion, Nonlinear eigenvalue problems, Auxiliary field approach EMPIR 2017: Fundamental 30 10.1186/s41476-019-0098-z NA F.Binkowski L.Zschiedrich S.Burger proceedings BurgerZHS2019 1217 Using Gaussian process regression for efficient parameter reconstruction Metrology, Inspection, and Process Control for Microlithography XXXIII 2019 3 26 10959 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1095911 computational metrology, optical metrology, computational lithography, Bayesian optimization,machine learning, finite-element methods, nanooptics https://arxiv.org/abs/1903.12128 EMPIR 2017: Fundamental SPIE San Jose, USA Metrology, Inspection, and Process Control for Microlithography XXXIII 24-02-2019 to 28-02-2019 30 10.1117/12.2513268 NA P-I.Schneider M.Hammerschmidt L.Zschiedrich S.Burger article KiselevDMFVPABBLXBHD2019 1024 Long Slender Piezo-Resistive Silicon Microprobes for Fast Measurements of Roughness and Mechanical Properties inside Micro-Holes with Diameters below 100 µm Sensors 2019 2019 3 22 19(6) 1410 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements cantilever microprobe; high-speed; contact resonance; tip wear; piezo-resistive; mechanical damping; tip-testing standard https://www.mdpi.com/1424-8220/19/6/1410 EMPIR 2017: Industry MDPI AG
Basel
30 10.3390/s19061410 NA U.Brand M.XU L.Doering J.Langfahl-Klabes H.Behle S.Bütefisch T.Ahbe E.Peiner S.Völlmeke T.Frank B.Mickan I.Kiselev M.Hauptmannl M.Drexel
article OelfkeBBD2019_2 1047 The effect of magnetic field strength on the response of Gafchromic EBT-3 film Physics in Medicine & Biology 2019 3 14 64 6 15HLT08: MRgRT: Metrology for MR guided radiotherapy 06NT03 MRI-Linac, MRI-guided radiotherapy, film dosimetry, magnetic field https://iopscience.iop.org/article/10.1088/1361-6560/ab0503 EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/ab0503 NA I.Billas H.Bouchard U.Oelfke S.Duane article MinelliBPRUSSGS2019 1543 Sticky Measurement Problem: Number Concentration of Agglomerated Nanoparticles Langmuir 2019 3 14 35 14 14IND12: Innanopart: Metrology for innovative nanoparticles 4927-4935 Sticky Measurement Problem: Number Concentration of Agglomerated Nanoparticles EMPIR 2014: Industry American Chemical Society (ACS) 30 0743-7463, 1520-5827 10.1021/acs.langmuir.8b04209 NA C.Minelli D.Bartczak R.Peters J.Rissler A.Undas A.Sikora E.Sjöström H.Goenaga-Infante A.G.Shard article BraunBRSB2019 1033 Measurement and Analysis of PMU Reporting Latency for Smart Grid Protection and Control Applications IEEE Access 2019 3 12 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 1-1 Phasor measurement units, Ethernet, Hardware, Real-time systems, Synchronization, Task analysis EMPIR 2017: Industry Institute of Electrical and Electronics Engineers (IEEE) 30 2169-3536 10.1109/ACCESS.2019.2903929 NA S.M.Blair M.H.Syed A.J.Roscoe G.M.Burt J.P.Braun article KurlyandskayaSCMBACT2019 944 Specific loss power measurements by calorimetric and thermal methods on γ-Fe2O3 nanoparticles for magnetic hyperthermia Journal of Magnetism and Magnetic Materials 2019 3 473 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 403-409 Magnetic hyperthermia, Fe-oxide, Magnetic nanoparticles EMPIR 2016: Pre-Co-Normative Elsevier BV 30 0304-8853 10.1016/j.jmmm.2018.10.107 NA M.Coïsson G.Barrera C.Appino F.Celegato L.Martino A.P.Safronov G.V.Kurlyandskaya P.Tiberto article PisaniBE2019 1000 High-Index Glass Ball Retroreflectors for Measuring Lateral Positions Sensors 2019 3 19 5 17IND03: LaVA: Large Volume Metrology Applications 1082 backscattering, retroreflectors, glory, ray tracing, high index ball lenses https://www.mdpi.com/1424-8220/19/5/1082 EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s19051082 NA A.Egidi A.Balsamo M.Pisani proceedings ThalmannMBK2019 1030 CT machine geometry changes under thermal load Nondestructive Testing 2019 3 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 23681 CT machine geometry, thermal influences, geometry measurement system, metrology http://www.ndt.net/?id=23681 EMPIR 2017: Industry NDT.net Padova 9th Conference on Industrial Computed Tomography (iCT) 2019 13-02-2019 to 15-02-2019 30 1435-4934 NA https://www.ndt.net/article/ctc2019/papers/iCT2019_Full_paper_47.pdf R.Thalmann F.Meli B.A.Bircher A.Küng proceedings ThalmannMBK2019_2 1029 CT geometry determination using individual radiographsof calibrated multi-sphere standards Nondestructive Testing 2019 3 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 23677 CT machine geometry, correction, multi-sphere standard, metrology https://www.ndt.net/search/docs.php3?showForm=off&id=23677 EMPIR 2017: Industry NDT.net Padova 9th Conference on Industrial Computed Tomography (iCT) 2019 13-02-2019 to 15-02-2019 30 1435-4934 NA R.Thalmann F.Meli B.A.Bircher A.Küng article ChunnilallKBGRKLPRGD2019 1012 Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source Metrologia 2019 2 22 56 2 17FUN06: SIQUST: Single-photon sources as new quantum standards 025004 single-photon sources, quantum technologies, quantum characterization EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab022e NA E.Rebufello F.Piacentini M.López R.A.Kirkwood I.Ruo Berchera M.Gramegna G.Brida S.Kück C.J.Chunnilall M.Genovese I.P.Degiovanni article ChunnilallKBGRKLPRGD20190 1012 Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source Metrologia 2019 2 22 56 2 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 025004 single-photon sources, quantum technologies, quantum characterization EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab022e NA E.Rebufello F.Piacentini M.López R.A.Kirkwood I.Ruo Berchera M.Gramegna G.Brida S.Kück C.J.Chunnilall M.Genovese I.P.Degiovanni article ChunnilallKBGRKLPRGD20191 1012 Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source Metrologia 2019 2 22 56 2 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 025004 single-photon sources, quantum technologies, quantum characterization EMPIR 2014: Industry IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab022e NA E.Rebufello F.Piacentini M.López R.A.Kirkwood I.Ruo Berchera M.Gramegna G.Brida S.Kück C.J.Chunnilall M.Genovese I.P.Degiovanni article BurgerRRHS2019 1520 Numerical Investigation of Light Emission from Quantum Dots Embedded into On‐Chip, Low‐Index‐Contrast Optical Waveguides physica status solidi (b) 2019 2 15 256 7 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1800437 single photon emitters, coherent light matter interaction, numerical simulations, finite element methods https://arxiv.org/abs/2006.10466 EMPIR 2017: Fundamental Wiley 30 0370-1972, 1521-3951 10.1002/pssb.201800437 NA T.Hoehne P.Schnauber S.Rodt S.Reitzenstein S.Burger article NeuCJBPKC2019 1305 Frontiers of magnetic force microscopy Journal of Applied Physics 2019 2 14 125 6 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 060901 MFM https://aip.scitation.org/doi/10.1063/1.5050712 EMPIR 2015: SI Broader Scope AIP Publishing 30 0021-8979, 1089-7550 10.1063/1.5050712 NA O.Kazakova R.Puttock C.Barton H.Corte-León HectorCorte-Leon M.Jaafar V.Neu article MendezSBCKSD2019 1021 Characterization of an analog-to-digital converter frequency response by a Josephson arbitrary waveform synthesizer Measurement Science and Technology 2019 2 11 30 3 15RPT04: TracePQM: Traceability routes for electrical power quality measurements 035006 quantum standard, digital converter, Josephson arbitrary waveform synthesizer, programmable Josephson voltage standard, Monte Carlo method, Sine fitting algorithms, artificial neural network (ANN) https://iopscience.iop.org/article/10.1088/1361-6501/aafb27/meta EMPIR 2015: Research Potential IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aafb27 NA J.Diaz de Aguilar J.R.Salinas O.Kieler R.Caballero R.Behr Y.A.Sanmamed A.Méndez article McPeakBHGW2019 1059 Correlation of circular differential optical absorption with geometric chirality in plasmonic meta-atoms Optics Express 2019 2 11 27 4 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 5097 circular differential optical absorption, chirality, plasmonics EMPIR 2017: Fundamental 30 10.1364/OE.27.005097 NA J.C.Wilson P.Gutsche S.Herrmann S.Burger K.M.McPeak article DittmannFHGBHKWPSDM2019 1001 Results of four European round-robins on short-circuit current temperature coefficient measurements of photovoltaic devices of different size Solar Energy 2019 2 179 16ENG02: PV-Enerate: Advanced PV energy rating 424-436 Photovoltaics, Short-circuit current temperature coefficient intercomparisons, Spectral temperature coefficients, Bare cells to full-size modules EMPIR 2016: Energy Elsevier BV 30 0038-092X 10.1016/j.solener.2018.10.051 NA E.Salis D.Pavanello I.Kröger S.Winter K.Bothe D.Hinken T.Gandy J.Hohl-Ebinger G.Friesen S.Dittmann J.Dubard H.Müllejans article LazzeriniDGVKYB2019 1074 Design and performance of a test rig for evaluation of nanopositioning stages Measurement Science and Technology 2019 2 30 3 15SIB09: 3DNano: Traceable three-dimensional nanometrology 035002 multi-axis positioning stages, traceability, nanopositioning, dimensional metrology EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aafd03 NA AndrewYacoot PetrKlapetek MiroslavValtr PetrGrolich HerveDongmo Giovanni MLazzerini AngusBridges article HarrisDBSKDS2019 1160 Children With Cystic Fibrosis Are Infected With Multiple Subpopulations of Mycobacterium abscessus With Different Antimicrobial Resistance Profiles Clinical Infectious Diseases 2019 1 26 15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance lung transplant, whole-genome sequencing, within-patient diversity, macrolides, physiological niches EMPIR 2015: Health Oxford University Press (OUP) 30 1058-4838, 1537-6591 10.1093/cid/ciz069 NA L.P.Shaw R.M.Doyle E.Kavaliunaite H.Spencer F.Balloux G.Dixon K.A.Harris article DegiovanniB2019 1011 Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology Metrologia 2019 1 25 56 2 17FUN06: SIQUST: Single-photon sources as new quantum standards 024001 quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaf7b2 NA I.R.Berchera I.P.Degiovanni article DegiovanniB20190 1011 Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology Metrologia 2019 1 25 56 2 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 024001 quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaf7b2 NA I.R.Berchera I.P.Degiovanni article DegiovanniB20191 1011 Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology Metrologia 2019 1 25 56 2 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 024001 quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics EMPIR 2014: Industry IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaf7b2 NA I.R.Berchera I.P.Degiovanni article KochKBWHBISIK2019 Does airborne ultrasound lead to activation of the auditory cortex? Biomedical Engineering / Biomedizinische Technik 2019 1 18 HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound airborne ultrasound; brain imaging; hearingthreshold EMRP A169: Call 2011 Metrology for Health Walter de Gruyter GmbH 30 1862-278X, 0013-5585 10.1515/bmt-2018-0048 NA C.Koch R.Kühler M.Bauer M.Weichenberger J.Hensel R.Brühl A.Ihlenfeld T.Sander B.Ittermann S.Kühn article JarosovaKBPN2019 975 Intraocular Pressure Response to Short-Term Extreme Normobaric Hypoxia Exposure Frontiers in Endocrinology 2019 1 9 785 16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements 1-7 intraocular pressure, hypoxia, normobaric hypoxia, glaucoma, oxygen saturation https://www.frontiersin.org/research-topics/6935/the-role-of-hypoxia-in-the-regulation-of-metabolism EMPIR 2016: Research Potential Frontiers Media SA 30 1664-2392 10.3389/fendo.2018.00785 NA E.Najmanová F.Pluháček M.Botek J.Krejčí J.Jarošová article OliveroDFGRBLKTMCKGD2019 1007 Feasibility study towards comparison of the g (2)(0) measurement in the visible range Metrologia 2019 1 56 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 015016 colour centers, single-photon source, metrology for quantum technologies EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaf6c8 NA E.Moreva P.Traina R.A.Kirkwood M.López G.Brida M.Gramegna I.Ruo-Berchera J.Forneris S.Ditalia Tchernij P.Olivero C.J.Chunnilall S.Kück M.Genovese I.P.Degiovanni article ZschiedrichFRBHG2019 1060 Decomposition of scattered electromagnetic fields into vector spherical wave functions on surfaces with general shapes Physical Review B 2019 1 99 4 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 045406 light scattering, vector spherical wave functions https://arxiv.org/abs/1808.02315 EMPIR 2017: Fundamental 30 10.1103/PhysRevB.99.045406 NA X.Garcia Santiago M.Hammerschmidt S.Burger C.Rockstuhl I.Fernandez-Corbaton L.Zschiedrich article OliveroDFGRBLKTMCKGD20190 1007 Feasibility study towards comparison of the g (2)(0) measurement in the visible range Metrologia 2019 1 56 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 015016 colour centers, single-photon source, metrology for quantum technologies EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaf6c8 NA E.Moreva P.Traina R.A.Kirkwood M.López G.Brida M.Gramegna I.Ruo-Berchera J.Forneris S.Ditalia Tchernij P.Olivero C.J.Chunnilall S.Kück M.Genovese I.P.Degiovanni article OliveroDFGRBLKTMCKGD20191 1007 Feasibility study towards comparison of the g (2)(0) measurement in the visible range Metrologia 2019 1 56 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 015016 colour centers, single-photon source, metrology for quantum technologies EMPIR 2014: Industry IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaf6c8 NA E.Moreva P.Traina R.A.Kirkwood M.López G.Brida M.Gramegna I.Ruo-Berchera J.Forneris S.Ditalia Tchernij P.Olivero C.J.Chunnilall S.Kück M.Genovese I.P.Degiovanni article MohnsHBHR2019 1041 Comparison of Reference Setups for Calibrating Power Transformer Loss Measurement Systems IEEE Transactions on Instrumentation and Measurement 2019 17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors power transformers, loss measurement, power transformer losses, load loss, shunt reactor, power measurement, comparison, calibration, high voltage, uncertainty. SEG EMPIR 2017: Pre-Co-Normative 30 10.1109/TIM.2018.2879171 NA GertRietveld EnricoMohns ErnestHoutzager HenrikBadura DennisHoogenboom article BaduraCMR2019 1042 A Fundamental Step-Up Method for Standard Voltage Transformers Based on an Active Capacitive High-Voltage Divider IEEE Transactions on Instrumentation and Measurement 2019 17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors Capacitors, Standards, Voltage measurement, Calibration, Uncertainty, Gain, Voltage transformersCapacitive divider, high voltage, inductive voltage divider (IVD), phase displacement, ratio error SEG EMPIR 2017: Pre-Co-Normative 30 10.7795/EMPIR.17NRM01.CA.20190408 NA H.Badura J.Chunyang E.Mohns P.Raether article AkramMNBKKO2019 1056 Pulsation of InGaAs photodiodes in liquid helium for driving Josephson arrays in ac voltage realization IEEE Transactions on Applied Superconductivity 2019 29 7 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 1200308 Photodiodes, Integrated circuits, Josephson junctions, Optical distortion, Junctions, Bit rate, Optical pulses EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 1051-8223, 1558-2515, 2378-707 10.1109/TASC.2019.2901573 NA B.Karlsen O.Kieler R.Behr T.A.Tuan Nguyen H.Malmbekk M.N.Akram P.A.Ohlckers article RydlerB2019 1138 Realization of Absolute Phase and AC Resistance of Current Shunts by Ratio Measurements IEEE Transactions on Instrumentation and Measurement 2019 68 6 15RPT04: TracePQM: Traceability routes for electrical power quality measurements 2041-2046 Capacitance, current shunt,impedance measurement, inductance, measurement standards, phase measurement, resistance https://ieeexplore.ieee.org/document/8608020 EMPIR 2015: Research Potential IEEE 30 1557-9662 10.1109/TIM.2018.2882927 NA T.Bergsten K.E.Rydler inbook PriceRBSW2019 1192 Standardisation of magnetic nanomaterials: Steps towards magnetic reference particles 2019 PTB-Berich 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 200-208 standardisation, magnetic nanomaterials, reference materials, EMPIR 2016: Pre-Co-Normative Fachverlag NW in Carl Ed. Schünemann KG
Bremen
NanoWorkshop 2018: Workshop on Reference Nanomaterials 30 978-3-95606-440-1 0179-0609 10.7795/110.20190412 NA A.Price R.Rüttinger R.Bleul U.Steinhoff F.Wiekhorst
article GodDCBYDDRW2019 1238 High-rank Symmetries in Nuclei: Challenges for Prediction Capacities of the Nuclear Mean-field Theories Acta Physica Polonica B 2019 50 3 15SIB10: MetroBeta: Radionuclide beta spectra metrology 685 Nuclear mean field theory, modeling prediciton capacities, nuclear point group symmetreis, high-rank symmetries EMPIR 2015: SI Broader Scope Jagiellonian University 30 0587-4254, 1509-5770 10.5506/APhysPolB.50.685 NA J.Dudek I.Dedes J.Yang A.Baran D.Curien T.Dickel A.Góźdź D.Rouvel H.L.Wang proceedings BuzoianuRF2019 1244 Recent progress in chemical measuring capabilities in INM as a result of EMRP/EMPIR Programme 19th International Congress of Metrology (CIM2019) 2019 20004 (2019) 16RPT02: ALCOREF: Certified forensic alcohol reference materials 1-13 ICP-MS, gas chromatography EMPIR 2016: Research Potential EDP Sciences LNE CIM 2019 - 19th International Metrology Congress 16-09-2019 to 21-09-2019 30 10.1051/metrology/201920004 NA M.Buzoianu M.Radu G.V.Ionescu proceedings Buzoianu2019 1245 Work at the INM to Develop Measurement Capabilities to Assign Reference Values in Proficiency Testing Schemes - 2019 - - 16RPT01: ChemMet-Cap: Development of scientific and technical capabilities in the field of chemical analysis Proficiency Testing Schemes http://www.pt-conf.org/2019/wp-content/uploads/2019/09/Proceedings-PT-Conf-2019.pdf EMPIR 2016: Research Potential -
1 rue Gaston Boissier
LNE 7TH INTERNATIONAL PROFICIENCY TESTING CONFERENCE 10-09-2019 to 13-09-2019 30 - - NA http://www.pt-conf.org/2019/wp-content/uploads/2019/09/Proceedings-PT-Conf-2019.pdf M.Buzoianu
proceedings BuzoianuRF20190 1244 Recent progress in chemical measuring capabilities in INM as a result of EMRP/EMPIR Programme 19th International Congress of Metrology (CIM2019) 2019 20004 (2019) 16RPT01: ChemMet-Cap: Development of scientific and technical capabilities in the field of chemical analysis 1-13 ICP-MS, gas chromatography EMPIR 2016: Research Potential EDP Sciences LNE CIM 2019 - 19th International Metrology Congress 16-09-2019 to 21-09-2019 30 10.1051/metrology/201920004 NA M.Buzoianu M.Radu G.V.Ionescu proceedings SpasovaBNOSCTHZSAV2019 1490 A new EMPIR Project “MetForTC” for Developing Traceable Measurement Capabilities for Monitoring Thermocouple Performance 19th International Congress of Metrology (CIM2019) 2019 - 2019 18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance 5/18006 EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple EMPIR 2018: Research Potential EDP Sciences Paris, France 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201918006 NA N.Arifovic D.Sestan D.Zvizdić N.Hozic E.Turzó-András S.Čohodarević R.Strnad K.Opel D.Neagu C.Bordianu S.Spasova T.Vukičević article Brown2019 1728 Semantic Web Technologies for Data Curation and Provenance Zenodo 2019 17IND02: SmartCom: Communication and validation of smart data in IoT-networks Semantic Data Curation Provenance https://zenodo.org/record/4305667 EMPIR 2017: Industry Zenodo 30 10.5281/zenodo.4305667 NA C.Brown proceedings GiordanoCRMGLFRSBD2019 1945 Pantograph-Catenary Arc Detection Technique based on Conducted Effects Measurement on Railway Supply System WCRR Papers 2019 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems arc discharge; electric arc; Power quality; rail transportation system; EMPIR 2016: Energy Tokyo, Japan WORLD CONGRESS OF RAIL RESEARCH (WCRR), Tokyo, Japan, 28 October - 1 November 2019 28-10-2019 to 01-11-2019 30 NA https://zenodo.org/record/4587794 D.Giordano G.Crotti P.Roccato A.Mariscotti D.Gallo M.Luiso N. Filippini I.Rossetta C.Spalvieri A.Biancucci L.Domandio article SchererBKDG2018 1105 Calibrating Ultrastable Low-Noise Current Amplifiers of the Second Generation With a Cryogenic Current Comparator IEEE TRANSACTIONS ON INSTRUMENTATION AND MEASUREMENT 2018 12 21 68 6 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 2027-2033 Calibration, current comparator, current measurement, low-noise amplifiers, measurement uncertainty. EMPIR 2015: SI Broader Scope IEEE 30 0018-9456 10.1109/TIM.2018.2884060 NA M.Götz D.Drung C.Krause U.Becker H.Scherer article SchioppoNMMLLIHCFBBBBAWSLWZZZ2018 958 New bounds on dark matter coupling from a global network of optical atomic clocks Science Advances 2018 12 4 12 15SIB03: OC18: Optical clocks with 1E-18 uncertainty eaau4869 optical atomic clocks, sensor network, dark matter http://advances.sciencemag.org/content/4/12/eaau4869.full EMPIR 2015: SI Broader Scope American Association for the Advancement of Science (AAAS) 30 2375-2548 10.1126/sciadv.aau4869 NA P.Wcisło P.Ablewski K.Beloy S.Bilicki M.Bober R.Brown R.Fasano R.Ciuryło H.Hachisu T.Ido J.Lodewyck A.Ludlow W.McGrew P.Morzyński D.Nicolodi M.Schioppo M.Sekido R.Le Targat P.Wolf X.Zhang B.Zjawin M.Zawada proceedings nceABADU2018 1023 Development of Dynamic Calibration Machine for Pressure Transducers Journal of Physics: Conference Series 2018 12 1065 2018 17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures 162013 dynamic pressure, dynamic calibration, pressure measurement, pressure calibration, pressure transducer, traceability, signal conditioning, drop mass https://doi.org/10.1088/1742-6596/1065/16/162013 EMPIR 2017: Industry IOP Publishing Belfast XXII World Congress of the International Measurement Confederation (IMEKO 2018) 03-09-2018 to 06-09-2018 30 1742-6588, 1742-6596 1742-6588, 1742-6596 10.1088/1742-6596/1065/16/162013 NA Y.Durgut B.Aydemir E.Bağcı E.Akşahin A.T.İnce U.Uslukılıç thesis BrunPicard2018 1218 Une nouvelle génération d'étalons quantiques fondée sur l'effet Hall quantique 2018 12 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere Graphène, effet Hall quantique, métrologie https://hal.archives-ouvertes.fr/tel-01973021 EMPIR 2015: SI Broader Scope Université Paris-Saclay Paris-Saclay 37 NA J.Brun-Picard techreport KleinHDBBK2018 1413 NanoWorkshop 2018: Workshop on Reference Nanomaterials; Current Situation and needs: development, measurement, Standardization PTB bericht 2018 12 F-61 F-61 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements 1-315 Comparability of Measurement Results;Nanomaterial Properties;Nanometrology;Nanoparticle Characterization;Reference Nanomaterials;Standardization https://oar.ptb.de/resources/show/10.7795/110.20190412 EMPIR 2016: Pre-Co-Normative Physikalisch-Technische Bundesanstalt 30 78-3-95606-440-1 0179-0609 10.7795/110.20190412 NA T.Klein V.-D.Hodoroaba T.Dziomba E.Buhr H.Bosse M.Krumrey article ColemanGKBDR2018 970 Flow rate measurement in stacks with cyclonic flow – Error estimations using CFD modelling Measurement 2018 12 129 16ENV08: IMPRESS 2: Metrology for air pollutant emissions 167-183 flow measurement, cyclonic flow, velocity measurements, standard reference method, ultrasonic flow measurement, EN ISO 16911-2, validated computational fluid dynamics (CFD) modelling, OpenFoam software, Emissions Trading System https://arxiv.org/ftp/arxiv/papers/1808/1808.10159.pdf EMPIR 2016: Environment Elsevier BV 30 0263-2241 10.1016/j.measurement.2018.06.032 NA J.Gersl S.Knotek Z.Belligoli R.P.Dwight R.A.Robinson M.D.Coleman article DorscherASBSSPOHHSL2018 1054 Towards an optical clock for space: Compact, high-performance optical lattice clock based on bosonic atoms Physical Review A 2018 11 29 98 5 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 053443 optical clocks, optical lattice clock, isotope shift, clock comparisons https://www.ptb.de/cms/fileadmin/internet/fachabteilungen/abteilung_4/4.3_quantenoptik_und_laengeneinheit/4.32/ori18.pdf EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.98.053443 NA S.Origlia M.S.Pramod S.Schiller Y.Singh K.Bongs R.Schwarz A.Al-Masoudi S.Dörscher S.Herbers S.Häfner U.Sterr C.Lisdat proceedings PeinerXBVKF2018 1025 Optimizing a Cantilever Measurement System towards High Speed, Nonreactive Contact-Resonance-Profilometry Proceedings 2018 11 21 2 13 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 889 contact resonance spectroscopy; layer analysis; piezoresistive; tactile cantilever;automatic gain control; phase-locked-loop https://www.mdpi.com/2504-3900/2/13/889 EMPIR 2017: Industry MDPI AG Graz, Austria Eurosensors 2018 09-09-2018 to 12-09-2018 30 2504-3900 10.3390/proceedings2130889 NA M.Fahrbach L.Krieg T.Voss M.Bertke J.Xu E.Peiner article BarreraFigueroa2018 Free-field reciprocity calibration of measurement microphones at frequencies up to 150 kHz The Journal of the Acoustical Society of America 2018 10 31 144 4 HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound 2575-2583 airborne noise assessment, ultrasound in air, microphone calibration, free-field reciprocity EMRP A169: Call 2011 Metrology for Health Acoustical Society of America (ASA) 30 0001-4966 10.1121/1.5063815 NA S.Barrera-Figueroa article VargasBCMPR2018 894 An Unmanned Aircraft System to Detect a Radiological Point Source Using RIMA Software Architecture Remote Sensing 2018 10 30 10 11 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 1712 UAS, CZT, UAS software Architecture, radiological detection EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs10111712 NA P.Royo E.Pastor M.Macias R.Cuadrado C.Barrado A.Vargas article ClarkPLPBDMSSS2018 883 Crystallographic texture can be rapidly determined by electrochemical surface analytics Acta Materialia 2018 10 15 159 1 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 89-101 Orientation mapping, Crystallographic characterisation, Electrochemical jet processing, https://www.sciencedirect.com/science/article/pii/S1359645418305998 EMPIR 2015: SI Broader Scope Elsevier BV 30 1359-6454 10.1016/j.actamat.2018.07.059 NA A.Speidel R.Su R.Su J.Mitchell-Smith P.Dryburgh I.Bisterov D.Pieris W.Li R.Patel M.Clark article HuldSBGD2018 Energy-based metric for analysis of organic PV devices in comparison with conventional industrial technologies Renewable and Sustainable Energy Reviews 2018 10 93 ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification 76-89 Energy, Transport and Climate EMRP A169: Call 2013 Energy II Elsevier BV 30 1364-0321 10.1016/j.rser.2018.04.029 NA T.Huld E.Salis G.Bardizza A.M.Gracia-Amillo E.D.Dunlop article BurianovaVS2018 810 Tissue-equivalence of 3D-printed plastics for medical phantoms in radiology Journal of Instrumentation 2018 9 20 13 09 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy P09018-P09018 Medical phantom; radiology; ionizing radiation; 3D print; linear attenuation coefficient; Hounsfield unit http://mrtdosimetry-empir.eu/?page_id=1166 EMPIR 2015: Health IOP Publishing 30 1748-0221 10.1088/1748-0221/13/09/P09018 NA J.Solc T.Vrba L.Burianová article YangBJCJTS2018 Individualized magnetoencephalography using optically pumped magnetometers with an anatomy derived sensor holder Biomedical Engineering / Biomedizinische Technik 2018 9 63 s1 HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound 240 OPM, SQUID, SQUID-MEG, signal-to-noise ratio EMRP A169: Call 2011 Metrology for Health Walter de Gruyter GmbH
Berlin
30 1862-278X, 0013-5585 10.1515/bmt-2018-6045 NA T.Yang R.Brühl A. Jodko-Władzińska P.Cotic Smole V.Jazbinšek L.Trahms T.Sander-Thömmes
article HaasSSRBH2018 A gravitational telescope deformation model for geodetic VLBI Journal of Geodesy 2018 8 29 93 5 SIB60: Surveying: Metrology for long distance surveying 669-680 VLBI, Telescope deformation, Systematic errors, Terrestrial reference frames http://link.springer.com/article/10.1007/s00190-018-1188-1 EMRP A169: Call 2012 SI Broader scope (II) Springer Nature 30 0949-7714, 1432-1394 10.1007/s00190-018-1188-1 NA R.Haas C.G.Svantesson J.Spetz C.Rieck S.Bergstrand M.Herbertsson article CastroBW2018 786 Assessing the Validity of Transient Photovoltage Measurements and Analysis for Organic Solar Cells Physical Review Applied 2018 8 24 10 2 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 024038 photovoltaics, transient photovoltage, transient photocurrent, organic solar cells, finite-element method, organic semiconductors https://journals.aps.org/prapplied/abstract/10.1103/PhysRevApplied.10.024038 EMPIR 2016: Energy American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.024038 NA S.Wood J.C.Blakesley F.A.Castro article StrupinskiUOGPMPMPWKB2018 992 Electrical Homogeneity Mapping of Epitaxial Graphene on Silicon Carbide ACS Applied Materials & Interfaces 2018 8 21 10 37 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics 31641-31647 conductivity; graphene; metrology; micro four-point probe; SiC; terahertz spectroscopy https://pubs.acs.org/doi/10.1021/acsami.8b11428 EMPIR 2016: Pre-Co-Normative American Chemical Society (ACS) 30 1944-8244, 1944-8252 10.1021/acsami.8b11428 NA P.R.Whelan V.Panchal D.H.Petersen D.M.A.Mackenzie C.Melios I.Pasternak J.Gallop F.W.Østerberg P.U. Jepsen W.Strupinski O.Kazakova P.Bøggild article SieversYSHGBTCBF2018 996 Excitation and coherent control of magnetization dynamics in magnetic tunnel junctions using acoustic pulses Applied Physics Letters 2018 8 13 113 7 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements Excitation, Coherent control, Magnetization dynamics, magnetic tunnel junctions, acoustic pulses https://arxiv.org/abs/1804.10503 EMPIR 2015: SI Broader Scope 30 10.1063/1.5037780 NA H.F.Yang F.Garcia-Sanchez X.K.Hu S.Sievers T.Böhnert J.D.Costa M.Tarequzzaman R.Ferreira M.Bieler H.W.Schumacher article BruchertseiferFCDPHVPLMM2018 Measurement of absolute γ-ray emission probabilities in the decay of 227Ac in equilibrium with its progeny Applied Radiation and Isotopes 2018 8 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity γ-ray intensities, 227Ac, 227Th, 223Ra, decay data, γ-ray spectrometry EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2018.08.023 NA F.Bruchertseifer A.Fazio P.Carconi P.Dryák S.Pierre M.Hult R.Van Ammel S.Pommé G.Lutter M.Marouli A.Morgenstern article NeuvonenAALBBPMSPFWSBL2018 1062 Establishing traceability for liquid density measurements in Europe: 17RPT02-rhoLiq a new EMPIR joint research project Journal of Physics: Conference Series 2018 8 1065 8 17RPT02: rhoLiq: Establishing traceability for liquid density measurements 082013 density of liquids; hydrostatic weighing; oscillation-type density meters https://iopscience.iop.org/article/10.1088/1742-6596/1065/8/082013/pdf EMPIR 2017: Research Potential IOP Publishing
Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom
30 1742-6588, 1742-6596 10.1088/1742-6596/1065/8/082013 NA A.Furtado J.Pereira M.Schiebl G.Mares G.Popa P.Bartos J.Bebic E.Lenard A.Alic S.Alisic P.Neuvonen H.Wolf G.Sariyerli A.Bescupschii B.Laky
article OguzAytekinKMSISFSZSJoHBHPV2018 1086 Improving emerging European NMIs’ capabilities in humidity measurement Journal of Physics: Conference Series 2018 8 1065 15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement 122019 Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019 EMPIR 2015: Research Potential IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1065/12/122019 NA N.Hodzic S.Čohodarević N.Jandrić R.Strnad D.Zvizdić D.Sestan V.Fernicola D.Smorgon L.Iacomini S.Simic D.Mac Lochlainn N.Karaboce S.Oguz Aytekin J.Bojkovski D.Hudoklin O.Petrušova T.Vukičević article BehrHDBIIWBS2018 1153 Towards a Metrology class ADC based on Josephson junction devices Journal of Physics: Conference Series 2018 8 1065 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 052044 Metrology, Josephson, ADC, DC Voltage, AC Voltage EMPIR 2015: SI Broader Scope IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1065/5/052044 NA A.Belcher J.Williams J.Ireland R.Iuzzolino M.E.Bierzychudek R.Dekker J.Herick R.Behr K.Schaapman article OlbrichSROBS2018 1626 Validation of simulations in multiphase flow metrology by comparison with experimental video observations Journal of Physics: Conference Series 2018 8 1065 16ENG07: MultiFlowMet II: Multiphase flow reference metrology 092015 Multiphase flow, slug flow, CFD, liquid level extraction, frequency analysis EMPIR 2016: Energy IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1065/9/092015 NA M.Olbrich E.Schmeyer L.Riazy K.Oberleithner M.Bär S.Schmelter article KuuskABVF2018 2453 Implication of Illumination Beam Geometry on Stray Light and Bandpass Characteristics of Diode Array Spectrometer IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing 2018 8 11 8 16ENV03: MetEOC-3: Further metrology for earth observation and climate 2925-2932 Optical fibre devices, Optical spectroscopy, stray light, laser measurement, Illumination beam geometry EMPIR 2016: Environment Institute of Electrical and Electronics Engineers (IEEE) 30 1939-1404, 2151-1535 10.1109/JSTARS.2018.2841772 NA J.Kuusk I.Ansko A.Bialek R.Vendt N.Fox article McKennaGSBCHGP2018 608 Exposure of mass-selected bimetallic Pt–Ti nanoalloys to oxygen explored using scanning transmission electron microscopy and density functional theory RSC Advances 2018 7 31 8 52 14IND12: Innanopart: Metrology for innovative nanoparticles 27276–27282 Nanoparticles, nanotechnology, nanoalloys, platinum, bimetallic, electron microscopy http://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra02449a EMPIR 2014: Industry The Royal Society of Chemistry 30 2046-2069 10.1039/C8RA02449A NA S.Gholhaki S.Hung D.Cant C.Blackmore A.Shard Q.Guo K.McKenna R.Palmer article BoarinoRDSPDGFMC2018 846 Influence of the long-range ordering of gold-coated Si nanowires on SERS Scientific Reports 2018 7 27 8 1 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance surface-enhanced Raman spectroscopy; substrates for bio-analytical applications; flexible gold-coated Si nanowires https://www.nature.com/articles/s41598-018-29641-x.pdf EMPIR 2015: Health Springer Nature 30 2045-2322 10.1038/s41598-018-29641-x NA E.Cara L.Mandrile F.Ferrarese Lupi A.M.Giovannozzi M.Dialameh C.Portesi K.Sparnacci N.De Leo A.M.Rossi L.Boarino article HoflingSBBHSGLFSKRS2018_2 696 Photon-Number-Resolved Measurement of an Exciton-Polariton Condensate Physical Review Letters 2018 7 25 121 4 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 047401 Exciton Polariton, Photon Statistics https://arxiv.org/abs/1805.02959 EMPIR 2014: Industry American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.121.047401 NA M.Klaas E.Schlottmann H.Flayac F. P.Laussy F.Gericke M.Schmidt M. v.Helversen J.Beyer S.Brodbeck H.Suchomel S.Höfling S.Reitzenstein C.Schneider article JelezkoDNAEBGJSMTFDGO2018 1010 Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept Physical Review Applied 2018 7 25 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance https://arxiv.org/abs/1706.07935 EMPIR 2017: Fundamental American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.014024 NA J.Forneris S.Ditalia Tchernij P.Traina E.Moreva N.Skukan M.Jakšić V.Grilj F.Bosia E.Enrico G.Amato I.P.Degiovanni B.Naydenov F.Jelezko M.Genovese P.Olivero article JelezkoDNAEBGJSMTFDGO20180 1010 Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept Physical Review Applied 2018 7 25 10 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance EMPIR 2017: Fundamental American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.014024 NA https://arxiv.org/abs/1706.07935 J.Forneris S.Ditalia Tchernij P.Traina E.Moreva N.Skukan M.Jakšić V.Grilj F.Bosia E.Enrico G.Amato I.P.Degiovanni B.Naydenov F.Jelezko M.Genovese P.Olivero article vanSchaikPBP2018 999 Climatic chamber for dew-point temperatures up to 150 °C Metrologia 2018 7 13 55 4 14IND11: HIT: Metrology for humidity at high temperatures and transient conditions 597-608 calibration, high temperatures, relative humidity, sensors, speed of sound https://iopscience.iop.org/article/10.1088/1681-7575/aacecc/meta EMPIR 2014: Industry IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aacecc NA R.Bosma R.J.Pouw W.van Schaik A.Peruzzi article RottgerDDBKN2018 Novel spectrometers for environmental dose rate monitoring Journal of Environmental Radioactivity 2018 7 187 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 115-121 Environmental dosimetry, Spectrometers, MetroERM, Early warning networks https://www.sciencedirect.com/science/article/pii/S0265931X17304976?via%3Dihub EMRP A169: Call 2013 Environment II Elsevier BV 30 0265-931X 10.1016/j.jenvrad.2018.01.020 NA A.Röttger H.Dombrowski R.Dabrowski B.Behnke P.Kessler S.Neumaier article WeisbachKHDBALKHW2018 515 Development and characterization of sub-monolayer coatings as novel calibration samples for X-ray spectroscopy Spectrochimica Acta Part B: Atomic Spectroscopy 2018 7 145 14IND07: 3D Stack: Metrology for manufacturing 3D stacked integrated circuits 36-42 X-ray fluorescence, calibration samples https://arxiv.org/abs/1801.04246 EMPIR 2014: Industry Elsevier BV 30 0584-8547 10.1016/j.sab.2018.04.001 NA P.Honicke M.Krämer L.Lühl K.Andrianov B.Beckhoff R.Dietsch T.Holz B.Kanngießer D.Weißbach T.Wilhein article SigrayLCBMBBAHRGCBD2018 904 Calibration standards for hydrophones and autonomous underwater noise recorders for frequencies below 1 kHz: current activities of EMPIR “UNAC-LOW” project ACTA IMEKO 2018 7 7 2 15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz 32 low frequency hydrophone calibration; low frequency underwater noise recorders; underwater acoustics; calibration http://dx.doi.org/10.21014/acta_imeko.v7i2.542 EMPIR 2015: Research Potential IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v7i2.542 NA A.Biber A.C.Çorakçı A.Golick S.Robinson G.Hayman J.Ablitt S.Barrera-Figueroa S.Buogo S.Mauro F.Borsani S.Curcuruto M.Linné P.Sigray P.Davidsson article EllingsbergBAVLRWPS2018 1376 Evaluation of EMI Effects on Static Electricity Meters 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 2018 7 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters. SEG https://zenodo.org/record/3587786#.XiGxp3u7KUn EMPIR 2017: Pre-Co-Normative IEEE 30 10.1109/CPEM.2018.8500945 NA P.S.Wright G.Rietveld F.Leferink H.E.van den Brom F.R.IAlonso J.P.Braun K.Ellingsberg M.Pous M.Svoboda article LudwigSKSDGTNPFJBPKRI2018 900 Development of white LED illuminants for colorimetry and recommendation of white LED reference spectrum for photometry Metrologia 2018 6 28 55 4 15SIB07: PhotoLED: Future photometry based on solid-state lighting products 526-534 Photometry, colorimetry, illuminant, reference spectrum, photometer, calibration, uncertainty EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aacae7 NA A.Kokka T.Poikonen P.Blattner S.Jost A.Ferrero T.Pulli M.Ngo A.Thorseth T.Gerloff P.Dekker F.Stuker A.Klej K.Ludwig M.Schneider T.Reiners E.Ikonen article YuWMGDCBBTCOGM2018 955 Preliminary assessment of stable nitrogen and oxygen isotopic composition of USGS51 and USGS52 nitrous oxide reference gases and perspectives on calibration needs Rapid Communications in Mass Spectrometry 2018 6 26 32 15 16ENV06: SIRS: Metrology for stable isotope reference standards 1207-1214 N2O, reference material, isotope delta value, USGS51, USGS52 https://onlinelibrary.wiley.com/doi/10.1002/rcm.8257 EMPIR 2016: Environment Wiley 30 0951-4198 10.1002/rcm.8157 NA N.E.Ostrom H.Gandhi T.B.Coplen S.Toyoda J.K.Böhlke W.A.Brand K.L.Casciotti J.Dyckmans A.Giesemann J.Mohn J.Mohn R.Well L.Yu manual KielerBWMRCSBSSCDOB2018 719 Good Practice Guide on the operation of AC quantum voltage standards 2018 6 21 1 14RPT01: ACQ-PRO: Towards the propagation of ac quantum voltage standards ISBN ok https://grp.isbn-international.org/search/piid_cineca_solr/978-80-905619%2B%2528ISBNPrefix%2529?keys=978-80-905619%2B%2528ISBNPrefix%2529 Good Practice Guide, quantum standards, alternating voltage, Josephson effect, measurement techniques, uncertainty estimation, software tools, safe operation, cryogenic equipment EMPIR 2014: Research Potential Czech Metrology Institute
Brno
30 978-80-905619-2-2 NA http://acqpro.cmi.cz/index.php/results/28-good-practice-guide O.Kieler R.Behr J.M.Williams H.Malmbekk L.Ribeiro V.Cabral A.Sosso P.Bruszewski M.Šíra Y.A.Sanmamed R.Caballero J.Diaz de Aguilar R.Orhan G.Bonfait
article HarrisHRB2018 905 Signal-modelling methods applied to the free-field calibration of hydrophones and projectors in laboratory test tanks Measurement Science and Technology 2018 6 19 29 8 15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz 085001 underwater acoustics, transducer calibration, signal-modelling, non-linear least-squares EMPIR 2015: Research Potential IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aac752 NA S.P.Robinson G.Hayman P.M.Harris G.A.Beamiss article GoenagaInfanteBWSSSM2018 575 Measuring the relative concentration of particle populations using differential centrifugal sedimentation Analytical Methods 2018 6 14 10 22 14IND12: Innanopart: Metrology for innovative nanoparticles 2539 - 2660 Relative, concentration, particle, populations, differential centrifugal sedimentation, DCS, spherical particles https://pubs.rsc.org/en/content/articlepdf/2018/ay/c8ay00491a EMPIR 2014: Industry The Royal Society of Chemistry 30 1759-9679 10.1039/c8ay00491a NA A.Shard K.Sparnacci A.Sikora L.Wright D.Bartczak H.Goenaga-Infante C.Minelli article MalhiARNDBOCL2018 959 Realistic Forest Stand Reconstruction from Terrestrial LiDAR for Radiative Transfer Modelling Remote Sensing 2018 6 13 10 6 16ENV03: MetEOC-3: Further metrology for earth observation and climate 933 tree reconstruction, radiative transfer, terrestrial LiDAR, forestry, 3D modelling, calibration and validation, end-to-end traceability https://www.mdpi.com/2072-4292/10/6/933 EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs10060933 NA K.Calders N.Origo A.Burt M.Disney J.Nightingale P.Raumonen M.Åkerblom Y.Malhi P.Lewis article elGawharyLWNSRBF2018 Sensitivity study of the instrumental temperature corrections on Brewer total ozone column measurements Atmospheric Measurement Techniques 2018 6 11 11 6 ENV59: atmoz: Traceability for atmospheric total column ozone 3323-3337 Brewer, instrumental temperature https://www.atmos-meas-tech.net/11/3323/2018/amt-11-3323-2018.html EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-11-3323-2018 NA O.El Gawhary S.F.León-Luis K.Wilson S.Nevas M.M.Sildoja A.Redondas A.Berjon I.Fountoulakis article EbertWBSLW2018 High-resolution Fourier transform measurements of air-induced broadening and shift coefficients in the 00 0 2–00 0 0 main isotopologue band of nitrous oxide Journal of Molecular Spectroscopy 2018 6 348 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 68-78 Nitrous oxide, Fourier transform infrared spectroscopy, Spectral line parameters, Air-broadening, Air-shift, Gas metrology https://www.sciencedirect.com/science/article/pii/S0022285217302059?via%3Dihub EMRP A169: Call 2010 Environment Elsevier BV 30 0022-2852 10.1016/j.jms.2017.07.002 NA V.Ebert O.Werhahn J.Brunzendorf A.Serdyukov G.Li V.Werwein article deClercqZGRPCAB2018 Toward a High-Stability Coherent Population Trapping Cs Vapor-Cell Atomic Clock Using Autobalanced Ramsey Spectroscopy Physical Review Applied 2018 6 9 6 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications Resonance raman transition, dual-frequency laser, long-term stability, rubidium, standard; compensation, performance, shifts, EMRP A169: Call 2012 Metrology for Industry (II) American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.9.064002 NA E.de Clercq T.Zanon-Willette S.Guérandel C.Rocher M.Petersen G.Coget M.Abdel Hafiz R.Boudot article WebsterCPB2018 1149 Patient-centred outcome metrology for healthcare decision-making Journal of Physics: Conference Series 2018 6 1044 15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases 012057 patient-centred outcome metrology EMPIR 2015: Health IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1044/1/012057 NA S.JCano L.RPendrill S.PBarbic W.PFisher article BarlowJ2018 823 A hybrid 2D/3D inspection concept with smart routing optimisation for high throughput, high dynamic range and traceable critical dimension metrology Measurement Science and Technology 2018 5 23 29 7 14IND09: MetHPM: Metrology for highly-parallel manufacturing 074004 dimensional metrology, surface topography, hybrid measurement, high dynamic range, process control, inline measurement, calibration http://iopscience.iop.org/article/10.1088/1361-6501/aababd/meta EMPIR 2014: Industry IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aababd NA C.W.Jones DO’Connor proceedings BymanLHBSS2018 870 Online measurement of optical fibre geometry during manufacturing Proc. SPIE 2018 5 17 10683 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 1068318 fibre, manufacturing, concentricity, scatterometry, modelling https://arxiv.org/abs/1806.07596 EMPIR 2014: Industry SPIE Strasbourg Fiber Lasers and Glass Photonics: Materials through Applications 22-04-2018 to 26-04-2018 30 10.1117/12.2314762 NA M.Shpak S.Burger M.Haapalainen A.Lassila V.Byman K.Saastamoinen article LiuHSFB2018 822 Fast and cost-effective in-process defect inspection for printed electronics based on coherent optical processing Optics Express 2018 5 16 26 11 14IND09: MetHPM: Metrology for highly-parallel manufacturing 13927 all-optical difference engine, defects, detection, printed electronics, roll-to-roll, Fourier optics and signal processing, Spatial filtering, Imaging systems, Optical inspection, Optical sensing and sensors https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-11-13927 EMPIR 2014: Industry The Optical Society 30 1094-4087 10.1364/OE.26.013927 NA X.Feng R.Su T.Happonen J.Liu RichardLeach article vanSlagerenKFKPFKMPKBMP2018 898 Room Temperature Uniaxial Magnetic Anisotropy Induced By Fe-Islands in the InSe Semiconductor Van Der Waals Crystal Advanced Science 2018 5 11 5 7 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 1800257 Magnetic Anisotropy, Nanotechnology, Nano-scale traceable magnetic field measurements EMPIR 2015: SI Broader Scope Wiley 30 2198-3844 10.1002/advs.201800257 NA F.Moro M.A.Bhuiyan Z.R.Kudrynskyi R.Puttock O.Kazakova O.Makarovsky M.W.Fay C.Parmenter Z.D.Kovalyuk A.J.Fielding M.Kern J.van Slageren A.Patanè article GenoveseDBTVLGAP2018 532 Investigating the Effects of the Interaction Intensity in a Weak Measurement Scientific Reports 2018 5 8 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies EMPIR 2014: Industry Springer Nature 30 2045-2322 10.1038/s41598-018-25156-7 NA F.Piacentini A.Avella M.Gramegna R.Lussana F.Villa A.Tosi G.Brida I.P.Degiovanni M.Genovese article HudlickaHBL2018 794 Prediction of SINR using BER and EVM for Massive MIMO Applications EuCAP 2018 5 14IND10: MET5G: Metrology for 5G communications SINR, EVM, BER, Interference Characterisation, Massive MIMO http://epubs.surrey.ac.uk/846356/ EMPIR 2014: Industry 30 NA http://arxiv.org/abs/1809.07811 M.Hudlicka D.A.Humphreys T.W.C.Brown T. H.Loh article BelenguerJKLA2018 796 Empty Substrate Integrated Waveguide-Fed MMW Aperture-Coupled Patch Antenna for 5G Applications EuCAP 2018 5 14IND10: MET5G: Metrology for 5G communications 5G, antennas, millimetre-wave, Empty Substrate Integrated Waveguide. http://www.eucap.org/ EMPIR 2014: Industry 30 NA https://arxiv.org/abs/1809.07817 A.Belenguer S.F.Jilani Z.U.Khan T. H.Loh A.Alomainy article BuismanSSN2018 798 An Inter-Laboratory Comparison of NVNA Measurements INMMIC 2018 5 14IND10: MET5G: Metrology for 5G communications Nonlinear microwave measurements, NVNA, measurement comparison http://arxiv.org/abs/1809.07301 EMPIR 2014: Industry 30 10.1109/INMMIC.2018.8430012 NA MSalter LStant KBuisman TNielsen article BuismanCHL2018 797 An Evaluation of Distortion and Interference Sources originating Within a Millimeter-wave MIMO Testbed for 5G Communications URSI 2018 5 14IND10: MET5G: Metrology for 5G communications MIMO, Testbed, Interference, Distortion http://www.ursi.org/proceedings/procAT18/papers/SA052.pdf EMPIR 2014: Industry 30 NA http://arxiv.org/abs/1809.07825 K.Buisman D.Cheadle D.Humphreys T. H.Loh article ErikssonHLCB2018 800 Millimeter-Wave Over-the-Air Signal-to-Interference-plus-Noise-Ratio Measurements Using aMIMO Testbed URSI 2018 5 14IND10: MET5G: Metrology for 5G communications Millimeter-waveSINRMIMO EMPIR 2014: Industry 30 10.23919/URSI-AT-RASC.2018.8471560 NA https://research.chalmers.se/en/publication/505084 KBuisman DCheadle T HLoh DHumphreys T Eriksson article ErikssonB2018 801 Designing and characterizing MATE, the Chalmers mm-wave MIMO testbed EuCAP 2018 5 14IND10: MET5G: Metrology for 5G communications MATE, MIMO ,MM-wave ,Testbed EMPIR 2014: Industry 30 NA https://research.chalmers.se/en/publication/508028 T Eriksson KBuisman article GenoveseDBTVLGAP20180 532 Investigating the Effects of the Interaction Intensity in a Weak Measurement Scientific Reports 2018 5 8 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies EMPIR 2017: Fundamental Springer Nature 30 2045-2322 10.1038/s41598-018-25156-7 NA F.Piacentini A.Avella M.Gramegna R.Lussana F.Villa A.Tosi G.Brida I.P.Degiovanni M.Genovese article KimBBWLAM2018 843 Improved Extraction Repeatability and Spectral Reproducibility for Liquid Extraction Surface Analysis–Mass Spectrometry Using Superhydrophobic–Superhydrophilic Patterning Analytical Chemistry 2018 4 27 90 10 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 6001-6005 liquid extraction surface analysis (LESA); Droplet Microarray (DMA); extraction solvent; mass spectrometry https://pubs.acs.org/doi/pdf/10.1021/acs.analchem.8b00973 EMPIR 2015: Health American Chemical Society (ACS) 30 0003-2700, 1520-6882 10.1021/acs.analchem.8b00973 NA J.Meurs M.R.Alexander P.A.Levkin S.Widmaier J.Bunch D.A.Barrett D.H.Kim miscellaneous BastuckKS 1019 Condition monitoring of hydraulic systems Data Set Zenodo Community 2018 4 26 17IND12: Met4FoF: Metrology for the Factory of the Future sensor network, condition monitoring, hydraulic EMPIR 2017: Industry Zenodo 30 10.5281/zenodo.1323610 NA M.Bastuck S.Klein T.Schneider article DickersonBRR2018 826 Dealing with front-end white noise on differentiated measurements such as frequency and ROCOF in power systems IEEE Transcations on Instrumentation and Measurement 2018 4 25 67 11 15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids 2579-2591 Frequency measurement, noise measurement, power measurement, phase measurement, white noise, measurement uncertainty, phasor measurement units https://strathprints.strath.ac.uk/63576/ EMPIR 2015: Pre-Co-Normative IEEE 30 1557-9662 10.1109/TIM.2018.2822438 NA A.J.Roscoe S.M.Blair W.Dickerson G.Rietveld article AarhaugHAGCMB2018 502 Probability of occurrence of ISO 14687-2 contaminants in hydrogen: Principles and examples from steam methane reforming and electrolysis (water and chlor-alkali) production processes model International Journal of Hydrogen Energy 2018 4 15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications ISO14687-2, Hydrogen quality, Fuel cell electrical vehicle, Probability of occurrence, Hydrogen production process, ISO 19880-8 https://www.sciencedirect.com/science/article/pii/S0360319918308450 EMPIR 2015: Pre-Co-Normative Elsevier BV 30 0360-3199 10.1016/j.ijhydene.2018.03.084 NA TBacquart AMurugan MCarré BGozlan FAuprêtre FHaloua T.A.Aarhaug article MarquesBMHIPSGS2018_2 520 Theoretical and experimental determination of K- and L-shell x-ray relaxation parameters in Ni Physical Review A 2018 4 97 4 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 042501 Electronic Structure, X-ray Fluorescence, Fundamental Parameters, Fluorescence Yields, Condensed matter https://journals.aps.org/pra/abstract/10.1103/PhysRevA.97.042501 EMPIR 2014: Industry American Physical Society (APS)
1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States
30 2469-9926, 2469-9934 10.1103/PhysRevA.97.042501 NA M.Guerra J. M.Sampaio F.Parente P.Indelicato P.Honicke M.Muller B.Beckhoff J. P.Marques J. P.Santos
article BoothTDFNMD2018_2 Advanced fault location in MTDC networks utilising optically-multiplexed current measurements and machine learning approach International Journal of Electrical Power & Energy Systems 2018 4 97 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids 319-333 Fault location, Multi-terminal direct current, Travelling waves, Optical sensors, Machine learning, Pattern recognition EMRP A169: Call 2013 Energy II Elsevier BV 30 0142-0615 10.1016/j.ijepes.2017.10.040 NA C.Booth D.Tzelepis A.Dysko G.Fusiek P.Niewczas S.Mirsaeidi X.Dong article VenceljPDCBGP2018 Evaluation of the radon interference on the performance of the portable monitoring air pump for radioactive aerosols (MARE) Applied Radiation and Isotopes 2018 4 134 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 439-445 Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements, Radon and thoron background, Radon progeny, Walk-in radon chamber EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.07.039 NA M.Vencelj D.Ponikvar P.De Felice F.Cardellini D.Brodnik D.Glavič-Cindro T.Petrovič article deClercqGMB2018 Pulsed coherent population trapping spectroscopy in microfabricated Cs–Ne vapor cells Journal of the Optical Society of America B 2018 4 35 5 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 1004 Atomic-frequency references, clock, resonances, frequency stability EMRP A169: Call 2012 Metrology for Industry (II) The Optical Society 30 0740-3224, 1520-8540 10.1364/JOSAB.35.001004 NA E.de Clercq C.Gorecki V.Maurice R.Boudot article BuismanN2018 789 Measurement Technique to Emulate Signal Coupling Between Power Amplifiers IEEE 2018 4 14IND10: MET5G: Metrology for 5G communications Active load–pull, antenna array, coupling effect, distortion, emulation, measurement technique, power amplifier (PA) https://research.chalmers.se/publication/502172/file/502172_Fulltext.pdf EMPIR 2014: Industry IEEE 30 10.1109/TMTT.2017.2786274 NA D.Nopchinda K.Buisman article PlimmerOHB2018 807 Development and characterisation of a low pressure transfer standard in the range 1 Pa to 10 kPa ACTA IMEKO 2018 4 7 1 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range 80 pressure, vacuum, transfer standard, resonant silicon gauge, mcapacitance diaphragm gauge EMPIR 2014: Industry IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v7i1.496 NA F.Boineau S.Huret P.Otal M.Plimmer article WellerJEB2018 936 Online immunocapture ICP-MS for the determination of the metalloprotein ceruloplasmin in human serum BMC Research Notes 2018 4 11 1 15HLT02: ReMiND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease 213-217 Ceruloplasmin, Immunocapture, ICP‑MS, ELISA, Human serum https://bmcresnotes.biomedcentral.com/articles/10.1186/s13104-018-3324-7 EMPIR 2015: Health Springer Nature 30 1756-0500 10.1186/s13104-018-3324-7 NA B.Bernevic A.H.El-Khatib N.Jakubowski M.G.Weller proceedings BlissBKG2018 1096 Accessing the Performance of Individual Cells of Fully Encapsulated PV Modules Using a Commercial Digital Light Processing Projector PVSAT proceedings 2018 4 16ENG02: PV-Enerate: Advanced PV energy rating Photovoltaic https://hdl.handle.net/2134/34784 EMPIR 2016: Energy London PVSAT-14 18-04-2018 to 20-04-2018 30 0904963845 NA MartinBliss Thomas Richard Betts George Koutsourakis RalphGottschalg article ChudnovskyPGWKGWHZBNZZZZ2018 582 Direct writing of room temperature and zero field skyrmion lattices by a scanning local magnetic field Applied Physics Letters 2018 3 26 112 13 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 132405 magnetic skyrmion, magnetic force microscopy, stray field, perpendicular magnetic anisotropy http://hdl.handle.net/10754/627497 EMPIR 2015: SI Broader Scope AIP Publishing 30 0003-6951, 1077-3118 10.1063/1.5021172 NA X,Zhang S.Zhang J.Zhang Q.Zhang C.Barton V.Neu Y.Zhao Z.Hou Y.Wen C.Gong O.Kazakova W.Wang Y.Peng D.A.Garanin E.M.Chudnovsky article TabandehBSRCM2018 Development of a low frost-point generator operating at sub-atmospheric pressure Measurement Science and Technology 2018 3 16 29 5 ENV58: MeteoMet2: Metrology for essential climate variables 054002 hygrometry, humidity generator, frost point, upper-air sensors EMRP A169: Call 2013 Environment II IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aaa785 NA S.Tabandeh G.Beltramino D.Smorgon L.Rosso R.Cuccaro G.Mana article CarrollMB2018 Novel Calibration Technique for a Coulometric Evolved Vapor Analyzer for Measuring Water Content of Materials International Journal of Thermophysics 2018 3 10 39 4 SIB64: METefnet: Metrology for moisture in materials 50 Calibration, Evolved vapor analyze,r Measurement traceability, Water content https://link.springer.com/article/10.1007%2Fs10765-018-2368-1 EMRP A169: Call 2012 SI Broader scope (II) Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-018-2368-1 NA P. A.Carroll P.Miao S. A.Bell article BarlowK2018 829 Cross-correlation limit of a SQUID-based noise thermometer of the pMFFT type Journal of Physics: Conference Series 2018 3 969 15SIB02: InK 2: Implementing the new kelvin 2 012083 primary magnetic field fluctuation thermometer, SQUID-based, noise thermometer, low temperature EMPIR 2015: SI Broader Scope IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/969/1/012083 NA A.Kirste JEngert article ManaBd2018 Air temperature sensors: dependence of radiative errors on sensor diameter in precision metrology and meteorology Metrologia 2018 2 28 55 2 ENV58: MeteoMet2: Metrology for essential climate variables 229-244 air temperature, meteorology, errors, sensors, metrology EMRP A169: Call 2013 Environment II IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaaa52 NA G.Mana S.Bell M.de Podesta article Borkowski2018 473 Optical Lattice Clocks with Weakly Bound Molecules Physical Review Letters 2018 2 22 120 8 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 083202 optical atomic clocks, ultracold molecules https://arxiv.org/abs/1802.08291 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.120.083202 NA M.Borkowski article EhlersSPPODBS2018 808 Calibration methods for negative gauge pressure down to  −100 kPa Measurement Science and Technology 2018 2 17 29 3 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range 035007 negative gauge pressure, piston pressure gauge, differential pressure, pressure, calibration, barometer, manometer calibration EMPIR 2014: Industry IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa92ea NA D.Bentouati Y.Durgut P.Otal M.Plimmer D.Pražák W.Sabuga S.Ehlers E.Sınır article RaumonenLCBBDW2018 Weighing trees with lasers: advances, challenges and opportunities Interface Focus 2018 2 16 8 2 ENV53: MetEOC2: Metrology for earth observation and climate 20170048 above-ground biomass, terrestrial laser, scanning, lidar, canopy, structure, buttress EMRP A169: Call 2013 Environment II The Royal Society 30 2042-8898, 2042-8901 10.1098/rsfs.2017.0048 NA P.Raumonen S. L.Lewis K.Calders A.Burt M.Boni Vicari M. I.Disney P.Wilkes article CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018 812 Geodesy and metrology with a transportable optical clock Nature Physics 2018 2 12 14 5 SIB55: ITOC: International timescales with optical clocks 437-441 optical fiber, optical frequency transfer EMRP A169: Call 2011 SI Broader Scope Springer Nature 30 1745-2473, 1745-2481 10.1038/s41567-017-0042-3 NA G.A.Costanzo M.Zucco P.Barbieri A.Tampellini F.Bregolin B.Rauf M.Pizzocaro P.Thoumany H.S.Margolis M.Zampaolo A.Rolland F.N.Baynes L.Timmen H.Denker C.Voigt C.Lisdat S.Häfner U.Sterr S.Vogt S.Koller J.Grotti C.Clivati F.Levi D.Calonico article HenaultCLDRBFMBH2018 374 A metrological comparison of Raman-distributed temperature sensors Measurement 2018 2 116 16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities 18-24 Distributed temperature sensors; Raman; Metrology; Structural health monitoring; Optical fibres http://www.sciencedirect.com/science/article/pii/S0263224117306656 EMPIR 2016: Environment Elsevier BV 30 0263-2241 10.1016/j.measurement.2017.10.041 NA G.Failleau O.Beaumont R.Razouk S.Delepine-Lesoille M.Landolt B.Courthial J.M.Hénault F.Martinot J.Bertrand B.Hay article StevenSRPGGGHPTB2018 A calibration procedure for a traceable contamination analysis on medical devices by combined X-ray spectrometry and ambient spectroscopic techniques Journal of Pharmaceutical and Biomedical Analysis 2018 2 150 1 IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry 308-317 XRF; Reference-free; N,N’-ethylene-bis (stearamide); Vibrational spectroscopy; Medical device https://www.sciencedirect.com/science/article/abs/pii/S0731708517310609 EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0731-7085 10.1016/j.jpba.2017.12.007 NA R.Steven C.Seim A.Rossi C.Portesi P.Gunning F.Green A.M.Giovannozzi A.Hornemann B.Pollakowski-Herrmann B.Tyler B.Beckhoff article OhlckersAMKB2018 455 Reliability study of fiber-coupled photodiode module for operation at 4 K Microelectronics Reliability 2018 2 81 February 2 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 362-367 Optoelectronic packaging, Cryogenics, Voltage standards EMPIR 2015: SI Broader Scope Elsevier BV 30 0026-2714 10.1016/j.microrel.2017.10.034 NA E.Bardalen B.Karlsen H.Malmbekk M.N.Akram P.Ohlckers article BarlowKGAWIOS2018 830 Development of large-area high-temperature fixed-point blackbodies for photometry and radiometry Metrologia 2018 2 55 2 15SIB02: InK 2: Implementing the new kelvin 2 S43-S51 large-area high-temperature fixed point, blackbody, rhenium–carbon,tungsten carbide–carbon, photometry EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 NA https://link.springer.com/article/10.1007%2Fs10765-017-2273-z C.Barlow B.Khlevnoy I.Grigoryeva K.Anhalt M. Waehmer E. Ivashin D. Otryaskin M.Solodilov thesis Bilicki2018 1083 Strontium optical lattice clocks : clock comparisons for timescales and fundamental physics applications 2018 1 24 15SIB03: OC18: Optical clocks with 1E-18 uncertainty Optical lattice clocks, spectroscopy, cold atoms, clock comparisons, timescales, amplified spontaneous emission EMPIR 2015: SI Broader Scope Université Pierre et Marie Curie - Paris VI
Paris
Université Pierre et Marie Curie - Paris VI 30 NA https://tel.archives-ouvertes.fr/tel-01691598 S.Bilicki
article BarlowLR2018 820 Thermography based online characterization of conductive thin films in large-scale electronics fabrication Optics Express 2018 1 11 26 2 14IND09: MetHPM: Metrology for highly-parallel manufacturing 1219 Flexible electronics, thin film based technology, quality assessment, thin film electronics, synchronized thermography, roll-to-roll https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-2-1219 EMPIR 2014: Industry The Optical Society 30 1094-4087 10.1364/OE.26.001219 NA K.Remes K.Remes K.Leppänen article VermesseSLDBROGDDPDSGCP2018 Feasibility of using a dose-area product ratio as beam quality specifier for photon beams with small field sizes Physica Medica 2018 1 45 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 106-116 Dose-area product, Beam quality, DAP ratio, Small photon beams EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2017.12.012 NA D.Vermesse L.Sommier M.Le Roy J.Daures J.M.Bordy B.Rapp A.Ostrowsky J.Gouriou S.Dufreneix F.Delaunay A.Petrucci V.De Coste L.Silvi A.S.Guerra C.Caporali M.Pimpinella article ScholzePEKHSB2018 478 Element sensitive reconstruction of nanostructured surfaces with finite elements and grazing incidence soft X-ray fluorescence Nanoscale 2018 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies GIXRF, nanostructure characterization, FEM https://arxiv.org/abs/1801.04157 EMPIR 2014: Industry Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/C8NR00328A NA V.Soltwisch P.Honicke Y.Kayser J.Eilbracht J.Probst F.Scholze B.Beckhoff article BeckhoffMWJCHU2018 534 Accurate experimental determination of Gallium K- and L3-shell XRF fundamental parameters Journal of Analytical Atomic Spectrometry 2018 16ENG03: HyMet: Hybrid metrology for thin films in energy applications X-ray fluorescence, atomic fundamental parameters https://arxiv.org/abs/1805.02951 EMPIR 2016: Energy Royal Society of Chemistry (RSC)
Thomas Graham House Science Park, Milton Rd Science Park, Milton Rd Cambridge CB4 0WF United Kingdom
30 0267-9477, 1364-5544 10.1039/C8JA00046H NA R.Unterumsberger P.Honicke J.L.Colaux C.Jeynes M.Wansleben M.Muller B.Beckhoff
proceedings GowerBMHLKB2018 Quantitative comparison of different non-destructive techniques for the detection of artificial defects in GFRP Proceedings of 12th European Conference on NDT 2018 ENG57: VITCEA: Validated inspection techniques for composites in energy applications composites, non-destructive testing, defects http://www.ndt.net/?id=22834 EMRP A169: Call 2013 Energy II Gothenburg 12th European Conference on Non Destructive Testing 11-06-2018 to 15-06-2018 30 NA https://www.ndt.net/article/ecndt2018/papers/ecndt-0297-2018.pdf M.Gower D.Brackrock C.Maierhofer T.Heckel M.Lodeiro R.Krankenhagen G.Baker proceedings BosseKJG2018 879 Measurement uncertainty estimation of a novel torque transducer for wind turbine test benches Conference Proceedings 22. IMEKO World Congress 2018 2018 14IND14: MNm Torque: Torque measurement in the MN•m range torque transducer, force lever, wind turbine, test benches, multiaxial loads, rotational speed EMPIR 2014: Industry Belfast, Northern Ireland 22. IMEKO World Congress 03-09-2018 to 06-09-2018 30 10.1088/1742-6596/1065/4/042050 NA J.Gnauert G.Jacobs S.Kock D.Bosse proceedings StrangfeldBJK2018 880 Simulation method for the characterisation of the torque transducers in MN·m range Conference Proceedings 22. IMEKO World Congress 2018 2018 14IND14: MNm Torque: Torque measurement in the MN•m range wind turbine test benches, torque measurement, multi-axial operation, rotational speed EMPIR 2014: Industry Belfast, Northern Ireland 22. IMEKO World Congress 03-09-2018 to 06-09-2018 30 10.1088/1742-6596/1065/4/042014 NA S.Kock G.Jacobs D.Bosse F.Strangfeld proceedings GottschalgBBK2018 965 Utilising Digital Light Processing and Compressed Sensing for Photocurrent Mapping of Encapsulated Photovoltaic Modules Proceedings of EUPVSEC 2018 16ENG02: PV-Enerate: Advanced PV energy rating Non-Destructive Testing, PV Modules, Compressed Sensing, Current Mapping https://www.eupvsec-proceedings.com/proceedings?paper=44865 EMPIR 2016: Energy Brussels 35th European Photovoltaic Solar Energy Conference and Exhibition 24-09-2018 to 27-09-2018 30 3-936338-50-7 10.4229/35thEUPVSEC20182018-5BO.11.6 NA R.Gottschalg T.Betts M. Bliss G. Koutsourakis article Bossew2018 985 Radon priority areas - definition, estimation and uncertainty Nuclear Technology and Radiation Protection 2018 33 3 16ENV10: MetroRADON: Metrology for radon monitoring 286-292 Radon priority area, classification, EURATOM Basic Safety Standards EMPIR 2016: Environment National Library of Serbia 30 1451-3994, 1452-8185 10.2298/NTRP180515011B NA P.Bossew article OhlckersAMKB2018_2 1183 Evaluation of InGaAs/InP photodiode for high-speed operation at 4 K International Journal of Metrology and Quality Engineering 2018 9 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 13 optoelectronics / cryogenics / voltage standards EMPIR 2015: SI Broader Scope EDP Sciences 30 2107-6847 10.1051/ijmqe/2018015 NA E.Bardalen B.Karlsen H.Malmbekk M.N.Akram P.Ohlckers thesis Bardalen2018 1188 Reliable Packaging and Development of Photodiode Module for Operation at 4 K 2018 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages Packaging, Photodiodes, Low Temperatures EMPIR 2015: SI Broader Scope Eivind Bardalen University of South-Eastern Norway 30 ISBN: 978-82-7860-317-8 (onlin ISSN: 2535-5252(online) NA http://hdl.handle.net/11250/2500465 E.Bardalen article BurnsRMNBFLADYHR2017 499 Antimicrobial peptide capsids of de novo design Nature Communications 2017 12 22 8 1 15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance 2263 Antimicrobials, Protein design, Self-assembly, Biometrology EMPIR 2015: Health Springer Nature 30 2041-1723 10.1038/s41467-017-02475-3 NA E.De Santis H.Alkassem B.Lamarre N.Faruqui A.Bella J.E.Noble N.Micale S.Ray J.R.Burns A.R.Yon B.W.Hoogenboom M.G.Ryadnov article MeschkeFMSPB2017 506 On-and-off chip cooling of a Coulomb blockade thermometer down to 2.8 mK Applied Physics Letters 2017 12 18 111 25 15SIB02: InK 2: Implementing the new kelvin 2 253105 nanoelectronic devices, thermometry https://aip.scitation.org/doi/10.1063/1.5002565 EMPIR 2015: SI Broader Scope AIP Publishing 30 0003-6951, 1077-3118 NA https://arxiv.org/abs/1708.09491 M.Meschke A.V.Feshchenko D.Maradan C.P.Scheller M.Palma C.Barlow article NeumaierDCBDS2017 Recommendations to harmonize European early warning dosimetry network systems Journal of Instrumentation 2017 12 18 12 12 ENV57: MetroERM: Metrology for radiological early warning networks in Europe P12024-P12024 data acquisition concepts, dosimetry concepts and apparatus, overall mechanics, design (support structures and materials, vibration analysis etc), radiation monitoring EMRP A169: Call 2013 Environment II IOP Publishing 30 1748-0221 10.1088/1748-0221/12/12/P12024 NA S.Neumaier R.Dabrowski M.D.Cort M.Bleher H.Dombrowski U.Stöhlker article RuizCMPB2017 819 Characterization of the reference wave in a compact digital holographic camera Applied Optics 2017 12 18 57 1 14IND09: MetHPM: Metrology for highly-parallel manufacturing A235-A241 holographic, reference wave, optical holography, https://www.osapublishing.org/ao/abstract.cfm?uri=ao-57-1-A235 EMPIR 2014: Industry The Optical Society 30 1559-128X, 2155-3165 10.1364/AO.57.00A235 NA I.S.Park R.J.C.Middleton C.R.Coggrave P.D.Ruiz J MCoupland article BorkowskiKMuC2017 594 Optical Feshbach resonances and ground-state-molecule production in the RbHg system Physical Review A 2017 12 15 96 6 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 063411 Optical Feshbach resonances, ultra-cold molecules https://arxiv.org/abs/1708.05403 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.96.063411 NA M.Borkowski R.Muñoz Rodriguez M.B.Kosicki R.Ciuryło P.S.Żuchowski article SterrRZSOBHLYMR2017 720 Ultrastable Silicon Cavity in a Continuously Operating Closed-Cycle Cryostat at 4 K Physical Review Letters 2017 12 15 119 24 15SIB03: OC18: Optical clocks with 1E-18 uncertainty ultrastable laser, silicon cavity, 4K cryocooler, time and frequency standards https://arxiv.org/abs/1708.05161 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.119.243601 NA W.Zhang J. M.Robinson L.Sonderhouse E.Oelker C.Benko J. L.Hall T.Legero D. G.Matei F.Riehle U.Sterr J.Ye article PivacPSDVFWKBHFDDB2017 544 Development and Synchrotron-Based Characterization of Al and Cr Nanostructures as Potential Calibration Samples for 3D Analytical Techniques physica status solidi (a) 2017 12 215 6 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 1700866 SIMS, APT, GISAXS, 3D nanostructures, di-block copolymers EMPIR 2014: Industry Wiley 30 1862-6300 10.1002/pssa.201700866 NA M.Dialameh F.Ferrarese Lupi P.Honicke Y.Kayser B.Beckhoff T.Weimann C.Fleischmann W.Vandervorst P.Dubček B.Pivac M.Perego G.Seguini N.De Leo L.Boarino article NielsenAKKIIHGFCCBHOOSS2017 New Primary Standards for Establishing SI Traceability for Moisture Measurements in Solid Materials International Journal of Thermophysics 2017 12 39 1 SIB64: METefnet: Metrology for moisture in materials Karl Fischer, Loss-on-drying, Moisture, Oven drying, Traceability EMRP A169: Call 2012 SI Broader scope (II) Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-017-2340-5 NA J.Nielsen R.Aro M.Krasheninina T.Keawprasert N.Ismail G.V.Ionescu D.Hudoklin E.Georgin V.Fernicola G.Cortellessa B.I.Choi S.Bell M.Heinonen S.Oguz Aytekin P.Österberg J.Skabar R.Strnad article TakasuBBCJYKTT2017 775 Beyond-Born-Oppenheimer effects in sub-kHz-precision photoassociation spectroscopy of ytterbium atoms Physical Review A 2017 12 96 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 063405 photoassociation, spectroscopy, ytterbium, EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.96.063405 NA M.Borkowski A.A.Buchachenko R.Ciuryło P.S.Julienne H.Yamada Y.Kikuchi K.Takahashi Y.Takahashi Y.Takasu article SassiLGWTMPLBPDCESK2017 Preparation and analysis of zero gases for the measurement of trace VOCs in air monitoring Atmospheric Measurement Techniques Discussions 2017 11 28 ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change 1-17 zero gas, VOC measurements https://www.atmos-meas-tech-discuss.net/amt-2017-412/ EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8610 10.5194/amt-2017-412 NA G.Sassi M.Lecuna Y.Ghorafi R.Wortmann E.Tensing K.Michl C.Plass-Duelmer J.Li A.Baldan S.Persijn A.Demichelis A.Claude J.Englert M.P.Sassi D.Kubistin article FountoulakisFGKKKHFDBBLRF2017 Temperature dependence of the Brewer global UV measurements Atmospheric Measurement Techniques 2017 11 22 10 11 ENV59: atmoz: Traceability for atmospheric total column ozone 4491-4505 Brewer spectrophotometer, temperature characterization, UV radiation EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-10-4491-2017 NA I.Fountoulakis K.Fragkos K.Garane T.Koskela J.M.Karhu T.Karppinen A.Heikkila U.Feister L.Doppler A.F.Bais A.Berjon K.Lakkala A.Redondas I.Fountoulakis article BaeHCGHAK2017 414 Upper frequency limit depending on potential shape in a QD-based single electron pump Journal of Applied Physics 2017 11 21 122 19 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 194502 single electron pump, quantum dot, single electron tunneling http://aip.scitation.org/doi/abs/10.1063/1.5000319 EMPIR 2015: SI Broader Scope AIP Publishing 30 0021-8979, 1089-7550 10.1063/1.5000319 NA Y.H.Ahn Y.P.Hong C.Hong Y.S.Ghee Y.Chung M.H.Bae N.Kim article EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017 602 First patients treated with a 1.5 T MRI-Linac: clinical proof of concept of a high-precision, high-field MRI guided radiotherapy treatment Physics in Medicine & Biology 2017 11 14 62 23 15HLT08: MRgRT: Metrology for MR guided radiotherapy L41-L50 MRgRT, Radiotherapy, MRI EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aa9517 NA B WRaaymakers I MJürgenliemk-Schulz G HBol MGlitzner A N T JKotte Bvan Asselen J C Jde Boer J JBluemink S LHackett M AMoerland S JWoodings J W HWolthaus H Mvan Zijp M E PPhilippens RTijssen J G MKok E Nde Groot-van Breugel IKiekebosch L T CMeijers C NNomden G GSikkes P A HDoornaert W S CEppinga NKasperts L G WKerkmeijer J H ATersteeg K JBrown BPais PWoodhead J J WLagendijk article SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017 The MeteoMet2 project – Highlights and results Measurement Science and Technology 2017 11 13 ENV58: MeteoMet2: Metrology for essential climate variables Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta EMRP A169: Call 2013 Environment II IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa99fc NA L.Šindelárová D.Sestan J.Salminen H.Sairanen L.Rosso J.del Rio M.K.Rasmussen S.Oguz Aytekin M.de Podesta P.Pavlasek M.Nogueras Cervera J.Nielsen C.Musacchio P.Miao L.G.Lanza A.Kowal M.Kalemci D.Hudoklin R.Högström S.Hernandez de la Villa M.Heinonen D.Groselj A.Gonzalez Calvo E.Georgin T.Gardiner C.García Izquierdo A.Garcia-Benadí VFernicola V.Ebert J.Drnovsek M.Dobre R.Cuccaro G.Coppa M.Colli N.Chiodo A.Castrillo D.del Campo M.Brunet J.Bojkovski G.Beltramino S.A.Bell G.Beges F.Sanna A.Merlone D.Smorgon F.Sparasci R.Strnad M.Voldán R.J.Underwood G.Mana article vanderVeenGUTBG2017 Validation and sensitivity evaluation of the ID-GC-TOF-MS method for determination of PAHs in biogas Journal of Chemical Metrology 2017 11 11 2 ENG54: Biogas: Metrology for biogas 78-85 PAH; biogas; biomethane; thermal desorption; isotope dilution; GC-TOF-MS EnG http://www.acgpubs.org/JCM/2017/Volume%2011/Issue%201/11-JCM_2017-11-01.pdf EMRP A169: Call 2013 Energy II ACG Publications 30 1307-6183 10.25135/jcm.11.17.11.01 NA A.van der Veen A.C.Goren I.Un T.Tarhan G.Bilsel T.Gokcen article UlmKECCSHFB2017 450 A pilot study on fingerprinting Leishmania species from the Old World using Fourier transform infrared spectroscopy Analytical & Bioanalytical Chemistry 2017 10 28 409 29 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 6907-6923 Fourier transforminfrared spectroscopy, Hierarchical cluster analysis (HCA), Principal componentsanalysis (PCA), Leishmania, DNA, Multivariate differentiation EMPIR 2015: Health Springer 30 1618-2642 10.1007/s00216-017-0655-5 NA A.Hornemann D.Sinning S.Cortes L.Campino P.Emmer K.Kuhls G.Ulm M.Frohme B.Beckhoff article QuinceyVTSPMMHWBWWSN2017 956 Mobility particle size spectrometers: Calibration procedures and measurement uncertainties Aerosol Science and Technology 2017 10 26 52 2 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 146-164 aerosol metrology , mobility particle size spectrometers , calibration, measurement uncertainties EMPIR 2016: Environment Informa UK Limited 30 0278-6826, 1521-7388 10.1080/02786826.2017.1387229 NA A.Wiedensohler A.Wiesner K.Weinhold W.Birmili M.Hermann M.Merkel T.Müller S.Pfeifer A.Schmidt T.Tuch F.Velarde P.Quincey S.Seeger A.Nowak article TunnermannESHLWSSPB2017 388 Measuring thermal load in fiber amplifiers in the presence of transversal mode instabilities Optics Letters 2017 10 18 42 21 14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications 4311-4314 Fiber optics amplifiers and oscillators, Thermal effects, Fiber properties, High power lasers https://www.osapublishing.org/ol/abstract.cfm?uri=ol-42-21-4311 EMPIR 2014: Industry The Optical Society of America 30 0146-9592, 1539-4794 10.1364/OL.42.004311 NA F.Beier M.Plötner B.Sattler F.Stutzki T.Walbaum A.Liem N.Haarlammert T.Schreiber R.Eberhardt A.Tünnermann article LestremauLKvBMBCBRYAB2017 Suitability of vessels and adsorbents for the short-term storage of biogas/biomethane for the determination of impurities – Siloxanes, sulfur compounds, halogenated hydrocarbons, BTEX Biomass and Bioenergy 2017 10 105 ENG54: Biogas: Metrology for biogas 127-135 BiogasCompositionImpuritiesVesselsSampling EnG http://www.sciencedirect.com/science/article/pii/S0961953417302118 EMRP A169: Call 2013 Energy II Elsevier BV 30 10.1016/j.biombioe.2017.06.025 NA F.Lestremau J.Li I.Krom A.M.H.van der Veen B.Brewer A.Murugan S.Bartlett L.Culleton O.Büker L.Rosell H.Yaghooby K.Arrhenius J.Beranek inbook GillBRBBNKJGBM2017 379 Absolute frequency measurement of the optical clock transition in 171Yb+ with an uncertainty of 4E-16 using a frequency link to international atomic time 2017 10 65 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 221-227 Frequency metrology, optical frequency standards, international atomic time http://empir.npl.co.uk/oc18/wp-content/uploads/sites/13/2016/04/Yb_J_Mod_Op.pdf EMPIR 2015: SI Broader Scope Informa UK Limited Journal of Modern Optics 30 0950-0340, 1362-3044 NA https://arxiv.org/abs/1707.00646v2 P.Gill K.Bongs A.Rolland P.E.G.Baird F.Baynes P.B.R.Nisbet-Jones S.A.King J.M.Jones R.M.Godun C.F.A.Baynham H.S.Margolis proceedings GrandidierEBXFMDAHD2017 421 Nano-probing station incorporating MEMS probes for 1D device RF on-wafer characterization 2017 47th European Microwave Conference (EuMC) 2017 10 14IND02: PlanarCal: Microwave measurements for planar circuits and components MEMS GSG Probe, nano-prober, Nanowire, on-wafer, microwave https://hal.archives-ouvertes.fr/hal-01726555 EMPIR 2014: Industry IEEE Nuremberg EuMC 08-10-2017 to 12-10-2017 30 10.23919/EuMC.2017.8230973 NA K.Daffé J.Marzouk A. ElFellahi T.Xu C.Boyaval S.Eliet B.Grandidier S.Arscott G.Dambrine K.Haddadi article KabrtSBMRW2017 Production and characterization of a traceable NORM material and its use in proficiency testing of gamma-ray spectrometry laboratories Applied Radiation and Isotopes 2017 9 18 134 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 45-50 Environmental radioactivity; Gamma-ray spectrometry; NORM; Reference material; Intercomparison; Interlaboratory comparison; Proficiency testing; Quartz sand; Drinking water treatment; Natural radionuclides https://www.sciencedirect.com/science/article/pii/S0969804317305158 EMRP A169: Call 2012 Metrology for Industry (II) Elsevier 30 10.1016/j.apradiso.2017.09.025 NA F.Kabrt M.Stietka A.Baumgartner F.J.Maringer J.Riedl H.Wiedner article BosmaOP2017 Effect of Pressure on Deep-Ocean Thermometers International Journal of Thermophysics 2017 9 13 38 11 ENV58: MeteoMet2: Metrology for essential climate variables Deep-ocean thermometers · Pressure effect · Thermistors https://link.springer.com/article/10.1007/s10765-017-2297-4 EMRP A169: Call 2013 Environment II Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-017-2297-4 NA R.Bosma S.Ober A.Peruzzi article SeguiniMLZIFDPRDB2017 480 Influence of block copolymer feature size on reactive ion etching pattern transfer into silicon Nanotechnology 2017 9 12 28 40 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 404001 block copolymers, reactive ion etching, self-assembly, cryogenic RIE, holey silicon http://iopscience.iop.org/article/10.1088/1361-6528/aa8144 EMPIR 2014: Industry IOP Publishing 30 0957-4484, 1361-6528 10.1088/1361-6528/aa8144 NA M.Dialameh F.Ferrarese Lupi D.Imbraguglio F.Zanenga A.Lamperti D.Martella G.Seguini M.Perego A.M.Rossi N.De Leo L.Boarino article MoldersBHMRR2017 Reproducibly emitting reference material on thermoplastic polyurethane basis for quality assurance/quality control of emission test chamber measurements Building and Environment 2017 9 122 ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change 230-236 Reference material, Emissions testing, Volatile Organic Compounds, Polymeric material, CO2 assisted impregnation https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/40646 EMRP A169: Call 2013 Environment II Elsevier BV
230 Park Avenue Suite 800 Shantae McGee 360 Park Avenue South New York NY 10169-0935 United States
30 0360-1323 10.1016/j.buildenv.2017.06.005 NA NilsMölders DorisBrödner WolfgangHorn BirteMull MatthiasRichter ManfredRenner
article BrodnerHSSMR2017 Reproducibly emitting reference materials for volatile and semi-volatile organic compounds—using finite element modeling for emission predictions Air Quality, Atmosphere & Health 2017 9 ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change Emitting reference material, Emission test chamber, Micro-chamber, FEM model https://link.springer.com/article/10.1007/s11869-017-0508-6 EMRP A169: Call 2013 Environment II Springer Nature 30 1873-9318, 1873-9326 10.1007/s11869-017-0508-6 NA DorisBrödner WolfgangHorn CarolineSchultealbert TilmanSauerwald BirteMull MatthiasRichter article FailleauHHPSRBZARGVSSKSPLG2017 Metrology for decommissioning nuclear facilities: Partial outcomes of joint research project within the European Metrology Research Program Applied Radiation and Isotopes 2017 9 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities Decommissioning, Sample preparation, Metrology EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.08.032 NA G.Failleau B.Hay P.Holm K.Peräjärvi J.Sand B.Rogiers S.Boden D.Zapata-García D.Arnold B.Russell M.Garcia Miranda R.Van Ammel J.Solc J.Smoldasova P.Kovář J.Šuráň S.Plumeri Y.Laurent Beck T.Grisa article BogucarskaPdJASSSKSTv2017 New high-throughput measurement systems for radioactive wastes segregation and free release Applied Radiation and Isotopes 2017 9 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities nuclear decommissioning, radioactive waste, free release, clearance level EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.09.043 NA T.Bogucarska B.Pedersen P.De Felice S.Jerome D.Arnold L.Skala J.Solc J.Smoldasova P.Kovář J.Šuráň F.Tzika R.Van Ammel article ChoiGIBFBGRPH2017 Effect of Handling, Packing and Transportation on the Moisture of Timber Wood International Journal of Thermophysics 2017 8 29 38 10 SIB64: METefnet: Metrology for moisture in materials Effect of ambient humidity, Moisture content, Timber wood,Transportation, Wood handling EMRP A169: Call 2012 SI Broader scope (II) Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-017-2292-9 NA B.I.Choi D.A.E.Gelil N.Ismail G.Beltramino V.Fernicola M.W.Ben Ayoub E.Georgin M.Rudolfová Z.Palkova M.Heinonen proceedings ZhouLLHBEK2017 463 Measurement of the Internal Inductance of Impulse Voltage Generators and the Limits of LI Front Times. e-cigre.org 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry lightning impulse, time parameters, front time, impulse generator EMPIR 2014: Industry Buenos Aires, Argentina International conference on high-voltage engineering 2017 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_569-measurement-of-the-internal-inductance-of-impulse-voltage-generators-and-the-limits-of-li-front-times L.Zhou Y.Li W.Larzelere J.Hällström A.Bergman A.P.Elg J.Klüss proceedings HallstromBNEMP2017 460 Characterization of a fast step generator e-cigre.org 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry Step response, impulse measurment, lightning impulse EMPIR 2014: Industry Buenos Aires, Argentina International symposium on high-voltage engineering 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_484-characterization-of-a-fast-step-generator J.Hällström A.Bergman M. Nordlund A.P.Elg J.Meisner S.Passon proceedings BergmanN2017 467 Characterisation at low voltage of two reference lightning impulse generators e-cigre.org 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry lightning impulse, reference measuring system, calibration EMPIR 2014: Industry Buenos Aires, Argentina International symposium on high-voltage engineering 2017 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_485-characterisation-at-low-voltage-of-two-reference-lightning-impulse-dividers A.Bergman M.Nordlund proceedings BergmanNEHMH2017 461 Influence of coaxial cable on response of high voltage resistive dividers e-cigre.org 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry Lightning impulse, pulse response, front time EMPIR 2014: Industry Buenos Aires, Argentina International symposium on high-voltage engineering 2017 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_487-influence-of-coaxial-cable-on-response-of-high-voltage-resistive-dividers A.Bergman M.Nordlund A.P.Elg J. Havunen J.Meisner J.Hällström proceedings ElgHB2017 462 Evaluation of step response of transient recorders for lightning impulse e-cigre.org 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry Step response, lightning impulse, transient recorder EMPIR 2014: Industry Buenos Aires, Argentina International symposium on high-voltage engineering 2017 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_488-evaluation-of-step-response-of-transient-recorders-for-lightning-impulse A.P.Elg J.Hällström A.Bergman proceedings HavunenHBB2017 458 Using Deconvolution for Correction of Non-Ideal Step Response of Lightning Impulse Digitizers and Measurement Systems e-cigre 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry Lightning impulse, Deconvolution EMPIR 2014: Industry Buenos Aires, Argentina International symposium on high voltage engineering 2017 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_381-using-deconvolution-for-correction-of-non-ideal-step-response-of-lightning-impulse-digitizers-and-measurement-systems J. Havunen J.Hällström A.E.Bergman A.Bergman article DegiovanniAPRLVTGBCVG2017 334 Determining the quantum expectation value by measuring a single photon Nature Physics 2017 8 14 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 4 Protective Measurements, Weak Measurements https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf; EMPIR 2014: Industry Springer Nature 30 1745-2473, 1745-2481 10.1038/nphys4223 NA F.Piacentini A.Avella E.Rebufello R.Lussana F.Villa A.Tosi M.Gramegna G.Brida E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article SuterSSPOMKHGFBAKLWS2017 The CLARA/NORSAT-1 solar absolute radiometer: instrument design, characterization and calibration Metrologia 2017 8 10 54 5 ENV53: MetEOC2: Metrology for earth observation and climate 674-682 solar irradiance, satellite measurements, electrical substitution radiometer, cavity detector, sun EMRP A169: Call 2013 Environment II IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa7a63 NA M.Suter M.Spescha R.Soder D,Pfiffner A.R.Oliva N.Mingard S.Koller K.Heuerman M.Gyo W.Finsterle I.Beck B.Andersen G.Kopp P.L.Levesque B.Walter W.Schmutz article LodewyckTBEBV2017 400 A noise-immune cavity-assisted non-destructive detection for an optical lattice clock in the quantum regime New Journal of Physics 2017 8 19 8 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 083002 optical clock, frequency stability, optical lattice clock, non-destructive detection, spin squeezing http://iopscience.iop.org/1367-2630/19/8/083002 EMRP A169: Call 2012 Open excellence call IOP Publishing 30 1367-2630 10.1088/1367-2630/aa7c84 NA J.Lodewyck R.L.Targat S.Bilicki U.Eismann E.Bookjans G.Vallet article StangaSBG2017 Determination of the neutron activation profile of core drill samples by gamma-ray spectrometry Applied Radiation and Isotopes 2017 8 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities Gamma spectrometry, Activity profile, Core sample, Concrete activation EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.08.004 NA D.Stanga O.Sima S.Boden D.Gurau article GreilichKBKBSSP2017 601 Radiation dosimetry in magnetic fields with Farmer-type ionization chambers: determination of magnetic field correction factors for different magnetic field strengths and field orientations Physics in Medicine & Biology 2017 8 62 16 15HLT08: MRgRT: Metrology for MR guided radiotherapy 6708-6728 Dosimetry, MRgRT, Radiotherapy, Magnetic fields EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aa7ae4 NA C KSpindeldreier OSchrenk ABakenecker IKawrakow LBurigo C PKarger SGreilich APfaffenberger article KeightleyBPVPBGW2017 Compact radioactive aerosol monitoring device for early warning networks Applied Radiation and Isotopes 2017 8 126 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 219-224 Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2016.12.036 NA L.Keightley S.J.Bell D.Ponikvar M.Vencelj T.Petrovič D.Brodnik D.Glavič-Cindro S.Woods article VandervorstMAFDKBV2017 565 Atom probe tomography analysis of SiGe fins embedded in SiO 2 : Facts and artefacts Ultramicroscopy 2017 8 179 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 100-107 Atom probe tomography, Tip shape, FinFET, Local magnification, Trajectory overlaps https://lirias2repo.kuleuven.be/rest/bitstreams/515063/retrieve EMPIR 2014: Industry Elsevier BV 30 0304-3991 10.1016/j.ultramic.2017.04.006 NA D.Melkonyan C.Fleischmann L.Arnoldi J.Demeulemeester A.Kumar J.Bogdanowicz F.Vurpillot W.Vandervorst article LecuelleMLDMFOFB2017 897 In vivo XCT bone characterization of lattice structured implants fabricated by additive manufacturing Heliyon 2017 8 3 8 15HLT09: MetAMMI: Metrology for additively manufactured medical implants e00374 Bioengineering; Biomedical engineering; Dentistry; Materials science; Medical imaging https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5669606/ EMPIR 2015: Health Elsevier BV 30 2405-8440 10.1016/j.heliyon.2017.e00374 NA A.F.Obaton J.Fain M.Djemaï D.Meinel F.Léonard E.Mahé B.Lécuelle J.J.Fouchet G.Bruno article DuaneFSBGSBR2017 429 Reply to Comment on ‘Development of a primary standard for absorbed dose from unsealed radionuclide solutions’ Metrologia 2017 7 27 54 4 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy 615-616 dosimetry, radionuclide solution, extrapolation chamber, primary standard,validation of dose calculation http://iopscience.iop.org/article/10.1088/1681-7575/aa78ff/meta EMPIR 2015: Health IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa78ff NA IBillas DShipley SGaler GBass TSander AFenwick SDuane V.Smyth article BoudotdYTCBA2017 High-contrast sub-Doppler absorption spikes in a hot atomic vapor cell exposed to a dual-frequency laser field New Journal of Physics 2017 7 25 19 7 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 073028 Counterpropagating light waves, saturation spectroscopy, dark resonances, diode-lasers; d-1 line, d1 line, d2 line EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing 30 1367-2630 10.1088/1367-2630/aa7258 NA R.Boudot E.de Clercq V.Yudin A.Taichenachev G.Coget D.Brazhnikov M.Abdel Hafiz article MasowskiLCCBAPMNNlLKBKMZCPBT2017 402 Fibre-optic delivery of time and frequency to VLBI station Astronomy & Astrophysics 2017 7 603 15SIB03: OC18: Optical clocks with 1E-18 uncertainty A48 high angular resolution instrumentation, interferometers EMPIR 2015: SI Broader Scope EDP Sciences 30 0004-6361, 1432-0746 10.1051/0004-6361/201730615 NA P.Krehlik L.Buczek J.Kołodziej M.Lipiński Ł.Śliwczyński J.Nawrocki P.Nogaś A.Marecki E.Pazderski P.Ablewski M.Bober R.Ciuryło A.Cygan D.Lisak P.Masłowski P.Morzyński M.Zawada R. M.Campbell J.Pieczerak A.Binczewski K.Turza proceedings SliwczynskiKBBT2017 443 Time and frequency transfer in modern DWDM telecommunication networks 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fiber, optical frequency transfer https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE Besançon, France 2017 European Frequency and Time Forum & International Frequency Control Symposium 10-07-2017 to 13-07-2017 30 10.1109/fcs.2017.8088894 NA K.Turza A.Binczewski W.Bogacki P.Krehlik L.Śliwczyński proceedings SliwczynskiKKIPESB2017 444 Fiber optic time transfer between PTB and Deutsche Telekom using multi-link redundant topology 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fiber, optical frequency transfer https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE Besançon, France 2017 European Frequency and Time Forum & International Frequency Control Symposium 10-07-2017 to 13-07-2017 30 10.1109/FCS.2017.8088999 NA L.Śliwczyński P.Krehlik J.Kolodziej H.Imlau H.Ender H.Schnatz D.Piester A.Bauch article SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017 477 CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fibre, network, clock, time, dissemination, service https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE 30 10.1109/FCS.2017.8089004 NA P.Krehlik L.Śliwczyński J.Dostal J.Radil V.Smotlacha R.Velc J.Vojtech M.Campanella D.Calonico C.Clivati F.Levi O.Číp S.Rerucha R.Holzwarth M.Lessing F.Camargo B.Desruelle J.Lautier-Gaud E.L.English J.Kronjäger P.Whibberley P.E.Pottie R.Tavares P.Tuckey F.John M.Snajder J.Stefl P.Nogaś R.Urbaniak A.Binczewski W.Bogacki K.Turza G.Grosche H.Schnatz E.Camisard N.Quintin J.Diaz T.Garcia E.Ros A.Galardini A.Seeds Z.Yang A.Amy-Klein article RuhlBTRFUPKHKHU2017 848 Enhancing the sensitivity of nano-FTIR spectroscopy Optics Express 2017 7 25 14 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 16574 Instrumentation, measurement, and metrology; Near-field microscopy https://www.osapublishing.org/DirectPDFAccess/158D237A-A0E8-5960-84426107CE1CBCF4_369006/oe-25-14-16574.pdf?da=1&id=369006&seq=0&mobile=no EMPIR 2015: Health The Optical Society 30 1094-4087 10.1364/OE.25.016574 NA P.Hermann B.Kästner A.Hoehl V.Kashcheyevs P.Patoka G.Ulrich J.Feikes M.Ries T.Tydecks B.Beckhoff E.Ruhl G.Ulm article HudlickaSBFH2017 769 Optical and RF metrology for 5G 2017 IEEE Photonics Society Summer Topical Meeting Series (SUM) 2017 7 14IND10: MET5G: Metrology for 5G communications Optical variables measurement, 5G mobile communication, Transmission line measurements, Photodiodes, Adaptive optics, Optical fiber communication, Oscilloscopes https://arxiv.org/abs/1809.08934 EMPIR 2014: Industry IEEE 30 10.1109/PHOSST.2017.8012717 NA D.A.Humphreys I.Fatadin M.Bieler P.Struszewski M.Hudlicka article UnterumsbergerPLKHHWB2017 Determination of SiO2 and C layers on a monocrystalline silicon sphere by reference-free x-ray fluorescence analysis Metrologia 2017 6 28 54 4 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 481-486 Avogadro project, X-ray fluorescence, quantification EMRP A169: Call 2013 Energy II IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa765f NA R.Unterumsberger B.Pollakowski-Herrmann J.Lubeck M.Kolbe I.Holfelder PHönicke J.Weser B.Beckhoff article MasowskiCZDBCAMWBL2017 387 Absolute frequency determination of molecular transition in the Doppler regime at kHz level of accuracy Journal of Quantitative Spectroscopy and Radiative Transfer 2017 6 11 201 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 156-160 Transition frequency, Absolute frequency measurement, Optical atomic clock, Oxygen B band, Cavity ring-down spectroscopy EMPIR 2015: SI Broader Scope Elsevier BV 30 0022-4073 10.1016/j.jqsrt.2017.07.010 NA https://arxiv.org/pdf/1705.06639.pdf K.Bielska S.Wójtewicz P.Morzyński P.Ablewski A.Cygan M.Bober J.Domysławska M.Zawada R.Ciuryło P.Masłowski D.Lisak article HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017 141 Test of Special Relativity Using a Fiber Network of Optical Clocks Physical Review Letters 2017 6 118 22 15SIB05: OFTEN: Optical frequency transfer - a European network https://arxiv.org/abs/1703.04426 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.118.221102 NA P.Delva J.Lodewyck S.Bilicki E.Bookjans G.Vallet R.Le Targat P.-E.Pottie C.Guerlin F.Meynadier C.Le Poncin-Lafitte O.Lopez A.Amy-Klein W.-K.Lee N.Quintin C.Lisdat A.Al-Masoudi S.Dörscher C.Grebing G.Grosche A.Kuhl S.Raupach U.Sterr I. R.Hill R.Hobson W.Bowden J.Kronjäger G.Marra A.Rolland F. N.Baynes H. S.Margolis P.Gill article MonteALBGRRKMAG2017 Defect characterisation of tensile loaded CFRP and GFRP laminates used in energy applications by means of infrared thermography Quantitative InfraRed Thermography Journal 2017 6 ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-20 Defect characterisation CFRP and GFRP laminates energy applications infrared thermography EMRP A169: Call 2013 Energy II Informa UK Limited 30 1768-6733, 2116-7176 10.1080/17686733.2017.1334312 NA C.Monte A.Aktas M.Lodeiro G.Baker M.Gower B.Rehmer M.Röllig R.Krankenhagen C.Maierhofer A.Adibekyan B.Gutschwager article BoothGOVNNFDT2017 Single-Ended Differential Protection in MTDC Networks Using Optical Sensors IEEE Transactions on Power Delivery 2017 6 32 3 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids 1605-1615 HVDC protection, multi-terminal direct current, modular multi-level converters, optical sensors. EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 0885-8977, 1937-4208 10.1109/TPWRD.2016.2645231 NA C.D.Booth N.Gordon P.Orr D.Vozikis P.Niewczas J.Nelson G.Fusiek A.Dysko D.Tzelepis proceedings SchutzeKSGRSBL2017 Highly sensitive benzene detection with MOS gas sensors Proceedings Sensor 2017 2017 6 A4 - Gas S ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change 92-97 metal oxide semiconductor, MOS, temperature-cycled operation, TCO, benzene https://www.ama-science.org/proceedings/details/2498 EMRP A169: Call 2013 Environment II Nurember AMA Conferences 2017 – SENSOR 2017 30-05-2017 to 01-06-2017 30 978-3-9816876-4-4 10.5162/sensor2017/A4.3 NA AndreasSchütze GertjanKok LaurentSpinelle MichelGerboles WolfhardReimringer TilmanSauerwald TobiasBaur MartinLeidinger article HoutzagerBKv2017 AC–DC Calibrations With a Pulse-Driven AC Josephson Voltage Standard Operated in a Small Cryostat IEEE Transactions on Instrumentation and Measurement 2017 6 66 6 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1391-1396 AC–DC difference, Josephson voltage standard, measurement standards, measurement techniques, voltagemeasurement. http://ieeexplore.ieee.org/document/7898429/ EMRP A169: Call 2012 SI Broader scope (II) Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2017.2662381 NA E.Houtzager S.Bauer O.F.O.Kieler H.E.van den Brom article ManderEBCB2017 A methodology for study of in-service drift of meteorological humidity sensors Metrologia 2017 5 26 54 3 ENV58: MeteoMet2: Metrology for essential climate variables S63-S73 humidty, meteorology, sensor drift http://iopscience.iop.org/article/10.1088/1681-7575/aa6dd0/meta;jsessionid=69E0689027FB9B75F14F77239651C49F.ip-10-40-1-105 EMRP A169: Call 2013 Environment II IOP Publishing
Bristol
30 0026-1394, 1681-7575 10.1088/1681-7575/aa6dd0 NA NMander CEngland S LBeardmore P ACarroll S ABell
article ClivatiLIDCSDCBI2017 140 Measuring molecular frequencies in the 1-10 µm range at 11-digits accuracy Atomic Physics (physics.atom-ph) 2017 5 18 15SIB05: OFTEN: Optical frequency transfer - a European network molecular frequencies EMPIR 2015: SI Broader Scope 30 10.1038/s41598-017-12891-6 NA G.Insero S.Borri D.Calonico P.Cancio Pastor C.Clivati D.D’Ambrosio P.De Natale M.Inguscio F.Levi G.Santambrogio proceedings BurgerTMC2017 851 Modelling of standard and specialty fibre-based systems using finite element methods Proc. SPIE 2017 5 17 10683 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 1068336 Finite element modelling, modal distribution, specialty fibres http://arxiv.org/abs/1807.10811 EMPIR 2014: Industry Strasbourg Fiber Lasers and Glass Photonics: Materials through Applications 22-04-2018 to 26-04-2018 30 10.1117/12.2307372 NA N.Castagna J.Morel L.Testa S.Burger article CaldersBADNMOB2017 Evaluation of the Range Accuracy and the Radiometric Calibration of Multiple Terrestrial Laser Scanning Instruments for Data Interoperability IEEE Transactions on Geoscience and Remote Sensing 2017 5 55 5 ENV53: MetEOC2: Metrology for earth observation and climate 2716-2724 Data interoperability, radiometric calibration, RIEGL VZ-400, terrestrial light detection and ranging (LiDAR). EMRP A169: Call 2013 Environment II Institute of Electrical and Electronics Engineers (IEEE)
New York, USA
30 0196-2892, 1558-0644 10.1109/TGRS.2017.2652721 NA KimCalders AndrewBurt JohnArmston Mathias I.Disney JoanneNightingale JasmineMuir NiallOrigo BenjaminBrede
article LopezAPBSL2017 139 Hybrid fiber links for accurate optical frequency comparison Applied Physics B 2017 5 123 5 15SIB05: OFTEN: Optical frequency transfer - a European network Hybrid fiber links, accurate optical frequency comparison, https://link.springer.com/article/10.1007/s00340-017-6736-5 EMPIR 2015: SI Broader Scope Springer Nature
New York
30 0946-2171, 1432-0649 10.1007/s00340-017-6736-5 NA W.K.Lee F.Stefani A.Bercy O.Lopez A.Amy-Klein P.E.Pottie
article SantarelliLLCCMWKKCSNRQDLBRGGAWGALLPG2017 138 First international comparison of fountain primary frequency standards via a long distance optical fiber link Metrologia 2017 5 54 3 15SIB05: OFTEN: Optical frequency transfer - a European network 348-354 optical fiber frequency transfer, atomic fountain clocks, international fountain, clock comparison http://iopscience.iop.org/article/10.1088/1681-7575/aa65fe EMPIR 2015: SI Broader Scope IOP Publishing
Bristol
30 0026-1394, 1681-7575 10.1088/1681-7575/aa65fe NA JGuena SWeyers MAbgrall CGrebing VGerginov PRosenbusch SBize BLipphardt HDenker NQuintin S M FRaupach DNicolodi FStefani NChiodo SKoke AKuhl FWiotte FMeynadier ECamisard CChardonnet YLe Coq MLours GSantarelli AAmy-Klein RLe Targat OLopez P EPottie GGrosche
article BhattacharyaUPRH2017 Temperature measurement using frequency comb absorption spectroscopy of CO2 Review of Scientific Instruments 2017 5 88 5 SIB60: Surveying: Metrology for long distance surveying 053113 spectroscopy, frequency comb laser http://aip.scitation.org/doi/10.1063/1.4984252 EMRP A169: Call 2012 SI Broader scope (II) AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.4984252 NA N.Bhattacharya H. P.Urbach S. T.Persijn A.Reyes-Reyes A.Hänsel article KochGIIGHKBWK2017 174 Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI PLOS ONE 2017 4 12 12 4 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources 1-19 Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI EMPIR 2015: Health
San Francisco, California, and Cambridge, United Kingdom.
30 10.1371/journal.pone.0174420 NA MarkusWeichenberger MartinBauer RobertKühler JohannesHensel C. G.Forlim AlbrechtIhlenfeld Bernd Ittermann JürgenGallinat ChristianKoch SimoneKühn
article BialekH2017 Cause, Effect, and Correction of Field Spectroradiometer Interchannel Radiometric Steps IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing 2017 4 10 4 ENV53: MetEOC2: Metrology for earth observation and climate 1542-1551 Fieldspectroscopy, radiometry, sensor model, temperature dependence http://ieeexplore.ieee.org/document/7819458/ EMRP A169: Call 2013 Environment II Institute of Electrical and Electronics Engineers (IEEE)
New Jersey
30 1939-1404, 2151-1535 10.1109/JSTARS.2016.2625043 NA A.Bialek A.Hueni
article CarmeleRBSSSGSSvTHKR2017 234 A bright triggered twin-photon source in the solid state Nature Communications 2017 4 8 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 14870 Quantum dots, Quantum optics, Single photons and quantum effects . https://www.nature.com/articles/ncomms14870 EMPIR 2014: Industry Springer Nature 30 2041-1723 10.1038/ncomms14870 NA T.Heindel A.Thoma M.von Helversen M.Schmidt A.Schlehahn M.Gschrey P.Schnauber J. -H.Schulze A.Strittmatter J.Beyer S.Rodt A.Carmele A.Knorr S.Reitzenstein article KataokaAKBG2017 313 Robust operation of a GaAs tunable barrier electron pump Metrologia 2017 4 54 3 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 299-306 single-electron pumps, primary electrical metrology, current standards http://iopscience.iop.org/article/10.1088/1681-7575/54/1/S1/meta;jsessionid=4918445C3978B8F392DE6A658FA21463.ip-10-40-1-105 http://www.e-si-amp.eu/outputs/ EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa634c NA S PGiblin M-HBae NKim Ye-HwanAhn MKataoka article JehlBKCVSHLBKC2017 369 Design and Operation of CMOS-Compatible Electron Pumps Fabricated With Optical Lithography IEEE Electron Device Letters 2017 4 38 4 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 414-417 Quantum dots, Quantum effect semiconductor devices, Quantization, Current control https://arxiv.org/abs/1612.09547 http://www.e-si-amp.eu/outputs/ EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0741-3106, 1558-0563 10.1109/LED.2017.2670680 NA P.Clapera J.Klochan R.Lavieville S.Barraud L.Hutin M.Sanquer M.Vinet A.Cinins G.Barinovs V.Kashcheyevs X.Jehl article PrancePPJHHGGBPB2017 504 On-chip magnetic cooling of a nanoelectronic device Scientific Reports 2017 4 7 15SIB02: InK 2: Implementing the new kelvin 2 45566 Electronic devices, Electronic properties and materials https://www.nature.com/articles/srep45566 EMPIR 2015: SI Broader Scope Springer Nature 30 2045-2322 10.1038/srep45566 NA D. I.Bradley A. M.Guénault D.Gunnarsson R. P.Haley S.Holt A. T.Jones Y. A.Pashkin J.Penttilä J. R.Prance M.Prunnila L.Roschier thesis Boles2017 312 Development of Traceable Capabilities in Non-Contact Thermal Metrology 2017 3 31 14RPT05: Eura-Thermal: Developing traceable capabilities in thermal metrology Blackbody cavity, Radiation thermometer, Blackbody orientation, Infrared thermometer, Calibration http://arrow.dit.ie/engmas/53/ EMPIR 2014: Research Potential DIT, Dublin, Ireland Dublin Institute of Technology 30 10.21427/D7B90D 10.21427/D7B90D 10.21427/D7B90D NA S.Boles article LassilaHPBH2017 Interferometric 2D small angle generator for autocollimator calibration Metrologia 2017 3 30 54 3 SIB58: Angles: Angle metrology 253-261 autocollimator, interferometry, metrology, angle measurement EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa648d NA A.Lassila B.Hemming I.Palosuo V.Byman V.Heikkinen article HusainLTYBSSTKFH2017 30 Single Carrier Trapping and De-trapping in Scaled Silicon Complementary Metal-Oxide-Semiconductor Field-Effect Transistors at Low Temperatures Semiconductor Science and Technology 2017 3 24 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere Coulomb blockade, MOSFETs, Carrier Trapping and De-trapping, quantum dots EMPIR 2015: SI Broader Scope IOP Publishing 30 0268-1242, 1361-6641 10.1088/1361-6641/aa6910 NA Zuo Li MuhammadHusain Hiroyuki Yoshimoto KazukiTani YoshitakaSasago DighHisamoto JonathanFletcher MasayaKataoka YoshishigeTsuchiya ShinichiSaito article GotzingerVPCLSMIBS2017 Experimental demonstration of a predictable single photon source with variable photon flux Metrologia 2017 3 21 54 2 EXL02: SIQUTE: Single-photon sources for quantum technologies 218-223 single photon sources, single photon metrology, silicon vacancy center, low optical flux detector, photon on demand EMRP A169: Call 2012 Open excellence call IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa5ba2 NA S.Götzinger A.Vaigu G.Porrovecchio X.L.Chu S.Lindner M.Smid A.Manninen E.Ikonen C.Becher V.Sandoghdar miscellaneous RoscoeB Real-time measurement of Phasor Measurement Unit (PMU) reporting latency Github 2017 3 20 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality Communications, IEC 61850, IEEE 1588, IEEE C37.118, phasor measurement units (PMUs), Sampled Values, time synchronisation EMRP A169: Call 2013 Energy II 30 10.5281/zenodo.400934 NA AndrewRoscoe StevenBlair article BrunzendorfWSLEW2017 High-resolution Fourier transform measurements of line strengths in the 00^02-00^00 main isotopologue band of nitrous oxide Applied Optics 2017 3 17 56 11 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring E99-E105 Nitrous oxide, Fourier transform infrared spectroscopy, spectral line parameters, line strengths, gas metrology EMRP A169: Call 2010 Environment The Optical Society
2010 Massachusetts Ave, NW Washington, DC 20036-1023, USA
30 0003-6935, 1539-4522 10.1364/ao.56.000e99 NA JensBrunzendorf ViktorWerwein AntonSerdyukov GangLi VolkerEbert OlavWerhahn
article deClercqGYCAB2017 A high-performance Raman-Ramsey Cs vapor cell atomic clock Journal of Applied Physics 2017 3 14 121 10 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 104903 Frequency standard, laser, resonances, stability, shift EMRP A169: Call 2012 Metrology for Industry (II) AIP Publishing 30 0021-8979, 1089-7550 10.1063/1.4977955 NA E.de Clercq S.Guérandel P.Yun G.Coget M.Abdel Hafiz R.Boudot article ZoladekLemanczykBNKCS2017 Fabrication of air-stable, large-area, PCDTBT:PC70BM polymer solar cell modules using a custom built slot-die coater Solar Energy Materials and Solar Cells 2017 3 161 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 388-396 Slot-die coating; Polymer Solar Cells (PSC); Large-area; Ambient stability; PCDTBT:PC70BM; Light beam induced current (LBIC); Photoluminescence (PL) EMRP A169: Call 2013 Energy II Elsevier BV
New York, United States
30 0927-0248 10.1016/j.solmat.2016.12.019 NA AlinaZoladek-Lemanczyk FrancescoBausi EdwardNew Dimitar I.Kutsarov Fernando A.Castro S. Ravi P.Silva
article BettsBHCKG2017 Compressed Sensing Current Mapping Spatial Characterization of Photovoltaic Devices IEEE Journal of Photovoltaics 2017 3 7 2 ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification 486-492 Compressed sensing (CS), light beam induced current (LBIC)measurements, solar cells, spatial characterization EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE)
Piscataway, New Jersey
30 2156-3381, 2156-3403 10.1109/JPHOTOV.2016.2646900 NA TRBetts MBliss SRGHall MCashmore GKoutsourakis RGottschalg
article WollschlagerHBGLP2017 Note: Nanomechanical characterization of soft materials using a micro-machined nanoforce transducer with an FIB-made pyramidal tip Review of Scientific Instruments 2017 3 88 3 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects 036104 MEMS, nanoindentation, soft materials EMRP A169: Call 2011 Metrology for New Technologies AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.4977474 NA N.Wollschläger K.Hiller U.Brand S.Gao Z.Li F.Pohlenz proceedings LiSBFKHTLS2017 1124 Transport properties in silicon nanowire transistors with atomically flat interfaces 2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM) 2017 2 28 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere narrow channel effect, silicon nanowire, SOI, TMAH, self-limiting oxidation https://eprints.soton.ac.uk/402316/ EMPIR 2015: SI Broader Scope IEEE Toyama 2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM) 28-02-2017 to 02-03-2017 30 10.1109/EDTM.2017.7947561 NA F.Liu M.K.Husain Z.Li M.S.H.Sotto D.Burt J.D.Fletcher M.Kataoka Y.Tsuchiya S.Saito article deLauretoBPSSFD2017 453 α-Synuclein structural features inhibit harmful polyunsaturated fatty acid oxidation, suggesting roles in neuroprotection Journal of Biological Chemistry 2017 2 23 292 17 15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases 6927-6937 α-synuclein (α-synuclein), lipid oxidation, mass spectrometry, (MS) polyunsaturated fatty acid (PUFA), protein chemical modification http://www.jbc.org/content/292/17/6927 EMPIR 2015: Health American Society for Biochemistry & Molecular Biology (ASBMB) 30 0021-9258, 1083-351X 10.1074/jbc.M116.765149 NA G.De Franceschi C.Fecchio R.Sharon A.H.V.Schapira C.Proukakis V.Bellotti P.P.de Laureto article PalafoxBH2017 A Josephson Impedance Bridge Based on Programmable Josephson Voltage Standards IEEE Transactions on Instrumentation and Measurement 2017 2 16 66 6 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1539 - 1545 mpedance, Josephson array, programmable Josephson system, Bridge circuits, Impedance, Uncertainty, Transient analysis, Standards, Measurement uncertainty, Frequency measurement EMRP A169: Call 2012 SI Broader scope (II) Institute of Electrical and Electronics Engineers (IEEE)
445 Hoes Lane Piscataway NJ 08855-1331
30 0018-9456, 1557-9662 10.1109/TIM.2017.2659898 NA L.Palafox R.Behr T.Hagen
article VilloingMGB2017 92 Internal dosimetry with the Monte Carlo code GATE: validation using the ICRP/ICRU female reference computational model Physics in Medicine and Biology 2017 2 62 5 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy 1885-1904 Monte Carlo modelling, internal dosimetry, GATE, MCNPX, voxelized models EMPIR 2015: Health IOP Publishing
Bristol
30 0031-9155, 1361-6560 10.1088/1361-6560/62/5/1885 NA DVilloing SMarcatili M-PGarcia MBardiès
article StagniRPNNMMLFBBAACZC2017 134 A VLBI experiment using a remote atomic clock via a coherent fibre link Scientific Reports 2017 2 7 15SIB05: OFTEN: Optical frequency transfer - a European network 40992 VLBI experiment, remote atomic clock https://www.nature.com/articles/srep40992 EMPIR 2015: SI Broader Scope Springer Nature
New York
30 2045-2322 10.1038/srep40992 NA C.Clivati R.Ambrosini T.Artz A.Bertarini C.Bortolotti M.Frittelli F.Levi A.Mura G.Maccaferri M.Nanni M.Negusini F.Perini M.Roma M.Stagni M.Zucco D.Calonico
article PavsiDBFVJSeHRKMAAM2017 2144 Inter-laboratory assessment of different digital PCR platforms for quantification of human cytomegalovirus DNA Analytical and Bioanalytical Chemistry 2017 1 26 409 10 HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms 2601-2614 Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials EMRP A169: Call 2011 Metrology for Health Springer Science and Business Media LLC 30 1618-2642, 1618-2650 10.1007/s00216-017-0206-0 NA J.Pavšič A.Devonshire A.Blejec C.A.Foy F.Van Heuverswyn G.M.Jones H.Schimmel J.Zel J.F.Huggett N.Redshaw M.Karczmarczyk E.Mozioglu S.Akyürek M.Akgöz M.Milavec article FinlaysonGUBd2017 An improved non-contact thermometer and hygrometer with rapid response Metrologia 2017 1 25 54 1 ENV58: MeteoMet2: Metrology for essential climate variables S9-S15 temperature, humidity, non-contact, rapid response, thermometer, hygrometer, TDLAS http://iopscience.iop.org/article/10.1088/1681-7575/aa54c6 EMRP A169: Call 2013 Environment II IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa54c6 NA AFinlayson TGardiner RUnderwood SBell MDe Podesta article deClercqGBFMCTY2017 High-Performance Coherent Population Trapping Clock with Polarization Modulation Physical Review Applied 2017 1 25 7 1 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications Frequency standards, atomic clock, ramsey fringes, dark-line, vapor, laser spectroscopy EMRP A169: Call 2012 Metrology for Industry (II) American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.7.014018 NA E.de Clercq S.Guérandel R.Boudot B.François S.Micalizio C.E.Calosso F.Tricot P.Yun article DucourtieuxCBAFF2017 Modelling of the X,Y,Z positioning errors and uncertainty evaluation for the LNE's mAFM using the Monte Carlo method Measurement Science and Technology 2017 1 23 28 3 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 034007 atomic force microscope, metrology, virtual instrument, measurement uncertainty, Monte Carlo method, Morris design, Sobol indices EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing
Temple Circus, Temple, Bristol, BS1 6BE, United Kingdom
30 0957-0233, 1361-6501 10.1088/1361-6501/28/3/034007 NA SebastienDucourtieux PaulCeria YounesBoukellal AlexandreAllard NicolasFischer NicolasFeltin
article MillesSSEGBNL2017 Comparing AFM cantilever stiffness measured using the thermal vibration and the improved thermal vibration methods with that of an SI traceable method based on MEMS Measurement Science and Technology 2017 1 23 28 3 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects 034010 cantilever stiffness calibration, active reference spring, micro-electro-mechanical system http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034010/pdf EMRP A169: Call 2011 Metrology for New Technologies IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/28/3/034010 NA L.F.Milles S.W.Stahl T.Sulzbach W.Engl S.Gao U.Brand V.Nesterov Z.Li article CalonicoLCCMBRTP2017 111 Absolute frequency measurement of the 1S0 – 3P0 transition of 171Yb Metrologia 2017 1 20 54 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 102-112 optical lattice clock, SI second, frequency metrology EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa4e62 NA MPizzocaro PThoumany BRauf FBregolin GMilani CClivati G.A.Costanzo FLevi DCalonico article NovikovaKGBWLRBMNL2017 CASTOR, a new instrument for combined XRR-GIXRF analysis at SOLEIL X-Ray Spectrometry 2017 1 13 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications x-ray EMRP A169: Call 2013 Energy II Wiley-Blackwell
111 River Street Hoboken, NJ 07030, USA
30 0049-8246 10.1002/xrs.2742 NA A.Novikova B.Kanngießer D.Grötzsch B.Beckhoff J.Weser J.Lubeck H.Rotella B.Boyer Y.Ménesguen E.Nolot M.-C.Lépy
article MihailescuBKC2017 497 Key comparison BIPM.RI(I)-K1 of the air-kerma standards of the SCK·CEN, Belgium and the BIPM in 60Co gamma radiation Metrologia 2017 1 54 1A 14RPT04: Absorb: Absorbed dose in water and air 06004-06004 cavity chamber, air kerma reference, comparison EMPIR 2014: Research Potential IOP Publishing 30 0026-1394, 1681-7575 10.1088/0026-1394/54/1a/06004 NA CKessler DBurns L CMihailescu SChiriotti article BecherLSGCSPHLRK2017_2 Experimental realization of an absolute single-photon source based on a single nitrogen vacancy center in a nanodiamond Optica 2017 1 4 1 EXL02: SIQUTE: Single-photon sources for quantum technologies 71 Metrology, Radiometry, Sources, Photon statistics EMRP A169: Call 2012 Open excellence call The Optical Society 30 2334-2536 10.1364/OPTICA.4.000071 NA C.Becher S.Lindner V.Sandoghdar S.Götzinger X.L.Chu M.Smid G.Porrovecchio H.Hofer M.López B.Rodiek S.Kück article BuermannR2017 1320 Dynamic determination of equivalent CT source models for personalized dosimetry Current Directions in Biomedical Engineering 2017 1 3 2 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion dosimetry, personalised medicine, CT source models EMPIR 2015: Health Walter de Gruyter GmbH 30 2364-5504 10.1515/cdbme-2017-0167 NA S.Rosendahl L.Büermann inbook Total Ozone Data Retrieval from the Phaethon DOAS System 2017 2 ENV59: atmoz: Traceability for atmospheric total column ozone 989-994/141 total ozone, DOAS, Phaethon, Langley http://link.springer.com/chapter/10.1007%2F978-3-319-35095-0_141 EMRP A169: Call 2013 Environment II Springer International Publishing
Switzerland
Perspectives on Atmospheric Sciences 30 978-3-319-35094-3 10.1007/978-3-319-35095-0_141 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-12-31 F.Gkertsi A.F.Bais Th.Drosoglou K.Fragkos I.Fountoulakis N.Kouremeti
proceedings WeidingerBJK2017 243 Torque measurement uncertainty in multi-MW nacelle test benches = Messunsicherheit des Drehmomentes in multi-MW Windenergieanlagen Prüfständen 3rd Conference for Wind Power Drives 2017 1 14IND14: MNm Torque: Torque measurement in the MN•m range 1-14 nacelle test bench, FEM simulation, measurement uncertainty EMPIR 2014: Industry Books on Demand
Norderstedt
Aachen, Germany 3rd Conference for Wind Power Drives , Aachen , Germany 07-03-2017 to 08-03-2017 30 978-3-7431-3456-0 10.18154/RWTH-2017-02946 NA S.Kock G.Jacobs D.Bosse P.Weidinger
proceedings ZschiedrichGWHBB2017 423 Quantifying parameter uncertainties in optical scatterometry using Bayesian inversion Proc. SPIE 2017 10330 14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications 1033004 computational metrology, optical metrology, computational lithography, nanolithography, finite-element methods, nanooptics https://arxiv.org/pdf/1707.08467 EMPIR 2014: Industry Munich Modeling Aspects in Optical Metrology VI 25-06-2017 to 29-06-2017 30 10.1117/12.2270596 NA MHammerschmidt MWeiser XGarcia Santiago LZschiedrich BBodermann SBurger proceedings VenceljPGB2017 MetroERM - Metrology for Radiological Early Warning Networks in Europe Proceedings of the eleventh symposium of the Croatian radiation protection association 2017 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 175-181 MetroERM, dose rate equivalent rate, radioactivity concentrations in air and ground EMRP A169: Call 2013 Environment II Osijek, Croatia 11th Symposium Of The Croatian Radiation Protection Association 05-04-2017 to 07-04-2017 30 1849 - 5060 NA M.Vencelj T.Petrovič D.Glavič - Cindro D.Brodnik article PlimmerOHB2017 809 A high-accuracy working standard for absolute pressure from 5 kPa to 130 kPa International Journal of Metrology and Quality Engineering 2017 8 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range 26 absolute pressure, calibration, working standard, capacitance diaphragm gauge, resonantsilicon gauge EMPIR 2014: Industry EDP Sciences 30 2107-6847 10.1051/ijmqe/2017020 NA F.Boineau S.Huret P.Otal M.Plimmer article BuismanTGF2017_2 813 Vector-corrected nonlinear multi-port IQ-mixer characterization using modulated signals IEEE 2017 14IND10: MET5G: Metrology for 5G communications Microwave measurement, Nonlinear distortion, Mixers, Frequency-domain analysis, Time-domain analysis https://research.chalmers.se/publication/248288/file/248288_Fulltext.pdf EMPIR 2014: Industry 30 10.1109/MWSYM.2017.8058888 NA S.Gustafsson M.Thorsell K.Buisman C.Fager article CoppolaCGMBGOS2017 931 Measurement of macro-scale indentation modulus using the primary hardness standard machines at INRIM IMEKO 2017 14IND03: Strength-ABLE: Metrology for length-scale engineering of materials Hardness, indentation modulus, macro-scale. EMPIR 2014: Industry Imeko
.
30 NA https://www.imeko.org/publications/tc5-2017/IMEKO-TC5-2017-001.pdf G.Coppola R.Cagliefo G.Genta G.Maizza G.Barbato A.Germak C.Origlia A. Schiavi
article BojkovskiOKMSISFZSSJoHHPV2017 1095 Expansion of European research capabilities in humidity measurement 18th International Congress of Metrology 2017 2017 18th 15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement 4/06006 Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html EMPIR 2015: Research Potential EDP Sciences 30 10.1051/metrology/201706006 NA N.Hodzic S.Čohodarević N.Jandrić R.Strnad D.Sestan D.Zvizdić V.Fernicola D.Smorgon L.Iacomini S.Simic D.Mac Lochlainn N.Karaboce S.Oguz Aytekin J.Bojkovski D.Hudoklin O.Petrušova T.Vukičević article NeumaierKBD2016 Characterization of detector-systems based on CeBr3, LaBr3, SrI2 and CdZnTe for the use as dosemeters Radiation Physics and Chemistry 2016 12 31 ENV57: MetroERM: Metrology for radiological early warning networks in Europe Environmental monitoring, Scintillation detectors, Monte-Carlo simulations EMRP A169: Call 2013 Environment II 30 10.1016/j.radphyschem.2016.12.015 NA S.Neumaier P.Kessler B.Behnke H.Dombrowski article MaringerWKSB2016 Study of particular problems appearing in NORM samples and recommendations for best practice gamma-ray spectrometry Applied Radiation and Isotopes 2016 12 28 126 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 285-288 Gamma-ray spectrometry; NORM; Spectral interference; Radon tightness https://www.sciencedirect.com/science/article/pii/S0969804316304961 EMRP A169: Call 2012 Metrology for Industry (II) Elsevier 30 10.1016/j.apradiso.2016.12.035 NA F.J.Maringer H.Wiedner F.Kabrt M.Stietka A.Baumgartner article GersterSSPGBWULHSP2016 11 Robustness of single-electron pumps at sub-ppm current accuracy level Metrologia 2016 12 20 54 1 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere S1-S8 single-electron pumps, small-current measurement, EMPIR 2015: SI Broader Scope IOP Publishing
Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom
30 0026-1394, 1681-7575 10.1088/1681-7575/54/1/S1 NA FStein HScherer TGerster RBehr MGötz EPesel CLeicht NUbbelohde TWeimann KPierz H WSchumacher FHohls
article LepratDBSP2016 66 Practical Quantum Realization of the Ampere from the Elementary Charge Physical Review X 2016 12 12 6 4 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 041051 Quantum current source, realization of the ampere, programmable Josephson voltage standard, quantum Hall resistance standard, cryogenic current comparator, SI EMPIR 2015: SI Broader Scope American Physical Society (APS)
New York, USA
30 2160-3308 10.1103/PhysRevX.6.041051 NA J.Brun-Picard S.Djordjevic D.Leprat F.Schopfer W.Poirier
article Transient photocurrent and photovoltage mapping for characterisation of defects in organic photovoltaics Solar Energy Materials and Solar Cells 2016 12 2 161 November 2016 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 89-95 Printed solar cells, Organic photovoltaics, Defects, Transient photovoltage, Transient photocurrent, Characterisation http://www.sciencedirect.com/science/article/pii/S0927024816304974 EMRP A169: Call 2013 Energy II Elsevier
Amsterdam
30 0927-0248 10.1016/j.solmat.2016.11.029 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SWood DO’Connor C WJones J DClaverley J CBlakesley CGiusca F ACastro
article VandervorstDPFLTHVBTFCS2016 158 Understanding Physico-Chemical Aspects in the Depth Profiling of Polymer:Fullerene Layers The Journal of Physical Chemistry C 2016 12 120 49 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 28074-28082 ToF-SIMS, GCIB, Ar cluster, quantification, depth profiling, organics, solar cells, polymer, fullerenes EMPIR 2014: Industry American Chemical Society (ACS)
CAS, a division of the American Chemical Society 2540 Olentangy River Road Columbus Ohio 43210 United States
30 1932-7447, 1932-7455 10.1021/acs.jpcc.6b09911 NA S.Surana T.Conard C.Fleischmann J.G.Tait J.P.Bastos E.Voroshazi R.Havelund M.Turbiez P.Louette A.Felten C.Poleunis A.Delcorte W.Vandervorst
article GenoveseBYTDM2016 233 Quantifying backflash radiation to prevent zero-error attacks in quantum key distribution Light: Science & Applications 2016 12 6 6 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication e16261 Backflash, Quantum Key Distribution, Single-photon avalanche diode, Zero-error attack http://www.nature.com/lsa/journal/v6/n6/full/lsa2016261a.html EMPIR 2014: Industry Springer Nature 30 2047-7538 10.1038/lsa.2016.261 NA A.Meda I.P.Degiovanni A.Tosi Z.Yuan G.Brida M.Genovese article HenaultBRPDBFBH2016 Development of facilities and methods for the metrological characterization of distributed temperature sensing systems based on optical fibres Measurement Science and Technology 2016 12 28 1 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities 015009 Distributed sensing, Temperature, Metrology, Raman http://iopscience.iop.org/article/10.1088/1361-6501/28/1/015009 EMRP A169: Call 2013 Environment II IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/28/1/015009 NA J MHénault Y LBeck RRazouk SPlumeri SDelepine-Lesoille OBeaumont GFailleau JBertrand BHay article BrownZQ2016 Temperature dependence of Hg vapour mass concentration at saturation in air: New SI traceable results between 15 and 30°C TrAC Trends in Analytical Chemistry 2016 12 85 ENV51: MeTra: Traceability for mercury measurements 81-88 Hg vapour mass concentrationIsotope dilution mass spectrometryTemperature dependent evolutionSI traceable resultsMeasurement procedure validationCombined uncertainty estimationISO/IEC 17025Internationally recommended reference datasets EMRP A169: Call 2013 Environment II Elsevier BV 30 0165-9936 10.1016/j.trac.2015.12.010 NA R.J.C.Brown M.Zampella C.R.Quétel article RietveldZOBCL2016 Traceable measurements of the electrical parameters of solid-state lighting products Metrologia 2016 11 21 53 6 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 1384-1394 uncertainty analysis, electrical measurement, solid-state lighting EMRP A169: Call 2013 Energy II IOP Publishing
Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom
30 0026-1394, 1681-7575 10.1088/0026-1394/53/6/1384 NA GRietveld DZhao FOverney J-PBraun AChristensen TLippert
proceedings New radiometric calibration site located at Gobabeb, Namib desert. Geoscience and Remote Sensing Symposium (IGARSS) 2016 11 3 ENV53: MetEOC2: Metrology for earth observation and climate 6094 - 6097 vicarious calibration, RadCalNet, site characterisation, HDRF http://ieeexplore.ieee.org/abstract/document/7730592/?reload=true EMRP A169: Call 2013 Environment II Institute of Electrical and Electronics Engineers International Beijing, China. Geoscience and Remote Sensing Symposium (IGARSS) 10th-15th July 2016 30 2153-7003 10.1109/IGARSS.2016.7730592 1 59 No, EURAMET is never allowed to make the publication publicly available. http://ieeexplore.ieee.org/abstract/document/7730592/?reload=true ABBialek CGGreenwell MLLamare AMMeygret SMMarcq SLLacherade EWWoolliams BBBerthelot MBBouvet MKKing CUUnderwood NFFox article GorenBTZSMPRFAF2016 Towards tributyltin quantification in natural water at the Environmental Quality Standard level required by the Water Framework Directive Talanta 2016 11 160 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 499-511 ICP-MS, Isotope Dilution, Limit of quantification, Metrological traceability, Tributyltin, Water Framework Directive EMRP A169: Call 2010 Environment Elsevier BV 30 0039-9140 10.1016/j.talanta.2016.07.056 NA A.C.Goren M.Bílsel M.Tunç T.Zuliani J.Sčančar R.Milačič R.Philipp J.Richter I.Fettig E.Alasonati P.Fisicaro article YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016 321 Versailles Project on Advanced Materials and Standards Interlaboratory Study on Measuring the Thickness and Chemistry of Nanoparticle Coatings Using XPS and LEIS The Journal of Physical Chemistry C 2016 10 27 120 42 14IND12: Innanopart: Metrology for innovative nanoparticles 24070-24079 VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory https://spiral.imperial.ac.uk/handle/10044/1/40824 EMPIR 2014: Industry American Chemical Society (ACS)
CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States
30 1932-7447, 1932-7455 10.1021/acs.jpcc.6b06713 NA N.A.Belsey D.Cant D.J.H.Cant C.Minelli J.R.Araujo B.Bock P.Brüner D.G.Castner G.Ceccone J.D.P.Counsell P.M.Dietrich M.H.Engelhard S.Fearn C.E.Galhardo H.Kalbe J.W.Kim L.Lartundo-Rojas H.S.Luftman T.S.Nunney J.Pseiner E.F.Smith V.Spampinato J.M.Sturm A.G.Thomas J.P.W.Treacy L.Veith M.Wagstaffe H.Wang M.Wang Y.C.Wang W.Werner L.Yang
article VilllaLCDBGLAPTZG2016 231 Measuring Incompatible Observables by Exploiting Sequential Weak Values Physical Review Letters 2016 10 20 117 17 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 170402 Weak Measurements, Optical tests of quantum theory, Weak Values https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.170402 EMPIR 2014: Industry American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.117.170402 NA F.Piacentini A.Avella M. P.Levi M.Gramegna G.Brida I. P.Degiovanni E.Cohen R.Lussana F.Villa A.Tosi F.Zappa M.Genovese article YoshidaWDKLSGIHTGMB2016 Reassessment of the NH4NO3thermal decomposition technique for calibration of the N2O isotopic composition Rapid Communications in Mass Spectrometry 2016 10 20 30 23 ENV52: HIGHGAS: Metrology for high-impact greenhouse gases 2487-2496 thermal decomposition, isotopic composition EMRP A169: Call 2013 Environment II Wiley-Blackwell 30 0951-4198 10.1002/rcm.7736 NA N.Yoshida R.A.Werner C.Decock T.Kuhn M.F.Lehmann P.Schleppi H.Geilmann E.Ibraim E.Harris S.Toyoda W.Gutjahr J.Mohn W.A.Brand article BillasSGBSFS2016 91 Development of a primary standard for absorbed dose from unsealed radionuclide solutions Metrologia 2016 10 19 53 6 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy 1259-1271 dosimetry, radionuclide solution, extrapolation chamber, primary standard,validation of dose calculation EMPIR 2015: Health IOP Publishing
Bristol
30 0026-1394, 1681-7575 10.1088/0026-1394/53/6/1259 NA IBillas DShipley SGaler GBass TSander AFenwick V.Smyth
article BrabanCEFBLPHTPMPVWvTNP2016 A metrological approach to improve accuracy and reliability of ammonia measurements in ambient air Measurement Science and Technology 2016 10 27 11 ENV55: MetNH3: Metrology for ammonia in ambient air 115012 ammonia in ambient air, traceability, reference gas standards, optical transfer standard, validation and testing infrastructure EMRP A169: Call 2013 Environment II IOP Publishing
Bristol, United Kingdom
30 0957-0233, 1361-6501 10.1088/0957-0233/27/11/115012 NA Christine FBraban NathanCassidy VolkerEbert ValerioFerracci DavidBalslev-Harder DaianaLeuenberger CélinePascale TuomasHieta CarloTiebe JariPeltola Nicholas AMartin StefanPersijn OlaviVaittinen KlausWirtz Jannekevan Wijk Marsailidh MTwigg BernhardNiederhauser AndreaPogány
article ReganCBABS2016 A comparison of emerging gamma detector technologies for airborne radiation monitoring Journal of Physics: Conference Series 2016 10 763 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 012010 gamma detector, airborne radiation monitoring, radiation monitoring EMRP A169: Call 2013 Environment II IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/763/1/012010 NA P HRegan S MCollins SBeeke PAitken-Smith S JBell RShearman article BecherCLB2016 Highly efficient heralded single-photon source for telecom wavelengths based on a PPLN waveguide Optics Express 2016 10 24 21 EXL02: SIQUTE: Single-photon sources for quantum technologies 23992 Nonlinear wave mixing, Photon statistics EMRP A169: Call 2012 Open excellence call The Optical Society 30 1094-4087 10.1364/OE.24.023992 NA C.Becher C.Chunnilall A.Lenhard M.Bock article DeLeoCVSMTFB2016 161 4-Nitrobenzene Grafted in Porous Silicon: Application to Optical Lithography Nanoscale Research Letters 2016 9 29 11 436 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 1-10 Porous silicon, Optical lithography, 4-Nitrobenzenediazonium, grafting, Improved chemical resistance https://nanoscalereslett.springeropen.com/articles/10.1186/s11671-016-1654-8 EMPIR 2014: Industry SpringerOpen
London
30 1556-276X 10.1186/s11671-016-1654-8 NA M.V.Tiddia G.Mula E.Sechi A.Vacca E.Cara N.De Leo M.Fretto L.Boarino
article RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016 Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network Atmospheric Chemistry and Physics 2016 9 23 16 18 ENV51: MeTra: Traceability for mercury measurements 11915-11935 Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1680-7324 10.5194/acp-16-11915-2016 NA R.Ramachandran X.Fu H.Zhang X.B.Feng D.Wip V.Obolkin N.Mashyanov F.Sena B.M.Gawlik L.M.Neves K.A.Read J.Kotnik M.Horvat H.Skov O.Magand H.Angot A.Dommergue P.E.Garcia M.D.CDiéguez C.Barbante W.Cairns J.Brito H.D.M.JBarbosa F.Morais P.Artaxo I.Wängberg J.Munthe L.Martin C.Labuschagne E.G.Brunke A.Weigelt R.Ebinghaus M.Landis V.Mannarino S.Cinnirella F.Carbone F.D'Amore M.Bencardino N.Pirrone F.Sprovieri D.Cossa J.Knoery NicolasMarusczak M.Nerentorp P.Fisicaro article Comb mode filtering silver mirror cavity for spectroscopic distance measurement Review of Scientific Instruments 2016 9 19 87 2016 SIB60: Surveying: Metrology for long distance surveying 093107 Mirrors, frequency combs, silver, Fabry-Perot interfermoters, piezoelectric transducers http://scitation.aip.org/content/aip/journal/rsi/87/9/10.1063/1.4962681 EMRP A169: Call 2012 SI Broader scope (II) AIP Publishing
Melville
30 10.1063/1.4962681 1 59 No, EURAMET is never allowed to make the publication publicly available. R.Šmíd A.Hänsel L.Pravdova O.Cip N.Bhattacharya
article LegreKKJGCBMMS2016 751 Creation of backdoors in quantum communications via laser damage Physical Review A 2016 9 15 94 3 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 030302(R) Quantum Cryptography, Quantum Communication https://link.aps.org/accepted/10.1103/PhysRevA.94.030302 EMPIR 2014: Industry American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.94.030302 NA V.Makarov J.P.Bourgoin P.Chaiwongkhot M.Gagné T.Jennewein S.Kaiser R.Kashyap M.Legré C.Minshull S.Sajeed article Color characterization of coatings with diffraction pigments Journal of the Optical Society of America A 2016 9 14 33 10 IND52: XD Reflect: Multidimensional reflectometry for industry 1978-1988 BSDF, BRDF, BTDF, Diffraction, Radiometry, Scattering measurements. https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-33-10-1978 EMRP A169: Call 2012 Metrology for Industry (II) OSA
Washington, DC, USA
30 1084-7529 (print), 1520-8532 (online) 10.1364/JOSAA.33.001978 1 No, EURAMET is never allowed to make the publication publicly available. AFerrero BBernad JCampos EPerales J LVelázquez F MMartínez-Verdú
article BennettBHWRBBRC2016 Double differential cross sections for proton induced electron emission from molecular analogues of DNA constituents for energies in the Bragg peak region The Journal of Chemical Physics 2016 9 14 145 10 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 104301 DNA, cross sections, proton impact, tetrahydrofuran, pyrimidine, trimethylphosphate, Bragg peak EMRP A169: Call 2011 SI Broader Scope AIP Publishing
2 Huntington Quadrangle, Ste 1 No 1 Suite 300, Melville 11747-4502 ,United States
30 0021-9606, 1089-7690 10.1063/1.4962171 NA DanielBennett Marion U.Bug GerhardHilgers MingjieWang BenediktRudek Woon YongBaek TiciaBuhr HansRabus ChristopheChampion
proceedings Impact of Surface Curvature on Spectral BRDF of Effect Coatings Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance 2016 9 7 N/A N/A IND52: XD Reflect: Multidimensional reflectometry for industry 295-302 BRDF, effect coatings, colour http://div2.cie.co.at/?i_ca_id=985 EMRP A169: Call 2012 Metrology for Industry (II) CIE
Vienna, Austria
Prague Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance 09-06-2016 to 09-07-2016 30 978-3-902842-59-6 1 No, EURAMET is never allowed to make the publication publicly available. CIE x043:2016 AFerrero BBernad JCampos EPerales F MMartínez-Verdú MSmid GPorrovecchio CStrothkämper
proceedings Multi-Angle Colour Characterization of Coatings with Diffraction Pigments Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance 2016 9 7 N/A N/A IND52: XD Reflect: Multidimensional reflectometry for industry 51-59 BRDF, gonio-spectrophotometry, effect coatings, diffraction http://div2.cie.co.at/?i_ca_id=985 EMRP A169: Call 2012 Metrology for Industry (II) CIE
Vienna, Austria
Prague Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance 09-06-2016 to 09-07-2016 30 978-3-902842-59-6 1 No, EURAMET is never allowed to make the publication publicly available. CIE x043:2016 AFerrero BBernad JCampos EPerales F MMartínez-Verdú
proceedings IrvineBR2016 Real-time compression of IEC 61869-9 sampled value data 2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 2016 9 1 1 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1-6 Communications, IEC 61850-9-2, IEC 61869-9, merging units, phasor measurement units, power system protection, time synchronization SEG EMRP A169: Call 2013 Energy II IEEE
445 Hoes Lane, Piscataway, NJ 08855-1331, USA
E.ON Energy Research Centre, RWTH Aachen University, Aachen, Germany IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 28-09-2016 to 30-09-2016 30 978-1-5090-2373-8 978-1-5090-2374-5 10.1109/AMPS.2016.7602854 NA JamesIrvine Steven M.Blair Andrew J.Roscoe
proceedings BlairR2016 Choice and properties of adaptive and tunable digital boxcar (moving average) filters for power systems and other signal processing applications 2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 2016 9 1 1 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1-6 Adaptive filters, Array signal processing, Finite impulse response filters, Power system measurements, Fourier transforms, Frequency measurement, Phase estimation, Power system state estimation, Power system parameter estimation EMRP A169: Call 2013 Energy II IEEE
445 Hoes Lane, Piscataway, NJ 08855-1331, USA
E.ON Energy Research Centre, RWTH Aachen University, Aachen, Germany IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 28-09-2016 to 30-09-2016 30 978-1-5090-2373-8 978-1-5090-2374-5 10.1109/AMPS.2016.7602853 NA Steven M.Blair Andrew J.Roscoe
article Investigations on the suitability of an electroacoustic sound source as a secondary sound power standard InterNoise 2016 2016 8 29 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, tonal components, secondary source, electroacoustics I-INCE Classification of Subjects Numbers: 10, 72.4 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)
Berlin
30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. H.Bietz V.Wittstock S.Brezas
article Automatic sound field sampling mechanisms to disseminate the unit watt in airborne sound InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, traceability; Calibration; Free-field over a reflecting plane (hemi-anechoic rooms)I-INCE Classification of Subjects Number(s): 72.4, 71.9 and 73.2 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)
Berlin
30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. P.Cellard H.Andersson S.Brezas V.Wittstock
article Dissemination of the unit watt in airborne sound: aerodynamic reference sound sources as transfer standards InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, dissemination, directivity, correction, substitution I-INCE Classification of Subjects Number(s): 72.4 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)
Berlin
30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S.Brezas P.Cellard H.Andersson C.Guglielmone C.Kirbas
article Primary sound power sources for the realisation of the unit watt in airborne sound InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound Power, Primary Sound Power Source, Rayleigh’s Integral http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)
Berlin
30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. C.Kirbas H.Andersson C.Guglielmone E.Bilgiç
article QuinonesANSBM2016 The Influence of Radon (Gas and Progeny) and Weather Conditions on Ambient Dose Equivalent Rate Radiation Protection Dosimetry 2016 8 13 174 3 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 1-8 radon, radon progeny, ambient dose equivalent rate, dosimetry EMRP A169: Call 2013 Environment II Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncw219 NA J.Quiñones A.Alvarez N.Navarro J. C.Saez G.Benito J. L.Márquez proceedings Convenient Graphene-Based Quantum Hall Resistance Standards Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 11 SIB51: GraphOhm: Quantum resistance metrology based on graphene Graphene, materials science and technology, measurement standards, metrology, quantum Hall effect devices http://ieeexplore.ieee.org/document/7540650/ EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540650 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Brun-Pcard R.Ribeiro-Palau F.Lafont D.Kazazis A.Michon F.Cheynis O.Couturaud C.Consejo B.Jouault W.Poirier F.Schopfer proceedings Comparison between time- and frequency-domain high-frequency device characterizations CPEM 2016, Conference on Precision Electromagnetic Measurements: conference digest: (2016) 2016 8 11 14IND02: PlanarCal: Microwave measurements for planar circuits and components high-frequency devices, vector network analyzer, electro-optic sampling http://dx.doi.org/10.1109/CPEM.2016.7540727 https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E EMPIR 2014: Industry IEEE Ottawa, Canada CPEM 2016, Conference on Precision Electromagnetic Measurements 10-15 July 2016 30 2160-0171 10.1109/CPEM.2016.7540727 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E M.Bieler U.Arz proceedings Stable arbitrary waveform generator as a transfer standard for ADC calibration 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016), Conference Digest 2016 8 11 CPEM 2016 Conference Digest 1 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 ac voltage measurement, signal synthesis, digital-to-analog converter, analog-to-digital converter, comparison, sampling, ac-dc transfer. http://ieeexplore.ieee.org/document/7540454/ EMRP A169: Call 2012 SI Broader scope (II) IEEE
New York, USA
Ottawa, Canada 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) July 10-15, 2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540454 1 No, EURAMET is never allowed to make the publication publicly available. J.Nissila J.Lee M.Sira T.Öztürk M.Arifovic J.Diaz de Aguilar R.Lapuh R.Behr
article Detector-device-independent QKD: security analysis and fast implementation Journal of Applied Physics 2016 8 9 120 6 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 063101 Copyright was too long instead of that we will ise the link. (see copyright statment below) Subject to the rights herein granted to AIP Publishing, each Copyright Owner retains ownership of copyright and all other proprietary rights such as patent rights in the Work. Each Copyright Owner retains the following nonexclusive rights to use the Work, without obtaining permission from AIP Publishing, in keeping with professional publication ethics, and provided clear credit is given to its first publication in an AIP Publishing journal. Any reuse must include a full credit line acknowledging AIP Publishing’s publication and a link to the VOR on AIP Publishing’s site. Each Copyright Owner may: 1. Reprint portions of the Work (excerpts, figures, tables) in future works created by the Author, in keeping with professional publication ethics. 2. Post the Accepted Manuscript (AM) to their personal web page or their employer’s web page immediately after acceptance by AIP Publishing. 3. Deposit the AM in an institutional or funder-designated repository immediately after acceptance by AIP Publishing. 4. Use the AM for posting within scientific collaboration networks (SCNs). For a detailed description of our policy on posting to SCNs, please see our Web Posting Guidelines (https://publishing.aip.org/authors/web-posting-guidelines). 5. Reprint the Version of Record (VOR) in print collections written by the Author, or in the Author’s thesis or dissertation. It is understood and agreed that the thesis or dissertation may be made available electronically on the university’s site or in its repository and that copies may be offered for sale on demand. 6. Reproduce copies of the VOR for courses taught by the Author or offered at the institution where the Author is employed, provided no fee is charged for access to the Work. 7. Use the VOR for internal training and noncommercial business purposes by the Author’s employer. 8. Use the VOR in oral presentations made by the Author, such as at conferences, meetings, seminars, etc., provided those receiving copies are informed that they may not further copy or distribute the Work. 9. Distribute the VOR to colleagues for noncommercial scholarly use, provided those receiving copies are informed that they may not further copy or distribute the Work. 10. Post the VOR to their personal web page or their employer’s web page 12 months after publication by AIP Publishing. 11. Deposit the VOR in an institutional or funder-designated repository 12 months after publication by AIP Publishing. 12. Update a prior posting with the VOR on a noncommercial server such as arXiv, 12 months after publication by AIP Publishing. Quantum cryptography, Polarization, Qubits, Photons, Modulators https://arxiv.org/pdf/1607.05435.pdf EMPIR 2014: Industry AIP Publishing
Melville
30 0021-8979 10.1063/1.4960093 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-8-10 AlbertoBoaron BorisKorzh RaphaelHoulmann GianlucaBoso Charles Ci WenLim AnthonyMartin HugoZbinden
article Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites International Journal of Remote Sensing 2016 8 9 37 19 ENV53: MetEOC2: Metrology for earth observation and climate 4665-4682 Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites http://www.tandfonline.com/doi/full/10.1080/01431161.2016.1220030 EMRP A169: Call 2013 Environment II Taylor and Francis
Abingdon
30 1366-5901 10.1080/01431161.2016.1220030 1 59 No, EURAMET is never allowed to make the publication publicly available. JGGorrono ABBialek PDGGreen PHHarris TSScanlon NPFFox CUUnderwood
article The calibration of a prototype occluded ear simulator designed for neonatal hearing assessment applications AIP Citation 2016 8 5 140 (2016) 2 HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound 806–813 occluded ear simulator, prototype, neonatal hearing assessment applications, Microphones, Ears, Calibration, Acoustic impedance measurement, Sound pressure http://scitation.aip.org/content/asa/journal/jasa/140/2/10.1121/1.4960517 EMRP A169: Call 2011 Metrology for Health The Journal of the Acoustical Society of America
Melville, NY
30 10.1121/1.4960517 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. R.Barham E.S.Olsen D.Rodrigues S.Barrera-Figueroa E.Sadikoğlu B.Karaböce
article SI traceable determination of the spring constant of a soft cantilever using a nanonewton force facility based on electrostatic methods Metrologia 2016 8 1 53 (2016) 4 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects 1031-1044 Nanonewton force facility Spring constant Soft cantilever Contact potential SI-traceable determination http://www.ingentaconnect.com/content/iop/met/2016/00000053/00000004/art01031 EMRP A169: Call 2011 Metrology for New Technologies IOP Publishing Ltd.
Bristol
30 0026-1394 (print) ; 1681-7575 (online) 10.1088/0026-1394/53/4/1031 1 59 No, EURAMET is never allowed to make the publication publicly available. V.Nesterov O.Belai D.Nies S.Buetefisch M.Muelelr T.Ahbe D.Neparty R.Popadic H.Wolff
article Protection Against Common Mode Currents on Cables Exposed to HIRF or NEMP IEEE Transactions on Electromagnetic Compatibility 2016 8 Submitted and accepted for publication in a future issue of this journal Not known yet IND60: EMC: Improved EMC test methods in industrial environments 1-9 Electromagnetic compatibility, electromagnetic coupling, electromagnetic fields, marine electrical equipment http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=16 EMRP A169: Call 2012 Metrology for Industry (II) IEEE
Piscataway, NJ
30 not known yet 1 59 No, EURAMET is never allowed to make the publication publicly available. B.J.A.M.van Leersum C.C.J.van der Ven J.G.Bergsma F.J.K.Buesink F.B.J.Leferink
article Characterization of a Multi-Element Clinical HIFU System Using Acoustic Holography and Nonlinear Modeling IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control 2016 8 60 8 HLT03: DUTy: Dosimetry for ultrasound therapy 1683-98 EMRP A169: Call 2011 Metrology for Health Institute of Electrical and Electronics Engineers 30 0885–3010 10.1109/TUFFC.2013.2750 1 59 No, EURAMET is never allowed to make the publication publicly available. wKrieder PYuldashev OASapoznikov NFarr APartinen MRBailey VAKhokhlova article SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016 135 A clock network for geodesy and fundamental science Nature Communications 2016 8 7 15SIB05: OFTEN: Optical frequency transfer - a European network 12443 Clock network; geodesy; https://www.nature.com/articles/ncomms12443 EMPIR 2015: SI Broader Scope Springer Nature
New York
30 2041-1723 10.1038/ncomms12443 NA C.Lisdat G.Grosche N.Quintin C.Shi S.M.F.Raupach C.Grebing D.Nicolodi F.Stefani A.Al-Masoudi S.Doerscher S.Haefner J.-L.Robyr N.Chiodo S.Bilicki E.Bookjans A.Koczwara S.Koke A.Kuhl F.Wiotte F.Meynadier E.Camisard M.Abgrall M.Lours T.Legero H.Schnatz U.Sterr H.Denker C.Chardonnet Y.Le Coq G.Santarelli A.Amy-Klein R.Le Targat J.Lodewyck OLopez P.-E.Pottie
article SvecSSRPNMLKJGFFDMAHBTTVW2016_2 60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy Applied Radiation and Isotopes 2016 8 114 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry 167-172 Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET EMRP A169: Call 2010 Industry Elsevier BV 30 0969-8043 10.1016/j.apradiso.2016.05.014 NA A.Svec J.Solc L.Silva M.Reis V.Peyres M.Nečemer H.Moser A.Luca S.Klemola A.Javornik E.García-Toraño L..Ferreux A.Fazio P.Dryák B.C.Marroyo D.Arnold M.Hult O.Burda F.Tzika Z.Tyminski B.Vodenik U.Wätjen article ShortisRKMB2016_2 Optimised multi-camera systems for dimensional control in factory environments Proceedings of the Institution of Mechanical Engineers, Part B: Journal of Engineering Manufacture 2016 8 232 10 IND53: Large Volume: Large volume metrology in industry 1707-1718 Industrial photogrammetry, camera calibration, refraction correction, manufacturing, part assembly EMRP A169: Call 2012 Metrology for Industry (II) SAGE Publications 30 0954-4054, 2041-2975 10.1177/0954405416654936 NA M.Shortis S.Robson S.Kyle L.MacDonald J.Boehm article Experimental determination of the oxygen K-shell fluorescence yield using thin SiO2 and Al2O3 foils Spectrochimica Acta Part B: Atomic Spectroscopy 2016 7 28 124 1 Oct 2016 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 94-98 fundamental parameter, fluorescence yield, oxygen, XRS http://www.sciencedirect.com/science/article/pii/S0584854716301732 EMRP A169: Call 2013 Energy II Elsevier B.V.
Amsterdam
30 0584-8547 10.1016/j.sab.2016.08.024 1 No, EURAMET is never allowed to make the publication publicly available. P.Hönicke M.Kolbe M.Krumrey R.Unterumsberger B.Beckhoff
article Conception of a mobile climate simulation chamber for the investigation of the influences of harsh shop floor conditions on in-process measurement systems in machine tools Measurement 2016 7 26 74 October 2015 IND62: TIM: Traceable in-process dimensional measurement 233-237 Traceable in-process measurement Machine tools Climate simulation Computational fluid dynamics http://www.journals.elsevier.com/measurement EMRP A169: Call 2012 Metrology for Industry (II) Elsevier
Amsterdam
30 0263-2241 10.1016/j.measurement.2015.07.010 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.sciencedirect.com/science/article/pii/S0263224115003450 DietrichBerger DanielBrabandt GiselaLanza
article WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016 Five-year records of Total Mercury Deposition flux at GMOS sites in the Northern and Southern Hemispheres Atmospheric Chemistry and Physics Discussions 2016 7 20 ENV51: MeTra: Traceability for mercury measurements 1-33 mercury, wet deposition flux, EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1680-7375 10.5194/acp-2016-517 NA I.Wängberg C.Walters M.Vardè P.Spandow V.Somerset F.Sena M.R.Islas V.Obolkin J.Munthe T.Mkololo N.Mashyanov L.Martin O.Magand C.Labuschagne J.Kotnik M.Horvat K.Hansson U.Hageström B.Gawlik P.E.Garcia X.Fu X.B.Feng R.Ebinghaus A.Dommergue M.D.C.Diéguez S.Comero W.Cairns F.Arcega-Cabrera E.G.Brunke C.Barbante H.Angot F.D'Amore M.Bencardino N.Pirrone F.Sprovieri A.Weigelt X.Yang P.Fisicaro proceedings Josephson-Based Characterization of Analog-to-Digital Converters Using an Equivalent Time Sampling Method Proceedings CPEM 2016 2016 7 18 54 12 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 Analog to Digital Converter, Josephson Voltage Standards, Sampling, Waveform http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=4126881 EMRP A169: Call 2012 SI Broader scope (II) Unknown
Unknown
Ottawa Conference on Precision Elexctromagnetic Measurements 10-07-2016 to 15-07-2016 30 0018-9456 0018-9456 10.1109/TIM.2007.891162 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Blaise JeanneretBlaise Jeanneret Fr´ed´eric OverneyFr´ed´eric Overney Christophe ScherlyChristophe Scherly G´erald SchallerG´erald Schaller
proceedings Receiver Algorithm for Decoding Constellation Modulation Advanced Photonics 2016 SPPCom 2016 7 18 2016 IND51: MORSE: Metrology for optical and RF communication systems SpTu1F.3 Coherent communications Fiber optics communications Modulation https://www.osapublishing.org/abstract.cfm?uri=SPPCom-2016-SpTu1F.3 EMRP A169: Call 2012 Metrology for Industry (II) Optical Society of America
Washington, D.C.
Vancouver, Canada Advanced Photonics 18-07-2016 30 978-1-943580-14-9 N/A 10.1364/SPPCOM.2016.SpTu1F.3 1 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S. S.Dash FPythoud BB AJosten PLeuchtmann DHillerkuss JLeuthold
proceedings BeckhoffPMHK2016 Fundamental parameter determination to improve spectroscopical methods Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on 2016 7 10 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells X-ray fluorescence, atomic fundamental parameters, fluorescence yields, optical constants, spectroscopy EMRP A169: Call 2013 Energy II IEEE Ottawa 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 10-07-2016 to 15-07-2016 30 10.1109/CPEM.2016.7540520 NA B.Beckhoff B.Pollakowski M.Muller P.Honicke M.Kolbe article Optical to microwave clock frequency ratios with a nearly continuous strontium optical lattice clock Metrologia 2016 7 8 53 4 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 1123 atomic clocks, high precision spectrocopy, frequency ratios, optical lattice clocks http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1123/meta EMRP A169: Call 2012 Open excellence call IOP Publishing
Bristol, UK
30 0026-1394 10.1088/0026-1394/53/4/1123 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. JLodewyck SBilicki EBookjans J-LRobyr CShi GVallet RLe Targat DNicolodi YLe Coq JGuéna MAbgrall PRosenbusch SBize
proceedings Characterization and Optimization of Ultrasonic Tests for Inspection of Fiber-Reinforced Plastic Composites in Energy Related Applications, 19th World Conference on Non-Destructive Testing 13-17 June 2016, Munich 19th World Conference on Non-Destructive Testing 2016 2016 7 2016 Energy Generation ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-8 http://www.ndt.net/article/wcndt2016/papers/we4d5.pdf EMRP A169: Call 2013 Energy II NDT.net
Bad Breisig, Germany
Internationales Congress Center München Messegelände, Munich, Germany 19th World Conference on Non-Destructive Testing 2016 13-06-2016 to 17-06-2016 30 978-3-940283-78-8 1435-4934 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SHHosseini DSSegur RBBoehm DGGohlke THHeckel SRRiemer DBBrackrock MGGaal
proceedings Characterisation of Artificial and Natural Defects in Fibre Reinforced Plastics Designed for Energy Applications Using Active Thermography 19th World Conference on Non-Destructive Testing 2016 2016 7 2016 Composite Materials ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-9 http://www.ndt.net/article/wcndt2016/papers/we2i4.pdf EMRP A169: Call 2010 Industry NDT.net
Bad Breisig, Germany
Internationales Congress Center München Messegelände, Munich, Germany 19th World Conference on Non-Destructive Testing 2016 13-06-2016 to 17-06-2016 30 978-3-940283-78-8 1435-4934 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CMMaierhofer RKKrankenhagen MRRöllig SRRiemer MGGower GBBaker MLLodeiro LKKnazovická ABBlahut CMMonte AAAdibekyan BGGutschwager
proceedings Design and manufacture of reference and natural defect artefacts for the evaluation of NDE techniques for fibre reinforced plastic (FRP) composites in energy applications 19th World Conference on Non-Destructive Testing 2016 2016 7 2016 Composite Materials ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-10 Infrared Testing (IRT), Ultrasonic Testing (UT), Visual and Optical Testing (VT/OT), Other Methods, delamination, validation, carbon fiber reinforced plastic (CFRP), Glass Fiber Reinforced Plastic (GFRP), tensile load, flat bottom hole http://www.ndt.net/article/wcndt2016/papers/we1e4.pdf EMRP A169: Call 2013 Energy II NDT.net
Bad Breisig, Germany
Internationales Congress Center München Messegelände, Munich, Germany 19th World Conference on Non-Destructive Testing 2016 13-06-2016 to 17-06-2016 30 978-3-940283-78-8 1435-4934 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MGGower MLLodeiro AAAktas RSShaw CMMaierhofer RKKrankenhagen SAAugustin MRRöllig LKKnazovická ABBlahut CMMonte RJJudaschke DSSegur
article vandenBromRWCB2016 Smart grid power quality and stability measurements in Europe 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 2016 7 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality instrument transformers, smart grids, metrology, phasor measurement units, synchrophasors, power quality,impedance measurement SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/CPEM.2016.7540462 NA H. E.van den Brom G.Rietveld P. S.Wright G.Crotti J. P.Braun article KielerMNBO2016 Packaging of fiber-coupled module for Josephson junction array voltage standards 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 2016 7 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements Optical fibers, Photodiodes, Silicon, Cryogenics, Bonding, Stress, Flip-chip devices EMRP A169: Call 2012 SI Broader scope (II) IEEE 30 10.1109/CPEM.2016.7540561 NA O.Kieler H.Malmbekk T.A.Tuan Nguyen E.Bardalen P.Ohlckers article PottieALB2016 133 Ultrastable optical frequency dissemination on a multi-access fibre network Applied Physics B 2016 6 25 122 7 15SIB05: OFTEN: Optical frequency transfer - a European network https://link.springer.com/article/10.1007/s00340-016-6463-3 EMPIR 2015: SI Broader Scope Springer Nature
New York
30 0946-2171, 1432-0649 10.1007/s00340-016-6463-3 NA A.Bercy O.Lopez P.E.Pottie A.Amy-Klein
article Consistency analysis of multidimensional gonio-spectrophotometric measurements in interlaboratory comparisons Metrologia 2016 6 14 53 4 IND52: XD Reflect: Multidimensional reflectometry for industry 1024-1030 BRDF, goniospectrophotometry, interlaboratory comparison http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1024/meta EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing
Bristol, UK
30 Online ISSN: 1681-7575, Print ISSN: 0026-1394 10.1088/0026-1394/53/4/1024 1 No, EURAMET is never allowed to make the publication publicly available. AFerrero JCampos BBernad APons M LHernanz F MMartínez-Verdú AHöpe
article High-performance near- and mid-infrared crystalline coatings Optica 2016 6 13 3 6 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 647 (300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings; (310.1860) Deposition and fabrication; (140.4780) Optical resonators. EMRP A169: Call 2012 Open excellence call Optical Society of America
Washington, D.C. 20036-1012 USA
30 2334-2536 10.1364/OPTICA.3.000647 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. G DCOLE WZHANG B JBJORK DFOLLMAN PHEU CDEUTSCH LSONDERHOUSE JROBINSON CFRANZ AALEXANDROVSKI MNOTCUTT O HHECKL JYE MASPELMEYER
article DauresRODB2016 Accuracy of a dose-area product compared to an absorbed dose to water at a point in a 2 cm diameter field Medical Physics 2016 6 10 43 7 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 4085-4092 small fields, dose-area product, EBT3, dosimetric references EMRP A169: Call 2011 Metrology for Health Wiley-Blackwell 30 0094-2405 10.1118/1.4953207 NA J.Daures B.Rapp A.Ostrowsky S.Dufreneix J. M.Bordy article Uncertainty propagation in computationally expensive models: A survey of sampling methods and application to scatterometry Measurement 2016 6 8 in press, corrected proof in press, corrected proof NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation - smart sampling, statistical inverse problem, scatterometry MAT http://www.sciencedirect.com/science/article/pii/S0263224116302901 EMRP A169: Call 2011 Metrology for New Technologies Elsevier
Amsterdam
30 - 10.1016/j.measurement.2016.06.009 1 59 No, EURAMET is never allowed to make the publication publicly available. SHeidenreich HGross MBär LWright
article Atomic fountains and optical clocks at SYRTE: Status and perspectives Comptes Rendus Physique 2016 6 1 16 5 SIB55: ITOC: International timescales with optical clocks 461 - 470 Atomic fountain clocks, Optical lattice clocks, Optical frequency combs, Stability of natural constants, Timekeeping http://www.sciencedirect.com/science/article/pii/S1631070515000614 EMRP A169: Call 2012 SI Broader scope (II) Elsevier
Amsterdam
30 n/a 10.1016/j.crhy.2015.03.010 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-6-1 MAbgrall BChupin LDe Sarlo JGuena PLaurent YLe Coq RLe Targat JLodewyck MLours PRosenbuch G. D.Rovera SBize
proceedings Assessing fringe projector volumetric error sources Proceedings of the 16th international conference of the european society for precision engineering and nanotechnology 2016 5 30 IND62: TIM: Traceable in-process dimensional measurement 3D optical scanner, characterisation, verification, tetrahedron EMRP A169: Call 2012 Metrology for Industry (II) Euspen
Cranfield
Nottingham 16th international conference of the european society for precision engineering and nanotechnology 30-05-2016 to 05-06-2016 30 978-0-9566790-8-6 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M RDury S BBrown M BMcCarthy S DWoodward
proceedings Maximizing the Benefit of Existing Equipment for Nonlinear and Communication Measurements N/A 2016 5 27 N/A N/A SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1-4 Nonlinear measurements, oscilloscope, sampling, analogue to digital conversion http://www.arftg.org/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE
Piscataway
San Francisco, CA, USA 87th ARFTG Microwave Measurement Conference 27-05-2016 30 978-1-5090-1308-1 N/A 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30 IEEE Catalog Number: CFP16ARF-ART D. A.Humphreys A.Raffo G.Bosi G.Vannini D.Schreurs K. N.Gebremicael K.Morris
proceedings Impact of Microwave Measurement Uncertainty on the Nonlinear Embedding Procedure N/A 2016 5 27 N/A N/A SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1-4 Microwave measurements uncertainty, microwave transistors, nonlinear embedding, power amplifiers, vector-calibrated nonlinear measurements. http://www.arftg.org/ EMRP A169: Call 2012 SI Broader scope (II) IEEE
Piscataway
San Francisco, CA, USA 87th ARFTG Microwave Measurement Conference 27-05-2016 30 978-1-5090-1308-1 N/A 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30 IEEE Catalog Number: CFP16ARF-ART G.Bosi A.Raffo G.Avolio D.Schreurs D. A.Humphreys
article Aperture alignment in autocollimator-based deflectometric profilometers REVIEW OF SCIENTIFIC INSTRUMENTS 2016 5 24 87 051906 (2016) SIB58: Angles: Angle metrology 1-9 Apertures, Calibration Charge coupled devices, Ray tracing, Optical aberrations http://aip.scitation.org/doi/10.1063/1.4950734 EMRP A169: Call 2012 SI Broader scope (II) American Institute of Physics
Melville, NY 11747-4300 USA
30 Print: 0034-6748, Online: 1089-7623 10.1063/1.4950734 1 55,59 No, EURAMET is never allowed to make the publication publicly available. R. D.Geckeler N. A.Artemiev S. K.Barber AJust I.Lacey OKranz B. V.Smith V. V.Yaschckuk
article WangBRdBBRBH2016 Cross sections for ionization of tetrahydrofuran by protons at energies between 300 and 3000 keV Physical Review A 2016 5 20 93 5 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy DNA cross sections, proton impact, tetrahydrofuran, Bragg peak EMRP A169: Call 2011 SI Broader Scope American Physical Society (APS)
1 Research Road,Ridge, NY 11961-2701, (631) 591-4000, United States
30 2469-9926, 2469-9934 10.1103/PhysRevA.93.052711 NA MingjieWang DanielBennett BenediktRudek Pablode Vera MarionBug TiciaBuhr HansRabus Woon YongBaek GerhardHilgers
article Nonequilibrium thermodynamics of the spin Seebeck and spin Peltier effects Physical Review B 2016 5 18 93 184421 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems 184421-1-11 spincaloritronics, Spin-Seebeck, Spin-Peltier http://journals.aps.org/prb/abstract/10.1103/PhysRevB.93.184421 EMRP A169: Call 2012 Open excellence call American Physical Society
College Park, MD
30 2469-9969 (online), 2469-9950 (print) 10.1103/PhysRevB.93.184421 1 59 No, EURAMET is never allowed to make the publication publicly available. V.Basso E.Ferraro A.Magni A.Sola M.Kuepferling M.Pasquale
proceedings Characterization of high-frequency interconnects: Comparison between time- and frequency-domain methods 2016 IEEE 20th Workshop on Signal and Power Integrity (SPI) Conference Proceedings 2016 5 12 N/A N/A 14IND02: PlanarCal: Microwave measurements for planar circuits and components 1-4 coplanar waveguides, frequency-domain analysis, microwave measurement, time-domain analysis http://dx.doi.org/10.1109/SaPIW.2016.7496271 EMPIR 2014: Industry IEEE Torino, Italy 2016 IEEE 20th Workshop on Signal and Power Integrity 08-05-2016 to 11-05-2016 30 978-1-5090-0349-5 10.7795/EMPIR.14IND02.CA.20190403D 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M.Bieler U.Arz article ZappaTVLLAPGBDG2016 232 Experiment Investigating the Connection between Weak Values and Contextuality Physical Review Letters 2016 5 116 18 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 180401 Quantum Foundations, Quantum Nonlocality, Weak Values, Weak Measurements EMPIR 2014: Industry American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.116.180401 NA F.Piacentini A.Avella M. P.Levi R.Lussana F.Villa A.Tosi F.Zappa M.Gramegna G.Brida I. P.Degiovanni M.Genovese article ProfrockGBBNGEPGSG2016 Potential reference measurement procedures for PBDE in surface water at levels required by the EU Water Frame Directive Talanta 2016 5 152 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 251-258 IDMS, Method Validation, PBDE, Water, Water Framework Directive EMRP A169: Call 2010 Environment Elsevier BV 30 0039-9140 10.1016/j.talanta.2016.01.066 NA D.Pröfrock A.González-Gago B.Binici M.Bílsel M.Nousiainen H.Goenaga-Infante J.Entwisle P.Petrov F.Gantois C.Swart A.C.Goren proceedings High-accuracy absolute distance measurement with a mode-resolved optical frequency comb Proceedings of SPIE 2016 4 29 9899 SIB60: Surveying: Metrology for long distance surveying 989906 Distance measurement, frequency combs, homodyne detection, intererometry EMRP A169: Call 2012 SI Broader scope (II) SPIE
Bellingham
Brussels, Belgium SPIE Photonics Europe 2016, Optical Sensing and Detection IV 04-04-2016 to 07-04-2016 30 1996-756X 10.1117/12.2227360 59 No, EURAMET is never allowed to make the publication publicly available. D.Voigt S.A.van den Berg A.Lešundák S.van Eldik N.Bhattacharya
article Towards joint reconstruction of noise and losses in quantum channels Quantum Measurements and Quantum Metrology 2016 4 21 3 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 27–31 Quantum Communication, Quantum Metrology, Calibration https://www.degruyter.com/view/j/qmetro EMPIR 2014: Industry DE GRUYTER OPEN
Warsaw (Poland)
30 2299-114X 10.1515/qmetro-2016-0005 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. https://www.degruyter.com/downloadpdf/j/qmetro.2016.3.issue-1/qmetro-2016-0005/qmetro-2016-0005.pdf F.Piacentini A.Avella P.Traina L.Lolli E.Taralli E.Monticone M.Rajteri D.Fukuda I. P.Degiovanni G.Brida
article DesogusMGPB2016 Design and metrological evaluation of the new 5 MN hexapod-shaped multicomponent build-up system Metrologia 2016 4 15 53 3 SIB63: Force: Force traceability within the meganewton range 956-964 hexapod, load simulation, build-up system, force transducer, uncertainty budget EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing 30 0026-1394, 1681-7575 10.1088/0026-1394/53/3/956 NA S.Desogus F.Mazzoleni A.Germak S.Palumbo G.Barbato article Absolute calibration of an EMCCD camera by quantum correlation, linking photon counting to the analog regime Optics Letters 2016 4 14 41 8 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 1841-1844 CCD, charge-coupled device; Quantum detectors; Calibration. https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-8-1841 EMPIR 2014: Industry OSA Publishing
Washington, D.C. 20036-1012 USA
30 0146-9592/16/081841-04 10.1364/OL.41.001841 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-14 A.Avella I.Ruo-Berchera I. P.Degiovanni G.Brida M.Genovese
article Inertial quantum sensors using light and matter Physica Scripta 2016 4 13 91 5 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 053006 quantum sensors, atom interferometry, cold atoms http://iopscience.iop.org/article/10.1088/0031-8949/91/5/053006/meta EMRP A169: Call 2012 Open excellence call IOP Publishing
Bristol, UK
30 0031-8949 10.1088/0031-8949/91/5/053006 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BBarrett ABertoldi PBouyer
article Diffusion-induced grain boundary migration as mechanism for grain growth and defect annihilation in chalcopyrite thin films Acta Materialia 2016 4 10 111 - ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 377-384 X-ray diffraction, Physical vapor deposition (PVD), Stacking faults, Grain boundary migration, CuInSe2 EMRP A169: Call 2013 Energy II Elsevier Ltd.
Amsterdam
30 1359-6454 10.1016/j.actamat.2016.03.073 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. H.Stange S.Brunken D.Greiner M. D.Heinemann C. A.Kaufmann S. S.Schmidt J.-P.Bäcker M.Klaus C.Genzel R.Mainz
proceedings JRP SIB60 “Metrology for Long Distance Surveying”-a concise survey on major project results Proceedings of the third Joint International Symposium on Deformation Monitoring 2016 4 SIB60: Surveying: Metrology for long distance surveying Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf EMRP A169: Call 2012 SI Broader scope (II) Vienna, Austria Joint International Symposium on Deformation Monitoring March 30-April 1, 2016 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Pollinger A.Bauch J.Leute K.Meiners-Hagen J.Mildner J.Guillory J.-P.Wallerand J.Jokela U.Kallio H.Koivula S.Lahtinen M.Poutanen M.Astrua C.Francese M.Zucco L.Eusebio F.Marques C.Pires F.Saraiva O.Pelligrino T.Tomberg T.Hieta T.Fordell M.Merimaa V.Kupko P.Neyezhmakov S.Bergstrand S.A.van den Berg T.Kersten T.Krawinkel proceedings SI-Traceable High-Accuracy EDM based on Multi-Wavelength Interferometry Proceedings of the third Joint International Symposium on Deformation Monitoring 2016 4 SIB60: Surveying: Metrology for long distance surveying Submission 15 EDM, multi-wavelength interferometry, index of refraction, EMRP JRP SIB60 Surveying http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf EMRP A169: Call 2012 SI Broader scope (II) Vienna, Austria Joint International Symposium on Deformation Monitoring 30-03-2016 to 01-04-2016 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf F.Pollinger J.Mildner P.Köchert R.Yang A.Bosnjakovic T.Meyer M.Wedde K.Meiners-Hagen article Potential of GPS Common Clock Single-differences for Deformation Monitoring Journal of Applied Geodesy 2016 3 31 10 1 SIB60: Surveying: Metrology for long distance surveying pages 45.52 GPS; Monitoring; Clock Modeling; Common Clock; EMRP JRP SIB60 https://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/reviewed/JISDM_2016_submission_101.pdf EMRP A169: Call 2012 SI Broader scope (II) De Gruyter 30 (Online) 1862-9024, (Print) 1862-9016 10.1515/jag-2015-0029 1 59 No, EURAMET is never allowed to make the publication publicly available. S.Schön H.K.Pham T.Kersten J.Leute A.Bauch article Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points Philosophical Transactions of the Royal Society A 2016 3 28 374 2064 SIB01: InK: Implementing the new kelvin 20150044 high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics http://rsta.royalsocietypublishing.org/content/374/2064/20150044 EMRP A169: Call 2011 SI Broader Scope The Royal Society
London
30 10.1098/rsta.2015.0044 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.RWooliams KAnhalt MBallico PBloembergen FBourson SBriaudeau JCampos M.GCox Ddel Campo WDong M.RDury VGavrilov IGrigoryeva M.LHernanz FJahan BKhlevnoy VKhromchenko D.HLowe XLu GMachin J.MMantilla M.JMartin H.CMcEvoy BRougie MSaldi S.G.RSalim NSasajima D.RTaubert A.D.WTodd RVan den Bossche
article DABAM: an open-source database of x-ray mirrors metrology Journal of Synchrotron Radiation 2016 3 24 23 23 SIB58: Angles: Angle metrology 665-678 X-ray mirror; metrology; database; Python; statistics. http://scripts.iucr.org/cgi-bin/paper?S1600577516005014 EMRP A169: Call 2012 SI Broader scope (II) IUCr Journals
Chester CH1 2HU, England
30 1600-5775 10.1107/S1600577516005014 1 59,80 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MSanchez del Rio DBianchi DCocco MGlass MIdir JMetz LRaimondi LRebuffi RReininger XShi FSiewert SSpielmann-Jaeggi PTakacs MTomasset TTonnessen ATonnessenivo VVYashchuk
proceedings Approaching the Shannon Limit Through Constellation Modulation Optical Fiber Communication Conference 2016 3 20 N/A 2016 IND51: MORSE: Metrology for optical and RF communication systems Th2A.46 Coherent communications Fiber optics communications Modulation https://www.osapublishing.org/abstract.cfm?uri=OFC-2016-Th2A.46 EMRP A169: Call 2012 Metrology for Industry (II) Optical Society of America
Washington, D.C.
Anaheim, California Optical Fiber Communication Conference 20-03-2016 30 978-1-943580-07-1 N/A 10.1364/OFC.2016.Th2A.46 1 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S. S.Dash FPythoud BBaeuerle AJosten DHillerkuss PLeuchtmann JLeuthold
article What are the correct L-subshell photoionization cross sections for quantitative X-ray spectroscopy? X-ray Spectrometry 2016 3 16 45 4 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 207–211 photoionization cross sections, xrs, fundamental parameters http://onlinelibrary.wiley.com/doi/10.1002/xrs.2691/full EMRP A169: Call 2013 Energy II John Wiley & Sons, Ltd 30 1097-4539 10.1002/xrs.2691 1 No, EURAMET is never allowed to make the publication publicly available. PHönicke MKolbe BBeckhoff article Preparation and characterisation of an 57Fe enriched haemoglobin spike material for speciesspecific isotope dilution mass spectrometry Journal of Analytical Atomic Spectrometry 2016 3 10 31 9 HLT05: Metallomics: Metrology for metalloproteins 1846 - 1857 isotope dilution mass spectrometry (IDMS), MonoQ® ion exchange chromatography, size exclusion column (SEC),high-performance liquid chromatography (HPLC) system http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00028B#!divAbstract EMRP A169: Call 2011 Metrology for Health Royal Society of Chemistry
London
30 0267-9477 (print) ; 1364-5544 (online) 10.1039/c6ja00028b 1 No, EURAMET is never allowed to make the publication publicly available. C.Brauckmann C.Frank D.Schulze P.Kaiser R.Stosch C.Swart
article PacynaHJDCBBBPHBGEPF2016 Importance of Integration and Implementation of Emerging and Future Mercury Research into the Minamata Convention Environmental Science & Technology 2016 3 50 6 ENV51: MeTra: Traceability for mercury measurements 2767-2770 Mercury, Minamata Convention, EMRP A169: Call 2013 Environment II American Chemical Society (ACS) 30 0013-936X, 1520-5851 10.1021/acs.est.6b00573 NA J.Pacyna M.Horvat D.Jaffe C.T.Driscoll C.Chen P.Bustamante J.Blum N.Basu A.Pierce C.R.Hammerschmidt M.S.Bank M.S.Gustin D.C.Evers N.Pirrone P.Fisicaro article Detection of Rare Drug Resistance Mutations by Digital PCR in a Human Influenza A Virus Model System and Clinical Samples Journal Of Clinical Microbiology 2016 2 28 54 2 HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms 392-400. Digital PCR, dPCR, Droplet, Influenza, Antimicrobial Resistance, AMR, Rare, Mutation, Trace, qPCR, Quantitative PCR, SNP, Single Nucleotide Polymorphism, H275Y, Oseltamivir, Tamiflu http://jcm.asm.org/content/54/2/392.long EMRP A169: Call 2011 Metrology for Health American Society for Microbiology
Washington DC
30 0095-1137 10.1128/JCM.02611-15 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A. S.Whale C.Bushell P.R.Grant S.Cowen I.Gutierrez-Aguirre D. M.O'Sullivan J.Zel M.Milavec C. A.Foy E.Nastouli J. A.Garson H. F.Huggett
article Dissemination of thermodynamic temperature above the freezing point of silver Philosophical Transactions of the Royal Society A 2016 2 22 374 2064 SIB01: InK: Implementing the new kelvin 20150043 high-temperature fixed points, thermodynamic temperature, filter radiometer, radiation thermometer http://rsta.royalsocietypublishing.org/content/374/2064/20150043 EMRP A169: Call 2011 SI Broader Scope The Royal Society
London
30 10.1098/rsta.2015.0043 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MSadli GMachin KAnhalt FBourson SBiraudeau Ddel Campo ADiril OKozlova D.HLowe J.MMantilla Amor M.JMartin H.CMcEvoy MOjanen-Saloranta ÖPehlivan BRougié S.G.RSalim
article Traceable quantitative Raman spectrometry and x-ray fluorescence analysis as non-destructive methods for spatially resolved chemical characterization of Cu(In,Ga)Se2 absorber films Applied Spectroscopy 2016 2 70 2 IND07: Thin Films: Metrology for the manufacturing of thin films 279-288 Calibration, Cu(In; Ga)Se2, International System of Units, Measurement uncertainty, Raman mapping, Raman spectrometry, SI, Solar cell, Traceability, X-ray spectrometry http://www.ncbi.nlm.nih.gov/pubmed/26903563 EMRP A169: Call 2010 Industry SAGE Publications  30 0003-7028 10.1177/0003702815620131. 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-1 SZZakel BPPollakowski CSStreeck SWWundrack AWWeber SBBrunken RMMainz BBBeckhoff RSStosch article PoletaeffBPOKZA2016 Improvement of LISN Measurement Accuracy Based on Calculable Adapters IEEE Transactions on Instrumentation and Measurement 2016 2 65 2 IND60: EMC: Improved EMC test methods in industrial environments 365-377 Improvement of LISN Measurement Accuracy Based on Calculable Adapters EMRP A169: Call 2012 Metrology for Industry (II) Institute of Electrical and Electronics Engineers (IEEE)
445 Hoes Lane, Piscataway, NJ 08855-1331, USA
30 0018-9456, 1557-9662 10.1109/TIM.2015.2479107 NA AndréPoletaeff DenisBélières BorutPinter MohamedOuameur MihaKokalj FrancoisZiade DjamelAllal
article MonteyneVPRFEBE2016 Preparation and evaluation of sufficiently homogeneous and stable reference materials for priority hazardous substances in whole water Accreditation and Quality Assurance 2016 2 21 2 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 113-120 Homogeneity, Stability, Uncertainty, Whole water, Reference materials, PAHs, PBDEs, TBT, Water Framework Directive EMRP A169: Call 2010 Environment Springer Nature 30 0949-1775, 1432-0517 10.1007/s00769-015-1189-1 NA E.Monteyne G.Vanermen R.Philipp J.Richter I.Fettig S.Elordui-Zapatarietxe G.Boom H.Emteborg article A folded‑sandwich polarization‑entangled two‑color photon pair source with large tuning capability for applications in hybrid quantum systems Applied Physics B 2016 1 30 122 February 2016 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 33 Entangled Photons Source, Quantum Hybrid Systems https://link.springer.com/article/10.1007/s00340-015-6275-x http://link.springer.com/journal/340 EMPIR 2014: Industry Springer-Verlag
Berlin Heidelberg
30 1432-0649 10.1007/s00340-015-6275-x 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. O.Dietz C.Müller T.Kreißl U.Herzog T.Kroh A.Ahlrichs O.Benson
article SawalNPGZRBTGSGACFEERBP2016 An interlaboratory comparison on whole water samples Accreditation and Quality Assurance 2016 1 29 21 2 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 121-129 Water Framework Directive, Interlaboratory comparison, Whole water sample, Suspended particulate matter, Polycyclic aromatic hydrocarbons, Polybrominated diphenyl ethers, Tributlyltin EMRP A169: Call 2010 Environment Springer Nature 30 0949-1775, 1432-0517 10.1007/s00769-015-1190-8 NA G.Sawal M.Nousiainen D.Pröfrock A.G.Gago T.Zuliani A.Rodríguez-Cea B.Binici M.Tunç T.Gokcen C.Swart F.Gantois E.Alasonati J.Cabillic I.Fettig H.Emteborg S.Elordui-Zapatarietxe J.Richter M.Buzoianu R.Philipp article First measurements of nitrous oxide self-broadening and self-shift coefficients in the 0002-0000 band at 2.26 μm using high resolution Fourier transform spectroscopy Journal of Molecular Spectroscopy 2016 1 23 323 Atmospheric Spectroscopy ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 28-42 Nitrous oxide, Fourier transform infrared spectroscopy, Line parameters; Self-broadening, Self-shift, Gas metrology http://www.sciencedirect.com/science/article/pii/S002228521630011X EMRP A169: Call 2010 Environment Elsevier B. V.
Kidlington (Oxford)
30 0022-2852 10.1016/j.jms.2016.01.010 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.sciencedirect.com/science/article/pii/S002228521630011X ViktorWerwein JensBrunzendorf AntonSerdyukov OlavWerhahn VolkerEbert
proceedings MonteBKALBGRRKMAG2016 Characterisation of artificial defects in CFRP and GFRP sheets designed for energy applications using active thermography Proceedings of the 2016 International Conference on Quantitative InfraRed Thermography 2016 1 16 ENG57: VITCEA: Validated inspection techniques for composites in energy applications Characterisation artificial defects CFRP and GFRP active thermography EMRP A169: Call 2013 Energy II QIRT Council
1065 ave. de la Medecine Quebec City Quebec G1V 0A6 Canada
Gdansk QIRT 16 04-07-2016 to 08-07-2016 30 10.21611/qirt.2016.076 NA C.Monte A.Blahut L.Knazovicka A.Aktas M.Lodeiro G.Baker M.Gower B.Rehmer M.Röllig R.Krankenhagen C.Maierhofer A.Adibekyan B.Gutschwager
article A fiber-coupled quantum-dot on a photonic tip APPLIED PHYSICS LETTERS 2016 1 8 108 1 EXL02: SIQUTE: Single-photon sources for quantum technologies 011112-5 quantum-dot, fiber-coupling http://scitation.aip.org/content/aip/journal/apl EMRP A169: Call 2012 Open excellence call AIP Publishing LLC
Melville, NY
30 0003-6951 10.1063/1.4939264 1 59 No, EURAMET is never allowed to make the publication publicly available. D.Cadeddu J.Teissier F.Braakman N.Gregersen P.Stepanov J.M.Gérard J.Claudon R. J.Warburton M.Poggio M.Munsch
article Alignment-free characterization of 2D gratings Applied Optics 2016 1 7 55 2 14IND09: MetHPM: Metrology for highly-parallel manufacturing 317-322 https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-2-317 EMPIR 2014: Industry OSA Publishing
Washington
30 10.1364/AO.55.000317 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-1-7 https://arxiv.org/ftp/arxiv/papers/1509/1509.07623.pdf M.HMadsen PBoher P.EHansen J.FJørgensen
article Electron beam controlled covalent attachment of small organic molecules to graphene Nanoscale 2016 1 4 8 SIB51: GraphOhm: Quantum resistance metrology based on graphene 2711-2719 graphene, polyaromatic molecules, measurement http://pubs.rsc.org/en/content/articlehtml/2016/nr/c5nr07539d EMRP A169: Call 2012 SI Broader scope (II) The Royal Society of Chemistry 30 10.1039/C5NR07539D 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Markevich S.Kurasch O.Lehtinen O.Reimer X.Feng K.Müllen A.Turchanin A. N.Khlobystov U.Kaiser E.Besley article Calibrated detectors for broad-band terahertz power measurements Laser+PHOTONICS 2016 1 1 11 Trade Journal (international issue of the German magazine PHOTONIK) NEW07: THz Security: Microwave and terahertz metrology for homeland security 2 Terahertz, THz power, THz detector http://www.photonik.de/calibrated-detectors-for-broad-band-terahertz-power-measurements/150/21404/320987 EMRP A169: Call 2011 Metrology for New Technologies AT-Fachverlag GmbH
Fellbach
30 1865-6633 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. W.Bohmeyer K.Lange R.Müller A.Steiger
proceedings A mercury optical lattice clock at LNE-SYRTE Journal of Physics: Conference Series 2016 1 1 723 n/a SIB55: ITOC: International timescales with optical clocks 012017 optical lattice clock http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012017/meta EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing
Bristol
Potsdam, Germany 8th Symposium on Frequency Standards and Metrology 12 - 16 October 2015 30 n/a n/a 10.1088/1742-6596/723/1/012017 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. LDe Sarlo MFavier RTyumenev SBize
article vanderVeenBA2016 Suitability of different containers for the sampling and storage of biogas and biomethane for the determination of the trace-level impurities – A review Analytica Chimica Acta 2016 1 902 ENG54: Biogas: Metrology for biogas 22-32 Sampling; Containers; Suitability; Biogas; Biomethane; Impurities; VOCs; Siloxanes EnG https://www.ncbi.nlm.nih.gov/pubmed/26703250 EMRP A169: Call 2013 Energy II Elsevier BV
New York
30 0003-2670 10.1016/j.aca.2015.10.039 NA A.M.H.van der Veen A.S.Brown K.Arrhenius
article DenoziereJPPPPGBR2016 First international comparison of primary absorbed dose to water standards in the medium-energy X-ray range Metrologia 2016 1 53 1A HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 06007-06007 absorbed dose to water, medium energy x ray, comparison EMRP A169: Call 2011 Metrology for Health IOP Publishing 30 0026-1394, 1681-7575 10.1088/0026-1394/53/1A/06007 NA M.Denoziere BJansen L.dPrez J.d.Pooter M.Pinto M.Pimpinella A.S.Guerra L.Büermann B.Rapp techreport TerauchiKSBWWADGAAHUWSJKKFSBSS2016 415 Final report of CCQM-K129 'Measurement of Mole Fractions of Cu, In, Ga and Se in Cu(In,Ga)Se2 Films Metrologia 2016 1 53 1A 14SIP05: TF-STANDARD: Developing a Standard for Valid Methodology for the Characterisation of Functional Alloy Thin Films 08011-08011 CIGS, Cu(In,Ga)Se2, mole fractions, key comparison CCQM-K129 http://iopscience.iop.org/article/10.1088/0026-1394/53/1A/08011
https://www.bipm.org/utils/common/pdf/final_reports/QM/K129/CCQM-K129.pdf EMPIR 2014: Support for Impact IOP Publishing 30 0026-1394, 1681-7575 10.1088/0026-1394/53/1A/08011 NA A.S.Kim K.J.Kim J.S.Jang J.K.Suh T.Wirth W.Unger V.D.Hodoroaba J.R.Araujo B.S.Archanjo C.E.Galhardo J.Damasceno C.A.Achete H.Wang M.Wang J.Bennett D.Simon A.Kurokawa S.Terauchi T.Fujimoto C.Streeck B.Beckhoff S.Spencer A.Shard article Quantum and Classical Characterization of Single/Few Photon Detectors Quantum Matter 2016 4 3 IND06: MIQC: Metrology for Industrial Quantum Communications 1-13 Quantum Tomography, Quantum Information, Single Photon Detectors, POVM http://www.aspbs.com/qm.html EMRP A169: Call 2010 Industry 30 2164-7615 59 No, EURAMET is never allowed to make the publication publicly available. M. G.Mingolla F.Piacentini A.Avella M.Gramegna L.Lolli A.Meda I.Ruo Berchera E.Taralli P.Traina M.Rajteri G.Brida I. P.Degiovanni M.Genovese article The minimum number of measurements for colour, sparkle, and graininess characterisation in gonio-apparent panels Coloration Technology 2016 131 4 IND52: XD Reflect: Multidimensional reflectometry for industry 303-309 gonio-apparent colours, sparkle, graininess, measurements http://onlinelibrary.wiley.com/doi/10.1111/cote.12157/citedby EMRP A169: Call 2012 Metrology for Industry (II) Society of Dyers and Colourists. John Wiley & Sons
New York
30 1478-4408 10.1111/cote.12157 1 59 No, EURAMET is never allowed to make the publication publicly available. E.Chorro E.Perales F.J.Burgos O.Gómez M.Vilaseca J.Pujol F.M.Martínez-Verdú
article New Avogadro spheres for the redefinition of the kilogram Key Engineering Materials 2016 617 1 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies 11-16 Measurement, SI unit, precision sphere, interferometry, manufacturing http://www.scientific.net/KEM/ EMRP A169: Call 2011 SI Broader Scope Trans Tech Publications Inc.
CH-8808 Pfaffikon
30 ISSN: 1662-9795 10.4028/www.scientific.net/KEM.613.17 1 59 No, EURAMET is never allowed to make the publication publicly available. http://www.scientific.net/KEM/details A.Nicolaus R.Meeß G.Bartl
article Time-Domain Optoelectronic Vector Network Analysis on Coplanar Waveguides IEEE Transactions on Microwave Theory and Techniques 2016 63 11 IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications 3775-3784 Ultrashort voltage pulses, electro-optic sampling, vector network analysis, time-domain reflectometry EMRP A169: Call 2010 Industry IEEE 30 0018-9480 10.1109/TMTT.2015.2481426 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MarkBieler HeikoFüser KlausPierz proceedings Measurement of goniofluorescence in photoluminiscent materials CIE Proceeding 2016 IND52: XD Reflect: Multidimensional reflectometry for industry Goniofluorescence, fluorescence, photoluminescence, spectrophotometry EMRP A169: Call 2012 Metrology for Industry (II) International Comission on Illumination
Serrano 144
Manchester/UK 28th Session CIE June 28 - July 4, 2015 30 59 No, EURAMET is never allowed to make the publication publicly available. AFerrero BBernad J LVelazquez APons M LHernanz PJaanson F MMartinez-Verdu EChorro EPerales JCampos
proceedings MEASURING SPARKLE OF EFFECT COATINGS CIE Proceeding 2016 IND52: XD Reflect: Multidimensional reflectometry for industry Sparkle, Glint, Glitter, Effect coatings, Spectrophotometry, Texture EMRP A169: Call 2012 Metrology for Industry (II) International Comission on Illumination
Serrano 144
Manchester/UK 28th Session CIE June 28 - July 4, 2015 30 59 No, EURAMET is never allowed to make the publication publicly available. AFerrero SBayon AlejandroFerrero
article Comparison of Two Potassium-Filled Gas-Controlled Heat Pipes International Journal of Thermophysics 2016 36 12 SIB10: NOTED: Novel techniques for traceable temperature dissemination 3393 Gas-controlled heat pipe · Pressure control · Thermocouple calibration · Thermometer calibration http://link.springer.com/article/10.1007%2Fs10765-015-2002-4 EMRP A169: Call 2011 SI Broader Scope Springer
Torino
30 0195-928X 10.1007/s10765-015-2002-4 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 FBertiglia LIacomini FMoro AMerlone
proceedings The calibration of static and dynamic performances of PMUs Proceedings of the International Congress of Metrology 2016 17 n/a ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality n/a Phasor measurement units, http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_12002.pdf EMRP A169: Call 2013 Energy II EDP Sciences
London
Paris 17th International Congress of Metrology 21-09-2015 to 24-09-2015 30 n/a n/a 10.1051/metrology/201512002 1 59 Yes, the publication is open access and EURAMET is permitted to upload an