% 
% This file was created by the TYPO3 extension
% bib
% --- Timezone: CET
% Creation date: 2020-02-25
% Creation time: 12-15-11
% --- Number of references
% 3171
% 

@Techreport { EbertWQ2020_2,
   subid = {1411},
   title = {Towards a TDLAS based optical gas standard for the absolute HCl measurements in flue gases from combustion process},
   journal = {HostingInstitution: Physikalisch-Technische Bundesanstalt (PTB)},
   year = {2020},
   month = {4},
   number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions},
   keywords = {We present our new dTDLAS based HCl spectrometer, specially designed and optimized to measure traceable HCl concentration in different matrices (high temperature, high water vapor and CO2 contents) motivated by large-scale power stations or biomass burning domestic boilers. This system is designed to serve as an optical gas standard (OGS) and thus as a traceable transfer standard to directly quantify HCl emissions or calibrate HCl sensors or dynamically generated gas standards in the field. It employs a mid-infrared interband cascade laser (ICL) and is targeting the HCl transition lines in the fundamental band to achieve less 1 ppm (at 1 meter) sensitivity and meet the compatibility goal set by lowered HCl ELVs in the European legislation such as the Industrial Emissions Directive (IED).},
   web_url = {https://oar.ptb.de/resources/show/10.7795/810.20191105},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Physikalisch-Technische Bundesanstalt},
   language = {30},
   ISSN = {ISNI: 0000 0001 2186 1887},
   DOI = {10.7795/810.20191105},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ebert, V. and Werhahn, O. and Qu, Z.}
}

@Article { SalmiCVWVYKHS2020,
   subid = {1354},
   title = {AlOx surface passivation of black silicon by spatial ALD: Stability under light soaking and damp heat exposure},
   journal = {Journal of Vacuum Science \& Technology A},
   year = {2020},
   month = {3},
   volume = {38},
   number = {2},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {022401},
   keywords = {Spatial Atomic Layer Deposition, aluminum oxide, surface passivation, light soaking, damp heat},
   misc2 = {EMPIR 2016: Energy},
   publisher = {American Vacuum Society},
   language = {30},
   ISSN = {0734-2101, 1520-8559},
   DOI = {10.1116/1.5133896},
   stag_bib_extends_levelofaccess = {NA},
   author = {Salmi, E. and Castro, F.A. and V{\"a}h{\"a}nissi, V. and Wood, S. and Virtanen, S. and Yli-Koski, M. and Koutsourakis, G.  and Heikkinen, I.T.S. and Savin, H.}
}

@Article { WallerandTG2020,
   subid = {1424},
   title = {Assessment of the mechanical errors of a prototype of an optical multilateration system},
   journal = {Review of Scientific Instruments},
   year = {2020},
   month = {2},
   day = {18},
   volume = {91},
   number = {2},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   pages = {025004},
   keywords = {-},
   web_url = {https://aip.scitation.org/doi/figure/10.1063/1.5132933},
   misc2 = {EMPIR 2017: Industry},
   publisher = {AIP Publishing},
   address = {1305 Walt Whitman Road Suite 300 Suite 300 Melville NY 11747 United States},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {https://dx.doi.org/10.1063/1.5132933},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wallerand, J.-P. and Truong, D. and Guillory, J.}
}

@Article { BeyerKP2020,
   subid = {1356},
   title = {An unfolding algorithm for high resolution microcalorimetric beta spectrometry},
   journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment},
   year = {2020},
   month = {2},
   volume = {953},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {163128},
   keywords = {Beta spectrometry, Unfolding, Deconvolution, Microcalorimeter, Monte Carlo Simulation, Bremsstrahlung},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0168-9002},
   DOI = {10.1016/j.nima.2019.163128},
   stag_bib_extends_levelofaccess = {NA},
   author = {Beyer, J. and Kossert, K. and Paulsen, M.}
}

@Techreport { EBERTWQ2020_3,
   subid = {1410},
   title = {Mid-IR ICL based TDLAS spectrometer dedicated to monitor HCl concentration in combustion emissions},
   journal = {HostingInstitution: Physikalisch-Technische Bundesanstalt (PTB)},
   year = {2020},
   month = {2},
   number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions},
   pages = {1-5},
   keywords = {direct tunable diode laser absorption spectroscopy (dTDLAS), approach targeting accurate HCl measurements in different matrices motivated by combustion emissions,  large-scale power stations, biomass burning domestic boilers, Mid-IR interband cascade laser (ICL), absolute HCl concentrations,hot gas plumes},
   web_url = {https://oar.ptb.de/resources/show/10.7795/810.20191119A},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Physikalisch-Technische Bundesanstalt},
   language = {30},
   ISSN = {ISNI: 0000 0001 2186 1887},
   DOI = {10.7795/810.20191119A},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ebert, V. and Werhahn, O. and Qu, Z.}
}

@Techreport { EbertWQ2020_4,
   subid = {1412},
   title = {The spatial heterogeneity effects on dTDLAS-based CO sensor for industrial emission monitoring applications},
   journal = {HostingInstitution: Physikalisch-Technische Bundesanstalt (PTB)},
   year = {2020},
   month = {2},
   number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions},
   keywords = {Accurate measurement of emissions to the atmosphere is vital to control and reduce air pollution. Industry needs to measure and report emissions for regulatory purposes including assessing stack emissions against concentration limit values. IMPRESS 1 and IMPRESS 2 projects [1] go beyond state of the art in measuring the emissions of critical pollutants with lower emission limit values, requiring detection limits and uncertainties unachievable with current Standard Reference Methods, enabling traceability and directly traceable measurements. Laser-based optical gas sensors provide powerful tools for industrial emission monitoring.Tunable diode laser absorption spectroscopy (TDLAS) is frequently used in science and industry for online and in situ gas analysis. We present our direct TDLAS (dTDLAS) method for absolute gas concentration measurement [2]. Note that the TDLAS is one of the line-of-sight (LOS) absorption spectroscopy techniques, and its application is normally limited to uniform conditions with constant or negligible temperature and/or concentration gradients along the LOS. However, in many applications, for example, combustion diagnostic and cross-stack emission measurements, temperature and concentration gradients along the LOS may occur. In those scenarios, special care should be taken to spectral fitting, line width and concentration quantification [3].This contribution covers a 4.6 \(\mu\)m EC-QCL based TDLAS CO spectrometer. The two gas cells configuration enables to investigate the heterogeneity effects on dTDLAS applications. The CO concentration and line width were measured under different heterogeneous conditions and compared to those under uniform settings. Currently the dTDLAS method is implemented for HCl measurements as a principle technique for cross-stack emission control.The research was supported by IMPRESS2 within EMPIR. The EMPIR initiative is co-funded by the European Union’s Horizon 2020 research and innovation programme and the EMPIR Participating States.},
   web_url = {https://oar.ptb.de/resources/show/10.7795/810.20200114},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Physikalisch-Technische Bundesanstalt},
   language = {30},
   ISSN = {ISNI: 0000 0001 2186 1887},
   DOI = {10.7795/810.20200114},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ebert, V. and Werhahn, O. and Qu, Z.}
}

@Article { WallerandTG2020_2,
   subid = {1423},
   title = {Assessment of the mechanical errors of a prototype of an optical multilateration system},
   journal = {Review of Scientific Instruments},
   year = {2020},
   month = {2},
   volume = {91},
   number = {2},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   pages = {025004},
   keywords = {Optical multilateration system, large volume metrology, laser tracker, absolute distance meter,},
   web_url = {https://aip.scitation.org/doi/10.1063/1.5132933},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.5132933},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wallerand, J.-P. and Truong, D. and Guillory, J.}
}

@Article { EbertWQ2020,
   subid = {1407},
   title = {The thermal boundary layer effects on line-of-sight TDLAS gas concentration measurements},
   journal = {HostingInstitution: Physikalisch-Technische Bundesanstalt},
   year = {2020},
   month = {1},
   day = {30},
   number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions},
   keywords = {thermal boundary layers, tunable diode laser absorption spectroscopy (TDLAS), spectral collisional widths, gas concentration measurements},
   web_url = {https://oar.ptb.de/files/download/5e32e0934c9390355c0049d6},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Physikalisch-Technische Bundesanstalt},
   language = {30},
   ISSN = {ISNI: 0000 0001 2186 1887},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.7795/EMPIR.16ENV08.JA.20200130},
   author = {Ebert, V. and Werhahn, O. and Qu, Z.}
}

@Article { HatanoMKTIGFTHGGB2020,
   subid = {1394},
   title = {Spectroscopic investigations of negatively charged tin-vacancy centres in diamond},
   journal = {New Journal of Physics},
   year = {2020},
   month = {1},
   day = {23},
   volume = {22},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {013048},
   keywords = {colour centres, diamond, tin-vacancy centre, single photons,Fourier-limited Emission lines,electron–Phonon scattering},
   web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab6631/pdf},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/ab6631},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hatano, M. and Meijer, J. and Kieschnick, M. and Taniguchi, T. and Iwasaki, T. and Gandil, M. and Fuchs, P. and Thiering, G. and Herrmann, D. and G{\"o}rlitz, J. and Gali, A. and Becher, C.}
}

@Article { SarjonenRBSB2020,
   subid = {1391},
   title = {A Versatile Capacitive Sensing Platform for the Assessment of the Composition in Gas Mixtures},
   journal = {Micromachines},
   year = {2020},
   month = {1},
   day = {21},
   volume = {11},
   number = {2},
   number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel},
   pages = {116},
   keywords = {energy  transition;  gas  composition  sensor;  capacitive  sensor  array;  interdigitated  electrodes; responsive coatings; tunable filter infrared spectrometer; LNG; biogas},
   web_url = {https://www.mdpi.com/2072-666X/11/2/116/pdf},
   misc2 = {EMPIR 2016: Energy},
   publisher = {MDPI AG},
   address = {Postfach Basel CH-4005 Switzerland},
   language = {30},
   ISSN = {2072-666X},
   DOI = {10.3390/mi11020116},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sarjonen, R. and Rajamaki, T. and Blokland, H. and Sweelssen, J. and Boersma, A.}
}

@Article { PierreRS2020,
   subid = {1246},
   title = {Experimental facility for the production of reference atmosphere of radioactive gases (Rn, Xe, Kr, and H isotopes)},
   journal = {Applied Radiation and Isotopes},
   year = {2020},
   month = {1},
   volume = {155},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {108934},
   keywords = {Calibration, Radioactive Gas, Metrology, Radon, Xenon, Tritium, Krypton},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {https://doi.org/10.1016/j.apradiso.2019.108934},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pierre, S. and Rodrigues, M. and Sabot, B.}
}

@Article { SantosCMGPAMI2020,
   subid = {1338},
   title = {Overview and calculation of X‐ray K‐shell transition yields for comprehensive data libraries},
   journal = {X-Ray Spectrometry},
   year = {2020},
   month = {1},
   number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters},
   keywords = {X-ray K-shell transition yields},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Wiley},
   language = {30},
   ISSN = {0049-8246, 1097-4539},
   DOI = {10.1002/xrs.3123},
   stag_bib_extends_levelofaccess = {NA},
   author = {Santos, J. P. and Carvalho, M. L. and Machado, J. and Guerra, M. and Pessanha, S. and Amaro, P. and Martins, L. and Indelicato, P.}
}

@Article { MatousekSPFLD2020,
   subid = {1375},
   title = {Influence of mounting on the optical surface figure in optical reference surfaces},
   journal = {Journal of Instrumentation},
   year = {2020},
   month = {1},
   volume = {15},
   number = {01},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {P01005},
   keywords = {Optics; Overall mechanics design (support structures and materials, vibration analysisetc); Manufacturing; Interferometry},
   web_url = {https://iopscience.iop.org/article/10.1088/1748-0221/15/01/P01005\#back-to-top-target},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/15/01/P01005},
   stag_bib_extends_levelofaccess = {NA},
   author = {Matoušek, O. and Schulz, M. and Psota, P. and Fortmeier, I. and L{\'e}dl, V. and Doleček, R.}
}

@Article { FortmeierSLMSHBBKSE2020,
   subid = {1374},
   title = {Round robin comparison study on the form measurement of optical freeform surfaces},
   journal = {Journal of the European Optical Society-Rapid Publications},
   year = {2020},
   month = {1},
   volume = {16},
   number = {1},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   keywords = {Freeform optical surfaces, Metrology, Interlaboratory comparison},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1990-2573},
   DOI = {10.1186/s41476-019-0124-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fortmeier, I. and Schachtschneider, R. and L{\'e}dl, V. and Matoušek, O. and Siepmann, J. and Harsch, A. and Beisswanger, R. and Bitou, Y. and Kondo, Y. and Schulz, M. and Elster, C.}
}

@Article { MinkMFMZSBSMNAAL2020,
   subid = {1399},
   title = {Experimental Low-Latency Device-Independent Quantum Randomness},
   journal = {Physical Review Letters},
   year = {2020},
   month = {1},
   volume = {124},
   number = {1},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   keywords = {quantum randomness},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.124.010505},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1812.07786},
   author = {Mink, A. and Miller, C.A. and Fu, H. and Mitchell, M.W. and Zhang, Y. and Shalm, L.K. and Bienfang, J.C. and Stevens, M.J. and Mazurek, M.D. and Nam, S.W. and Abell{\'a}n, C. and Amaya, W. and Knill, E.}
}

@Article { LeviBTCLL2020,
   subid = {1397},
   title = {Sideband-Enhanced Cold Atomic Source for Optical Clocks},
   journal = {Physical Review Applied},
   year = {2020},
   month = {1},
   volume = {13},
   number = {1},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   pages = {014013},
   keywords = {Optical Lattice Clock,cold atomic sources},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.13.014013},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1909.05810},
   author = {Barbiero, M. and Tarallo, M.G. and Calonico, D. and Levi, F. and Lamporesi, G. and Ferrari, G.}
}

@Article { ZilbertiKLGCBAZ2020,
   subid = {1334},
   title = {Accuracy Assessment of Numerical Dosimetry for the Evaluation of Human Exposure to Electric Vehicle Inductive Charging Systems},
   journal = {IEEE Transactions on Electromagnetic Compatibility},
   year = {2020},
   volume = {ea},
   number = {ea},
   number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles},
   pages = {1-12},
   keywords = {Basic restrictions, electric vehicles, electro-magnetic fields, inductive charging, numerical dosimetry, safety},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9375, 1558-187X},
   DOI = {10.1109/TEMC.2019.2954111},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zilberti, L. and Kuster, N. and Liorni, I. and Giaccone, L. and Chiampi, M. and Bottauscio, O. and Arduino, A. and Zucca, M.}
}

@Article { VilloneVMDSFD2020,
   subid = {1418},
   title = {Mutual Inductance Behavioral Modeling for Wireless Power Transfer System Coils},
   journal = {IEEE Transactions on Industrial Electronics},
   year = {2020},
   volume = {ea},
   number = {ea},
   number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles},
   pages = {1-11},
   keywords = {This paper derives low-complexity behavioral analytical models of the mutual inductance between the coupling coils of Wireless Power Transfer Systems (WPTSs), as functions of their reciprocal position. These models are extremely useful in the characterization and design optimization of WPTSs. Multi-Objective Genetic Programming (MOGP) algorithm is adopted to generate models ensuring an optimal trade-off between accuracy and complexity. The training and validation data sets needed for the generation of the models are here obtained by performing numerical full-3D electromagnetic simulations. The resulting behavioral models allow accurate and fast evaluation of the WPTS coils mutual inductance, over a wide range of misalignment conditions, enabling easier system analysis and optimization.},
   web_url = {https://ieeexplore.ieee.org/document/8994192},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0278-0046, 1557-9948},
   DOI = {10.1109/TIE.2019.2962432},
   stag_bib_extends_levelofaccess = {NA},
   author = {Villone, F. and Ventre, S. and Maffucci, A. and Di Mambro, G. and Stoyka, K. and Femia, N. and Di Capua, G.}
}

@Article { GoenagaInfantePRdBAC2020,
   subid = {1417},
   title = {The accurate determination of number concentration of inorganic nanoparticles using spICP-MS with the dynamic mass flow approach},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2020},
   number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements},
   keywords = {nanoparticles, nanoparticle number concentration, spICP-MS, inorganic nanoparticles, Au nanoparticles, TiO2 nanoparticles},
   web_url = {https://pubs.rsc.org/en/content/articlepdf/2020/ja/c9ja00415g},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   DOI = {10.1039/c9ja00415g},
   stag_bib_extends_levelofaccess = {NA},
   author = {Goenaga-Infante, H. and Pellegrino, F. and Ramsey, D.A. and  del Castillo Busto, M.E. and Bartczak, D. and Abad-´Alvaro, I. and Cuello-Nu˜nez, S.}
}

@Proceedings { ZhangHLBAJN2019,
   subid = {1422},
   title = {Deep Learning Applied to Attractor Images Derived from ECG Signals for Detection of Genetic Mutation},
   journal = {2019 Computing in Cardiology Conference (CinC)},
   year = {2019},
   month = {12},
   day = {30},
   volume = {46},
   number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management},
   pages = {097},
   keywords = {Symmetric Projection Attractor Reconstruction, ECG signals, transfer learning},
   web_url = {http://www.cinc.org/archives/2019/pdf/CinC2019-097.pdf},
   misc2 = {EMPIR 2018: Health},
   publisher = {Computing in Cardiology},
   event_place = {Singapore},
   event_name = {Computing in Cardiology},
   event_date = {08-09-2019 to 11-09-2019},
   language = {30},
   ISSN = {2325-887X},
   DOI = {10.22489/CinC.2019.097},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhang, Y. and Huang, C. and Lyle, J. and Bonet-Luz, E. and Aston, P. and Jeevaratnam, K. and Nandi, M.}
}

@Article { BrunoGCBPL2019,
   subid = {1400},
   title = {Narrowband photon pairs with independent frequency tuning for quantum light-matter interactions},
   journal = {Optics Express},
   year = {2019},
   month = {12},
   day = {18},
   volume = {27},
   number = {26},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   pages = {38463},
   keywords = {Parametric Down-conversion, Photon correlation, photon entnglement},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.382474},
   stag_bib_extends_levelofaccess = {NA},
   author = {Prakash, V. and Bianchet, Lorena C. and Cuairan, M.T. and Bruno, N. and Gomez, P. and Mitchell, M.W.}
}

@Article { ZilbertiCBBA2019,
   subid = {1328},
   title = {In silico evaluation of the thermal stress induced by MRI switched gradient fields in patients with metallic hip implant},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {12},
   day = {13},
   volume = {64},
   number = {24},
   number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations},
   pages = {245006},
   keywords = {dosimetry, magnetic resonance imaging (MRI), MR safety, gradient coils, medical implants, prostheses, numerical simulation},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/ab5428},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zilberti, L. and Chiampi, M. and Br{\"u}hl, R. and Bottauscio, O. and Arduino, A.}
}

@Article { KlenovskyCSRCLHR2019,
   subid = {1360},
   title = {Single-particle-picture breakdown in laterally weakly confining GaAs quantum dots},
   journal = {Physical Review B},
   year = {2019},
   month = {12},
   day = {13},
   volume = {100},
   number = {23},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {GaAs, quantum dot},
   web_url = {https://journals.aps.org/prb/pdf/10.1103/PhysRevB.100.235425},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/PhysRevB.100.235425},
   stag_bib_extends_levelofaccess = {NA},
   author = {Klenovsk{\'y}, P. and Covre Da Silva, S.F. and Schuler, S. and Reindl, M. and Csontosov{\'a}, D. and Lehner, B.U. and Huber, D. and Rastelli, A.}
}

@Article { PottieAQCLRWKKG2019,
   subid = {1393},
   title = {Combining fiber Brillouin amplification with a repeater laser station for fiber-based optical frequency dissemination over 1400 km},
   journal = {New Journal of Physics},
   year = {2019},
   month = {12},
   day = {13},
   volume = {21},
   number = {.},
   number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {123017},
   keywords = {optical frequency dissemination},
   web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab5d95},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOPscience},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/ab5d95},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pottie, P.-E. and Amy-Klein, A. and Quintin, N. and Cantin, E. and Lopez, O. and Raupach, S.M.F. and Waterholter, T. and Kuhl, A. and Koke, S. and Grosche, G.}
}

@Article { RodtHSSHKFSR2019,
   subid = {1359},
   title = {Deterministically fabricated spectrally-tunable quantum dot based single-photon source},
   journal = {Optical Materials Express},
   year = {2019},
   month = {12},
   day = {10},
   volume = {10},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {76},
   keywords = {quantum dot, single-photon source},
   web_url = {https://arxiv.org/ftp/arxiv/papers/1805/1805.10623.pdf},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {2159-3930},
   DOI = {10.1364/OME.10.000076},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rodt, S. and Heindel, T. and Schmidt, R. and Schliwa, A. and Helversen, M.V. and Kaganskiy, A. and Fischbach, S. and Schmidt, M. and Reitzenstein, S.}
}

@Article { Mougeot2019,
   subid = {1233},
   title = {Towards high-precision calculation of electron capture decays},
   journal = {Applied Radiation and Isotopes},
   year = {2019},
   month = {12},
   volume = {154},
   number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters},
   pages = {108884},
   keywords = {Electron capture, Theoretical calculations, Nuclear decay data, Radionuclide metrology},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2019.108884},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mougeot, X.}
}

@Article { GomezFGLDBMFMMGARPABCDH2019,
   subid = {1260},
   title = {Hydrogen fuel quality from two main production processes: Steam methane reforming and proton exchange membrane water electrolysis},
   journal = {Journal of Power Sources},
   year = {2019},
   month = {12},
   volume = {444},
   number2 = {15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications},
   pages = {227170},
   keywords = {Fuel cell electrical vehicles, ISO14687, Gas analysis, Hydrogen production, Hydrogen quality},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0378775319311632},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0378-7753},
   DOI = {https://doi.org/10.1016/j.jpowsour.2019.227170},
   stag_bib_extends_levelofaccess = {NA},
   author = {G{\'o}mez, C. and Fern{\'a}ndez, T. E. and Gernot, E. and Laridant, F. and Doucet, G. and Bartlett, S. and Murugan, A. and Fischer, A. and Morris, A. and Moore, N. and Gozlan, B. and Aupr{\^e}tre, F. and Rojo, A. and Persijn, S. and Arrhenius, K. and Bacquart, T. and Carr{\'e}, M. and De Reals, G. and Haloua, F.}
}

@Article { PanuJTS2019,
   subid = {1309},
   title = {Dynamic calibration method for reactive gases},
   journal = {Measurement Science and Technology},
   year = {2019},
   month = {12},
   volume = {31},
   number = {3},
   number2 = {16ENV01: MercOx: Metrology for oxidised mercury},
   pages = {034001},
   keywords = {evaporation, traceability, reference gas, gas generator, gas flow, reactivecompounds, mercury},
   misc2 = {EMPIR 2016: Environment},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ab4d68},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sari, S. and Timo, R. and Jussi, H. and Panu, H.}
}

@Article { TrusheimFGBA2019,
   subid = {1315},
   title = {Quantum nanophotonics with group IV defects in diamond},
   journal = {Nature Communications},
   year = {2019},
   month = {12},
   volume = {10},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {5625},
   keywords = {diamond, photonics, quantum optics, color centers, quantum technologies},
   web_url = {https://www.nature.com/articles/s41467-019-13332-w},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-019-13332-w},
   stag_bib_extends_levelofaccess = {NA},
   author = {Trusheim, M. E. and Forneris, J. and Gao, W. and Bradac, C. and Aharonovich, I.}
}

@Article { LeviHVBH2019,
   subid = {1398},
   title = {Cavity-enhanced non-destructive detection of atoms for an optical lattice clock},
   journal = {Optics Express},
   year = {2019},
   month = {12},
   volume = {27},
   number = {26},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   pages = {37099},
   keywords = {Non destructive measurement, Optical Lattice Clocks},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.27.037099},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hobson, R. and Hill, I.R. and Bowden, W. and Vianello, A. and Gill, P.}
}

@Article { PraakSSP2019,
   subid = {1386},
   title = {Changing the status of mmHg},
   journal = {Accreditation and Quality Assurance},
   year = {2019},
   month = {12},
   volume = {n/a},
   number = {n/a},
   number2 = {16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements},
   pages = {1-2},
   keywords = {SI, Pressure units, Sphygmomanometry, Eye tonometry},
   web_url = {https://link.springer.com/article/10.1007/s00769-019-01414-7},
   misc2 = {EMPIR 2016: Research Potential},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0949-1775, 1432-0517},
   DOI = {10.1007/s00769-019-01414-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Praž{\'a}k, D. and Sedl{\'a}k, V. and Sınır, E. and Pluh{\'a}ček, F.}
}

@Article { BockhornPBKLNRR2019,
   subid = {1355},
   title = {Improved Source/Absorber Preparation for Radionuclide Spectrometry Based on Low-Temperature Calorimetric Detectors},
   journal = {Journal of Low Temperature Physics},
   year = {2019},
   month = {11},
   day = {30},
   number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters},
   keywords = {Beta spectrometry, Preparation techniques, Low-temperature detectors},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0022-2291, 1573-7357},
   DOI = {10.1007/s10909-019-02274-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bockhorn, L. and Paulsen, M. and Beyer, J. and Kossert, K. and Loidl, M. and N{\"a}hle, O. J. and Ranitzsch, P. C.-O. and Rodrigues, M.}
}

@Article { HorenderSIDVA2019,
   subid = {1333},
   title = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm−3},
   journal = {Metrologia},
   year = {2019},
   month = {11},
   day = {27},
   number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality},
   keywords = {aerosol, optical particle counter, calibration, clean room, counting efficiency},
   misc2 = {EMPIR 2016: Environment},
   publisher = {IOP Publishing},
   booktitle = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm\(^{−3}\)},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab5c84},
   stag_bib_extends_levelofaccess = {NA},
   author = {Horender, Stefan and Sakurai, Hiromu and Iida, Kenjiro and Discherl, Kai and Vasilatou, Konstantina and Auderset, Kevin}
}

@Article { GroblacherNG2019,
   subid = {1389},
   title = {Feedback cooling of a room temperature mechanical oscillator close to its motional groundstate},
   journal = {Physical Review Letters},
   year = {2019},
   month = {11},
   day = {27},
   volume = {123},
   number = {1},
   number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry},
   pages = {223602},
   keywords = {Light-matter interactionOptomechanicsPhotonicsMicromechanical \& Nanomechanical Oscillators},
   web_url = {https://arxiv.org/abs/1911.01586\&\#10;https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.123.223602},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society},
   address = {Washington DC, USA},
   language = {30},
   ISSN = {1079-7114},
   DOI = {10.1103/PhysRevLett.123.223602},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gr{\"o}blacher, Simon and Norte, Richard and Guo, Jingkun}
}

@Article { GeislerNBHSRKWHTHMSU2019,
   subid = {1316},
   title = {Determining the Thickness and Completeness of the Shell of Polymer Core–Shell Nanoparticles by X-ray Photoelectron Spectroscopy, Secondary Ion Mass Spectrometry, and Transmission Scanning Electron Microscopy},
   journal = {The Journal of Physical Chemistry C},
   year = {2019},
   month = {11},
   day = {26},
   number2 = {17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses},
   keywords = {Nanoparticles, core-shell, XPS, SIMS, T-SEM, polymer},
   misc2 = {EMPIR 2017: Support for Impact},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {1932-7447, 1932-7455},
   DOI = {10.1021/acs.jpcc.9b09258},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gei{\ss}ler, D. and Nirmalananthan-Budau, N. and Benemann, S. and Hodoroaba, V-D. and Stockmann, J. M. and Radnik, J. and Kunz, V. and Werner, W. S. M. and Hronek, M. and Tougaard, S. and Heinrich, T. and M{\"u}ller, A. and Sparnacci, K. and Unger, W. E. S }
}

@Article { SimovskiM2019,
   subid = {1351},
   title = {Dual-metasurface superlens: A comprehensive study},
   journal = {Physical Review B},
   year = {2019},
   month = {11},
   day = {25},
   volume = {100},
   number = {20},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {205426},
   keywords = {Subwavelength resolution, superlens, metasurface, hybridization of plasmons, bandgap, nanoimaging205426},
   web_url = {https://arxiv.org/pdf/1910.14295v1.pdf},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/PhysRevB.100.205426},
   stag_bib_extends_levelofaccess = {NA},
   author = {Simovski, C. and Mollaei, M.S.M.}
}

@Article { KashcheyevsFBJLSGFRK2019,
   subid = {1312},
   title = {Continuous-variable tomography of solitary electrons},
   journal = {Nature Communications},
   year = {2019},
   month = {11},
   day = {22},
   volume = {10},
   number = {1},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   keywords = {Single electron, Electron wave packet, Tomography},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-019-13222-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kashcheyevs, V. and Fletcher, J. D. and Brouwer, P. W. and Johnson, N. and Locane, E. and See, P. and Griffiths, J. P. and Farrer, I. and Ritchie, D. A. and Kataoka, M.}
}

@Article { SchneiderHHCFKRSTR2019,
   subid = {1362},
   title = {Resolving the temporal evolution of line broadening in single quantum emitters},
   journal = {Optics Express},
   year = {2019},
   month = {11},
   day = {18},
   volume = {27},
   number = {24},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {35290},
   keywords = {single quantum emitter, GaAs and In(Ga)As quantum dots},
   web_url = {https://www.osapublishing.org/DirectPDFAccess/0872F4C8-F64C-1DD3-BF83A9359A9A78C7_423274/oe-27-24-35290.pdf?da=1\&id=423274\&seq=0\&mobile=no},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.27.035290},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schneider, C. and H{\"o}fling, S. and Hofer, J. and Covre Da Silva, S.F. and Fromherz, T. and Klenovsk{\'y}, P. and Reindl, M. and Schimpf, C. and Trotta, R. and Rastelli, A.}
}

@Article { KlauiJPDGVCC2019,
   subid = {1308},
   title = {Individual skyrmion manipulation by local magnetic field gradients},
   journal = {Communications Physics},
   year = {2019},
   month = {11},
   day = {15},
   volume = {2},
   number = {1},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {145},
   keywords = {Skyrmion, MFM},
   web_url = {https://www.nature.com/articles/s42005-019-0242-5\#article-info},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2399-3650},
   DOI = {10.1038/s42005-019-0242-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kl{\"a}ui, M. and Jakob, G. and Pasquale, M. and Durin, G. and Garcia-Sanchez, F. and Vafaee, M. and Corte-Le{\'o}n, H. and Casiraghi, A.}
}

@Article { KlauiJPDGVCC20190,
   subid = {1308},
   title = {Individual skyrmion manipulation by local magnetic field gradients},
   journal = {Communications Physics},
   year = {2019},
   month = {11},
   day = {15},
   volume = {2},
   number = {1},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {145},
   keywords = {Skyrmion, MFM},
   web_url = {https://www.nature.com/articles/s42005-019-0242-5\#article-info},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2399-3650},
   DOI = {10.1038/s42005-019-0242-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kl{\"a}ui, M. and Jakob, G. and Pasquale, M. and Durin, G. and Garcia-Sanchez, F. and Vafaee, M. and Corte-Le{\'o}n, H. and Casiraghi, A.}
}

@Article { StoschGZPFM2019,
   subid = {1299},
   title = {Step‐by‐step monitoring of a magnetic and SERS‐active immunosensor assembly for purification and detection of tau protein},
   journal = {Journal of Biophotonics},
   year = {2019},
   month = {11},
   day = {13},
   number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease},
   keywords = {synthesis of iron oxide, tau protein, diagnosis of Alzheimer's disease, SERS‐active immunosensor, purification and detection of tau protein},
   web_url = {https://onlinelibrary.wiley.com/doi/abs/10.1002/jbio.201960090},
   misc2 = {EMPIR 2015: Health},
   publisher = {Wiley},
   language = {30},
   ISSN = {1864-063X, 1864-0648},
   DOI = {10.1002/jbio.201960090},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stosch, R. and Garnweitner, G. and Zellmer, S. and Porsiel, J. C. and Frank, C. and Maurer, V.}
}

@Article { RanitzschPNMKKEBBLRS2019,
   subid = {1234},
   title = {Beta spectrometry with metallic magnetic calorimeters in the framework of the European EMPIR project MetroBeta},
   journal = {Applied Radiation and Isotopes},
   year = {2019},
   month = {11},
   volume = {153},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {108830},
   keywords = {Beta spectrometry; Metallic magnetic calorimeter; Ionizing radiation metrology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2019.108830},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ranitzsch, P. and Paulsen, M. and N{\"a}hle, O. and Mariam, R. and Kossert, K. and Kempf, S. and Enss, C. and Bockhorn, L. and Beyer, J. and Loidl, M. and Rodrigues, M. and Schmidt, M.}
}

@Article { KhabipovDL2019,
   subid = {1256},
   title = {DC measurement of dressed states in a coupled 100 GHz resonator system using a single quasiparticle transistor as a sensitive microwave detector},
   journal = {Applied Physics Letters},
   year = {2019},
   month = {11},
   volume = {115},
   number = {19},
   number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology},
   pages = {192601},
   keywords = {microwave detectors, single-electron tunneling, photon-assisted tunneling, Josephson generation, superconducting coplanar resonators, quantum oscillators, circuit QED, Josephson qubit, transmon qubit},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/1.5119220},
   stag_bib_extends_levelofaccess = {NA},
   author = {Khabipov, M. and Dolata, R. and Lotkhov, S. V.}
}

@Article { GuarnizoMRFS2019,
   subid = {1272},
   title = {Validation of Emission Spectroscopy Gas Temperature Measurements Using a Standard Flame Traceable to the International Temperature Scale of 1990 (ITS-90)},
   journal = {International Journal of Thermophysics},
   year = {2019},
   month = {11},
   volume = {40},
   number = {11},
   number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2},
   pages = {99},
   keywords = {Combustion, Emission spectroscopy, ITS-90, Rayleigh scattering, Standard Temperature},
   web_url = {https://link.springer.com/content/pdf/10.1007\%2Fs10765-019-2557-6.pdf},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-019-2557-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Guarnizo, G. and Mel{\'e}ndez, J. and Rodr{\'i}guez-Conejo, M.A. and Fateev, A. and Sutton, G.}
}

@Article { IkonenKOB2019,
   subid = {1286},
   title = {Optical Characterization of III-V Multijunction Solar Cells for Temperature-Independent Band Gap Features},
   journal = {IEEE Journal of Photovoltaics},
   year = {2019},
   month = {11},
   volume = {9},
   number = {6},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   pages = {1631-1636},
   keywords = {Band gap, light-emitting diode (LED), spectral response, temperature, III-V solar cells},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2156-3381, 2156-3403},
   DOI = {10.1109/JPHOTOV.2019.2933190},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ikonen, E. and K{\"a}rh{\"a}, P. and Oksanen, B. and Baumgartner, H.}
}

@Article { CidadePNGFF2019,
   subid = {1300},
   title = {Density measurements of viscoelastic samples with oscillation-type density meters},
   journal = {Journal of Physics: Conference Series},
   year = {2019},
   month = {11},
   volume = {1379},
   number = {Joint IMEK},
   number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements},
   pages = {012020},
   keywords = {density, harmonic oscillator, viscoelasticity, damping},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1379/1/012020/pdf},
   misc2 = {EMPIR 2017: Research Potential},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {doi:10.1088/1742-6596/1379/1/012020},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cidade, M.T. and Pereira, J. and Napole{\~a}o, A. and Gavina, J. and Furtado, A. and Furtado, A.}
}

@Article { KlenovskyBMASS2019,
   subid = {1361},
   title = {Optical response of (InGa)(AsSb)/GaAs quantum dots embedded in a GaP matrix},
   journal = {Physical Review B},
   year = {2019},
   month = {11},
   volume = {100},
   number = {19},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {electronic structure, quantum dot},
   web_url = {https://arxiv.org/abs/1906.09842},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/PhysRevB.100.195407},
   stag_bib_extends_levelofaccess = {NA},
   author = {Klenovsk{\'y}, P. and Bimberg, D. and Marr{\'o}n, D.F. and Al{\'e}n, B. and Sala, E.M. and Steindl, P.}
}

@Article { LandiGDL2019_2,
   subid = {1347},
   title = {Uncertainty Evaluation on the Absolute Phase Error of Digitizers},
   journal = {Transactions of the Institute of Measurement and Control},
   year = {2019},
   month = {11},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {1-10},
   keywords = {Phase Measurement,Digitizer,Calibration,Discrete Fourier Transform,Phasor Measurement Unit,Synchrophasor,Digital Low Power Instrument Transformer},
   web_url = {https://zenodo.org/record/3600435},
   misc2 = {EMPIR 2017: Industry},
   publisher = {SAGE Journals},
   language = {30},
   ISSN = {0142-3312},
   DOI = {10.5281/zenodo.3600435},
   stag_bib_extends_levelofaccess = {NA},
   author = {Landi, C. and Gallo, D. and Delle Femine, A. and Luiso, M.}
}

@Thesis { Rosner2019,
   subid = {1368},
   title = {Production and preparation of highly charged ions for re-trapping in ultra-cold environments,Master Thesis, Ruprecht-Karls-Universitat, Heidelberg (2019)},
   year = {2019},
   month = {11},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   keywords = {Optical ClockTrapped Ions},
   web_url = {https://pure.mpg.de/rest/items/item_3182118_1/component/file_3182119/content},
   misc2 = {EMPIR 2017: Fundamental},
   school = {Ruprecht-Karls-Universit{\"a}t, Heidelberg},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/21.11116/0000-0005-5B37-8},
   author = {Rosner, M.K.}
}

@Article { KipperHLBPHLV2019,
   subid = {1406},
   title = {Retention of acidic and basic analytes in reversed phase column using fluorinated and novel eluent additives for liquid chromatography-tandem mass spectrometry},
   journal = {Journal of Chromatography A},
   year = {2019},
   month = {11},
   volume = {in press},
   number = {in press},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   pages = {460667},
   keywords = {Eluent additivesHFIPHFTBPPNFTBRetention mechanisms},
   web_url = {https://www.sciencedirect.com/search/advanced?qs=Retention\%20of\%20acidic\%20and\%20basic\&pub=Journal\%20of\%20Chromatography\%20A\&cid=271409\&volumes=0\&lastSelectedFacet=volumes},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0021-9673},
   DOI = {10.1016/j.chroma.2019.460667},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kipper, K. and Herodes, K. and Leito, I. and Born, R. and Parman, E. and Hecht, M. and Lossmann, K. and Veigure, R.}
}

@Article { RibeiroPBSM2019,
   subid = {1419},
   title = {Method selection to evaluate measurement uncertainty in microflow applications},
   journal = {Journal of Physics: Conference Series},
   year = {2019},
   month = {11},
   volume = {1379},
   number = {2019},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   pages = {012033},
   keywords = {microflow, medicine, neonatology, oncology, measurement uncertainty, GUM, Monte Carlo},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1379/1/012033},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ribeiro, A.S. and Pellegrino, O. and Batista, E. and Sousa, J.A. and Martins, L.L.}
}

@Article { SantosCMGPAM2019,
   subid = {1337},
   title = {Multiconfiguration Dirac–Fock calculations of Zn K‐shell radiative and nonradiative transitions},
   journal = {X-Ray Spectrometry},
   year = {2019},
   month = {10},
   day = {29},
   volume = {49},
   number = {1},
   number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters},
   pages = {192-199},
   keywords = {Dirac–Fock method, Zn K‐shell},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Wiley},
   language = {30},
   ISSN = {0049-8246, 1097-4539},
   DOI = {10.1002/xrs.3089},
   stag_bib_extends_levelofaccess = {NA},
   author = {Santos, J. P. and Carvalho, M. L. and Machado, J. and Guerra, M. and Pessanha, S. and Amaro, P. and Martins, L.}
}

@Thesis { Bogen2019,
   subid = {1367},
   title = {Frequenz-, Leistungs- und Positionsstabilisierung von UV-Lasersystemen fur Frequenzmetrologie mit hochgeladenen Ionen, Master Thesis, Ruprecht-Karls-Universitat, Heidelberg (2019)},
   year = {2019},
   month = {10},
   day = {28},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   keywords = {Optical ClockTrapped Ions},
   web_url = {https://pure.mpg.de/rest/items/item_3175862_1/component/file_3175863/content},
   misc2 = {EMPIR 2017: Fundamental},
   school = {Ruprecht-Karls-Universit{\"a}t, Heidelberg},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/21.11116/0000-0005-1733-8},
   author = {Bogen, S.}
}

@Article { BinghamWSTMFZSRKH2019,
   subid = {1353},
   title = {Formation of N{\'e}el-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy},
   journal = {Physical Review B},
   year = {2019},
   month = {10},
   day = {25},
   volume = {100},
   number = {14},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {144435},
   keywords = {Skyrmions, DMI, spin waves},
   web_url = {https://arxiv.org/abs/1910.04515},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/PhysRevB.100.144435},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bingham, N. S. and Wintz, S. and Suszka, A. K. and Tacchi, S. and Mruczkiewicz, M. and Finizio, S. and Zelent, M. and Saha, S. and Raabe, J. and Krawczyk, M. and Heyderman, L. J.}
}

@Article { Zorin2019,
   subid = {1254},
   title = {Flux-Driven Josephson Traveling-Wave Parametric Amplifier},
   journal = {Physical Review Applied},
   year = {2019},
   month = {10},
   day = {23},
   volume = {12},
   number = {4},
   number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology},
   pages = {1-16},
   keywords = {Josephson junctions, SQUID, superconducting qubits, traveling waves, parametric amplifiers, Quantum information with solid state qubits},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.12.044051},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zorin, A.B.}
}

@Article { MarcqMHGFCBBTBMWW2019,
   subid = {1248},
   title = {RadCalNet: A Radiometric Calibration Network for Earth Observing Imagers Operating in the Visible to Shortwave Infrared Spectral Range},
   journal = {Remote Sensing},
   year = {2019},
   month = {10},
   day = {16},
   volume = {11},
   number = {2401},
   number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate},
   pages = {20},
   keywords = {RadCalNet, CEOS, radiometric calibration, SI-traceable, surface reflectance, network, instrument},
   web_url = {https://doi.org/10.3390/rs11202401\&\#160;},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2072-4292},
   DOI = {10.3390/rs11202401},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marcq, S. and Ma, L. and Henry, P. and Goryl, P. and Fox, N. and Czapla-Myers, J. and Bialek, A. and Berthelot, B. and Thome, K. and Bouvet, M. and Meygret, A. and Wenny, B. and Woolliams, E.}
}

@Thesis { Warnecke2019,
   subid = {1365},
   title = {Imaging of Coulomb crystals in a cryogenic Paul trap experiment, Master Thesis, Ruprecht-Karls-Universitat, Heidelberg (2019)},
   year = {2019},
   month = {10},
   day = {15},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   keywords = {Optical ClockTrapped Ions},
   web_url = {https://pure.mpg.de/rest/items/item_3173887_1/component/file_3173888/content},
   misc2 = {EMPIR 2017: Fundamental},
   school = {University Heidelberg},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/21.11116/0000-0004-F47D-D},
   author = {Warnecke, C.}
}

@Article { PfleidererRRLBAPWB2019,
   subid = {1313},
   title = {Ferromagnetic Resonance with Magnetic Phase Selectivity by Means of Resonant Elastic X-Ray Scattering on a Chiral Magnet},
   journal = {Physical Review Letters},
   year = {2019},
   month = {10},
   day = {14},
   volume = {123},
   number = {16},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   keywords = {Skyrmions, X-ray scattering, Ferromagnetic resonance},
   web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.123.167201\&\#10;\&\#10;https://arxiv.org/abs/1909.08293},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.123.167201},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pfleiderer, C. and Radu, F. and Ryll, H. and Luo, C. and Bauer, A. and Aqeel, A. and P{\"o}llath, S. and Woltersdorf, G. and Back, C. H.}
}

@Proceedings { HoogenboomHRY2019,
   subid = {1301},
   title = {Reliable Power Transformer Efficiency Tests},
   journal = {Proceedings 5th International Colloquium “Transformer Research and Asset Management” Opatija/Croatia, October 09 – 12, 2019},
   year = {2019},
   month = {10},
   day = {11},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {power transformers, efficiency, loss, loss measurement, reliability, calibration, accuracy, uncertainty},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   event_place = {Opatija, Croatia},
   event_name = {5th International Colloquium “Transformer Research and Asset Management” Opatija/Croatia},
   event_date = {09-10-2019 to 12-10-2019},
   language = {30},
   DOI = {10.5281/zenodo.3559845},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hoogenboom, D. and Houtzager, E. and Rietveld, G. and Ye, G.}
}

@Article { AlvesBLLPB2019,
   subid = {1401},
   title = {Maltese cross coupling to individual cold atoms in free space},
   journal = {Optics Express},
   year = {2019},
   month = {10},
   day = {11},
   volume = {27},
   number = {21},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   pages = {31042},
   keywords = {Sub-Pissonian statistics, photon anti bounching},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.27.031042},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bruno, Natalia and Bianchet, Lorena C. and Prakash, Vindhiya and Li, Nan and Alves, Nat{\'a}lia and Mitchell, M.W.}
}

@Article { NajmanovaPP2019,
   subid = {1326},
   title = {Intraocular pressure response affected by changing of sitting and supine positions},
   journal = {Acta Ophthalmologica},
   year = {2019},
   month = {10},
   day = {10},
   volume = {n/a},
   number = {n/a},
   number2 = {16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements},
   pages = {1-5},
   keywords = {baseline, body position, intraocular pressure, sitting, supine, time course},
   web_url = {https://onlinelibrary.wiley.com/doi/full/10.1111/aos.14267},
   misc2 = {EMPIR 2016: Research Potential},
   publisher = {Wiley},
   language = {30},
   ISSN = {1755-375X, 1755-3768},
   DOI = {10.1111/aos.14267},
   stag_bib_extends_levelofaccess = {NA},
   author = {Najmanov{\'a}, E. and Pluh{\'a}ček, F. and Haklov{\'a}, M}
}

@Inbook { EnricoGF2019,
   subid = {1357},
   title = {Superconducting Josephson-Based Metamaterials for Quantum-Limited Parametric Amplification: A Review},
   year = {2019},
   month = {10},
   day = {10},
   number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology},
   keywords = {superconductivity, metamaterial, Josephson effect, parametric amplification, microwave photonics},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IntechOpen},
   address = {IntechOpen  Rijeka},
   booktitle = {Condensed Matter Physics},
   language = {30},
   DOI = {10.5772/intechopen.89305},
   stag_bib_extends_levelofaccess = {NA},
   author = {Enrico, E. and Greco, A. and Fasolo, L.}
}

@Article { BochudNHLJJ2019,
   subid = {1231},
   title = {Development and validation of a double focalizing magnetic spectrometer for beta spectrum measurements},
   journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment},
   year = {2019},
   month = {10},
   volume = {942},
   number = {21 October},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {162384},
   keywords = {magnetic spectrometer, beta shape measurement, acquisition system, Cl-36},
   web_url = {https://reader.elsevier.com/reader/sd/pii/S0168900219309684?token=9907411027790E1C7A6500A4337D2D10E57E40E772BECF66298808C0FD62E4F989D02F38F9DA80F8EEB0FCC5EF556A53},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0168-9002},
   DOI = {10.1016/j.nima.2019.162384},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bochud, F. and Nedjadi, Y. and Haefeli, G. and Lorusso, G. and Juget, F. and Juget, F.}
}

@Article { BurgerHZB2019,
   subid = {1249},
   title = {Modal analysis for nanoplasmonics with nonlocal material properties},
   journal = {Physical Review B},
   year = {2019},
   month = {10},
   volume = {100},
   number = {15},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {155406},
   keywords = {Nanophotonics, Plasmonic, Drude model, Electromagnetic wave theory, Finite-element method},
   web_url = {https://arxiv.org/abs/1906.01941},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/PhysRevB.100.155406},
   stag_bib_extends_levelofaccess = {NA},
   author = {Burger, S. and Hammerschmidt, M. and Zschiedrich, L. and Binkowski, F.}
}

@Article { GiordanoLGCDL2019,
   subid = {1335},
   title = {Calibration of Voltage and Current Transducers for DC Railway Systems},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {10},
   volume = {68},
   number = {10},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   pages = {3850-3860},
   keywords = {Calibration, current transducer, dc railway system, dynamic conditions, energy measurement, power measurement, stationary conditions, voltage transducer.},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2019.2912232},
   stag_bib_extends_levelofaccess = {NA},
   author = {Giordano, D. and Landi, C. and Gallo, D. and Crotti, G. and Delle Femine, A. and Luiso, M.}
}

@Article { Dombrowski2019,
   subid = {1392},
   title = {Preparedness intercomparison of passive H*(10) area photon dosemeters in 2017/2018 (IC2017prep)},
   journal = {Journal of Instrumentation},
   year = {2019},
   month = {10},
   volume = {14},
   number = {10},
   number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident},
   pages = {P10008-P10008},
   keywords = {Dosimetry concepts and apparatus; Solid state detectors; Detector design and con-struction technologies and materials},
   web_url = {https://iopscience.iop.org/article/10.1088/1748-0221/14/10/P10008/pdf},
   misc2 = {EMPIR 2016: Environment},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/14/10/P10008},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dombrowski, H.}
}

@Article { Maringer2019,
   subid = {1257},
   title = {An innovative quick method for tracable measurement of radon 222 indrinking water},
   journal = {Applied Radiation and Isotopes},
   year = {2019},
   month = {9},
   day = {30},
   volume = {155},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {1-9},
   keywords = {Radon 222 activity concentration, Traceable calibration, Drinking water, Radon emanation, Ionisation chamber, Uncertainty budget, Characteristic limits},
   web_url = {https://doi.org/10.5281/zenodo.3555047},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier Ltd.},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2019.108907},
   stag_bib_extends_levelofaccess = {NA},
   author = {Maringer, F.J.}
}

@Article { EschelbachHLG2019,
   subid = {1222},
   title = {Gravitational deformation of ring-focus antennas for VGOS: first investigations at the Onsala twin telescopes project},
   journal = {Journal of Geodesy},
   year = {2019},
   month = {9},
   day = {28},
   volume = {2019},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   pages = {1-19},
   keywords = {Ring-focus paraboloid, Radio telescope, Antenna deformation, VLBI, VGOS, Signal path variation, SQP, Reverse engineering, Photogrammetry, Unmanned aircraft system},
   web_url = {https://link.springer.com/content/pdf/10.1007\%2Fs00190-019-01302-5.pdf\&\#10;https://link.springer.com/article/10.1007/s00190-019-01302-5},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Springer Berlin Heidelberg},
   language = {30},
   ISSN = {0949-7714},
   DOI = {10.1007/s00190-019-01302-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {L{\"o}sler, M. and Haas, R. and Eschelbach, C. and Greiwe, A.}
}

@Article { ToivonenK2019,
   subid = {1296},
   title = {Dynamic Enhancement of Nitric Oxide Radioluminescence with Nitrogen Purge},
   journal = {Scientific Reports},
   year = {2019},
   month = {9},
   day = {25},
   volume = {9},
   number = {1},
   number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities},
   pages = {13884},
   keywords = {Radioluminescence, nitric oxide, nitrogen purge},
   web_url = {https://www.nature.com/articles/s41598-019-50396-6},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {https://doi.org/10.1038/s41598-019-50396-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Toivonen, J. and Kerst, T.}
}

@Proceedings { FortuneCRSPA2019,
   subid = {1198},
   title = {STUDY OF NONINVASIVE INSTRUMENTS FOR THE MEASUREMENT OF X-RAY HIGH VOLTAGE TUBE},
   journal = {Proceedings of CIM 2019},
   year = {2019},
   month = {9},
   day = {24},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Pulsed X-ray tube, KVp meters, Metrology, Dose.},
   web_url = {https://www.cim2019.com},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Paris, France},
   event_name = {The 19st Congr{\`e}s Internationla de M{\'e}trologie},
   event_date = {24-09-2019 to 26-09-2019},
   language = {30},
   DOI = {10.1051/metrology/201902002},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {10.5281/zenodo.3335340},
   author = {Fortune, D. and Castaignau, L. and Robert, C. and Saadeddine, H. and Perillat, D. and Agazar, M.}
}

@Proceedings { Allal2019,
   subid = {1230},
   title = {EMPIR European project for validation of vector array SAR measurement systems},
   journal = {19th International Congress of Metrology (CIM2019)},
   year = {2019},
   month = {9},
   day = {23},
   number = {2019 19th},
   number2 = {16NRM07: Vector SAR: SAR measurement using vector probes},
   pages = {3/02003},
   keywords = {Specific Absorption Rate, Vector Probe Array, MIMO},
   web_url = {https://cfmetrologie.edpsciences.org/articles/metrology/abs/2019/01/metrology_cim2019_02003/metrology_cim2019_02003.html},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {EDP Sciences},
   event_place = {LNE},
   event_name = {19th International Congress of Metrology},
   event_date = {24-09-2019 to 26-09-2019},
   language = {30},
   DOI = {10.1051/metrology/201902003},
   stag_bib_extends_levelofaccess = {NA},
   author = {Allal, Djamel}
}

@Proceedings { FurtadoQPF2019,
   subid = {1258},
   title = {Robustness studies of oscillation-type density meters with viscoelastic fluids},
   journal = {19th International Congress of Metrology (CIM2019)},
   year = {2019},
   month = {9},
   day = {23},
   number = {2019},
   number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements},
   pages = {16/13002},
   keywords = {density, viscoelasticity, oscillation-type density meters, damping},
   web_url = {https://cfmetrologie.edpsciences.org/articles/metrology/abs/2019/01/metrology_cim2019_13002/metrology_cim2019_13002.html},
   misc2 = {EMPIR 2017: Research Potential},
   publisher = {EDP Sciences},
   event_place = {Paris, France},
   event_name = {19th International Congress of Metrology},
   event_date = {24-09-2019 to 26-09-2019},
   language = {30},
   DOI = {10.1051/metrology/201913002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Furtado, A. and Quendera, R. and Pereira, J. and Furtado, A.}
}

@Proceedings { BagciHYTAGD2019,
   subid = {1325},
   title = {Improvement of dynamic pressure standard for calibration of dynamic pressure transducers},
   journal = {19th International Congress of Metrology (CIM2019)},
   year = {2019},
   month = {9},
   day = {23},
   number = {2019},
   number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures},
   keywords = {dynamic pressure, measurement, calibration, drop mass, dynamic calibration machine},
   misc2 = {EMPIR 2017: Industry},
   publisher = {EDP Sciences},
   address = {17 av. du Hoggar PA de Courtaboeuf BP 112 PA de Courtaboeuf BP 112 Les Ulis cedex A 91944 France},
   event_place = {Paris},
   event_name = {19th International Congress of Metrology},
   event_date = {24-09-2019 to 26-09-2019},
   language = {30},
   DOI = {10.1051/metrology/201927009},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bağcı, E. and Hamarat, A. and Yilmaz, R. and Turk, A. and Aydemir, B. and Ganioglu, O. and Durgut, Y.}
}

@Article { HohlsBL2019,
   subid = {1310},
   title = {Time-energy filtering of single electrons in ballistic waveguides},
   journal = {New Journal of Physics},
   year = {2019},
   month = {9},
   day = {19},
   volume = {21},
   number = {9},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {093042},
   keywords = {Single electrons, time-energy filtering},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/ab3fbb},
   stag_bib_extends_levelofaccess = {NA},
   author = {Locane, E. and Brouwer, P.W. and Kashcheyevs, V.}
}

@Article { BurgerHSGSR2019,
   subid = {1291},
   title = {Benchmarking Five Global Optimization Approaches for Nano-optical Shape Optimization and Parameter Reconstruction},
   journal = {ACS Photonics},
   year = {2019},
   month = {9},
   day = {17},
   volume = {6},
   number = {11},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {2726-2733},
   keywords = {shape optimization, parameter reconstruction, machine learning, global optimization, Bayesian optimization},
   web_url = {https://arxiv.org/abs/1809.06674},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {ACS},
   language = {30},
   ISSN = {2330-4022, 2330-4022},
   DOI = {10.1021/acsphotonics.9b00706},
   stag_bib_extends_levelofaccess = {NA},
   author = {Burger, S. and Hammerschmidt, M. and Soltwisch, Vi. and Garcia Santiago, X. and Schneider, P.I. and Rockstuhl, C.}
}

@Article { SterpinG2019,
   subid = {1332},
   title = {Monte Carlo calculation of beam quality correction factors in proton beams using PENH},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {9},
   day = {17},
   volume = {64},
   number = {18},
   number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398},
   pages = {185009},
   keywords = {beam quality correction factors, Monte Carlo calculation, radiation dosimetry, proton therapy},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/ab3b94},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sterpin, E. and Gom{\`a}, C.}
}

@Article { MayrBWHFMRWZ2019,
   subid = {1370},
   title = {Deterministic Field-Free Skyrmion Nucleation at a Nanoengineered Injector Device},
   journal = {Nano Letters},
   year = {2019},
   month = {9},
   day = {17},
   volume = {19},
   number = {10},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {7246-7255},
   keywords = {Skyrmion; nanomagnetism, spin-orbit torque},
   web_url = {https://arxiv.org/abs/1902.10435},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Chemical Society (ACS)},
   address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Contract \#: 19-0000016470-01 PO \#: 6000110532 Columbus Ohio 43210 United States},
   language = {30},
   ISSN = {1530-6984, 1530-6992},
   DOI = {10.1021/acs.nanolett.9b02840},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mayr, S. and Burnell, G. and We{\ss}els, T. and Huxtable, A.J. and Finizio, S. and Marrows, C.H. and Raabe, J. and Wintz, S. and Zeissler, K.}
}

@Article { SergeevaCholletFPPDMS2019,
   subid = {1268},
   title = {Optimizing magnetoresistive sensor signal-to-noise via pinning field tuning},
   journal = {Applied Physics Letters},
   year = {2019},
   month = {9},
   day = {16},
   volume = {115},
   number = {12},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {122406},
   keywords = {magnetic sensor, noise, magnetoresistance},
   web_url = {https://arxiv.org/abs/1909.04531},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/1.5108604},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sergeeva-Chollet, N. and Fermon, C. and Pannetier-Lecoeur, M. and Paul, E. and Doll, A. and Moulin, J. and Solignac, A.}
}

@Article { PalonenOKBLGG2019,
   subid = {1293},
   title = {Laser Spectroscopy for Monitoring of Radiocarbon in Atmospheric Samples},
   journal = {Analytical Chemistry},
   year = {2019},
   month = {9},
   day = {10},
   volume = {91},
   number = {19},
   number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities},
   pages = {12315-12320},
   keywords = {Radiocarbon, Laser spectroscopy},
   web_url = {https://pubs.acs.org/doi/10.1021/acs.analchem.9b02496},
   misc2 = {EMPIR 2016: Environment},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {0003-2700, 1520-6882},
   DOI = {10.1021/acs.analchem.9b02496},
   stag_bib_extends_levelofaccess = {NA},
   author = {Palonen, V. and Oinonen, M. and Koskinen-Soivi, M.L. and Bell, S. and Lehmuskoski, J. and Genoud, G. and Genoud, G.}
}

@Proceedings { ChiampiBAZ2019,
   subid = {1271},
   title = {Uncertainty propagation in phaseless electric properties tomography},
   journal = {2019 International Conference on Electromagnetics in Advanced Applications (ICEAA)},
   year = {2019},
   month = {9},
   number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers},
   keywords = {magnetic resonance imaging (MRI),  phaseless contrast source inversion (CSI),  electric properties tomography (EPT),  uncertainty propagation,  Monte Carlo method},
   web_url = {https://arxiv.org/abs/1911.02809},
   misc2 = {EMPIR 2018: Health},
   publisher = {IEEE},
   event_place = {Granada},
   event_name = {2019 International Conference on Electromagnetics in Advanced Applications},
   event_date = {09-09-2019 to 13-09-2019},
   language = {30},
   DOI = {10.1109/ICEAA.2019.8879147},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chiampi, M. and Bottauscio, O. and Arduino, Alessandro and Zilberti, L.}
}

@Article { Bossew2019,
   subid = {1289},
   title = {Radon Priority Areas and Radon Extremes – Initial Statistical Considerations},
   journal = {Radiation Environment and Medicine},
   year = {2019},
   month = {9},
   volume = {8},
   number = {2},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {94-104},
   keywords = {radon priority area, anomaly, extreme},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Hirosaki University press},
   language = {30},
   ISSN = {2423-9097},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://crss.hirosaki-u.ac.jp/wp-content/files_mf/1568795052Web_REMVol828_PeterBossew.pdf},
   author = {Bossew, P.}
}

@Proceedings { KrokerWSKB2019,
   subid = {1282},
   title = {Sub-Wavelength Features in Spectroscopic Mueller Matrix Ellipsometry},
   journal = {Deutsche Gesellschaft f{\"u}r angewandte Optik Proceedings 2019},
   year = {2019},
   month = {9},
   volume = {120},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   keywords = {Gratings, Measurement Technology, Scatterometry},
   web_url = {https://www.dgao-proceedings.de/download/120/120_p9.pdf},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Deutsche Gesellschaft f{\"u}r angewandte Optik e.V. (DGaO)},
   event_place = {Darmstadt},
   event_name = {120. Jahrestagung der Deutschen Gesellschaft f{\"u}r angewandte Optik},
   event_date = {11-06-2019 to 15-06-2019},
   language = {30},
   ISSN = {1614-8436},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {urn:nbn:de:0287-2019-P009-1},
   author = {Kroker, Stefanie and Wurm, Matthias and Siefke, Thomas and K{\"a}seberg, Tim and Bodermann, Bernd}
}

@Article { KorpelainenGKAS2019,
   subid = {1298},
   title = {Atomic force microscope with an adjustable probe direction and piezoresistive cantilevers operated in tapping-mode / Im Tapping-Modus betriebenes Rasterkraftmikroskop mit einstellbarer Antastrichtung und piezoresistiven Cantilevern},
   journal = {tm - Technisches Messen},
   year = {2019},
   month = {9},
   volume = {86},
   number = {s1},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   pages = {12-16},
   keywords = {Rasterkraftmikroskopie; piezoresistive Cantilever; Nanomessmaschine},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Walter de Gruyter GmbH},
   language = {30},
   ISSN = {2196-7113, 0171-8096},
   DOI = {10.1515/teme-2019-0035},
   stag_bib_extends_levelofaccess = {NA},
   author = {Korpelainen, V. and Gr{\"o}schl, A.C. and Kl{\"o}pzig, U. and Albrecht, J. and Schaude, J.}
}

@Proceedings { BermbachSHTL2019,
   subid = {1294},
   title = {Guards and Watchdogs in One-Way Synchronization with Delay-Related Authentication Mechanisms},
   journal = {2019 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)},
   year = {2019},
   month = {9},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {1-6},
   keywords = {Synchronization, Protocols, Servers, Cryptography, Clocks, Global navigation satellite system},
   web_url = {https://doi.org/10.1109/ISPCS.2019.8886633},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IEEE},
   event_place = {Portland (Oregon) United States},
   event_name = {International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication},
   event_date = {22-09-2019 to 27-09-2019},
   language = {30},
   ISBN = {978-1-5386-7607-3, 978-1-5386-},
   ISSN = {1949-0313, 1949-0305},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.17IND06.CA.20191126},
   author = {Bermbach, R. and Sibold, D. and Heine, K. and Teichel, K. and Langer, M.}
}

@Proceedings { LuisoRBCM2019,
   subid = {1295},
   title = {Setup and Characterisation of Reference Current-to-Voltage Transformers for Wideband Current Transformers Calibration up to 2 kA},
   journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2019},
   month = {9},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {64-69},
   keywords = {wideband, current transformers, calibration, measurement uncertainty, instrument transformers, power quality},
   web_url = {https://doi.org/10.1109/AMPS.2019.8897759},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IEEE},
   event_place = {Aachen, Germany},
   event_name = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems},
   event_date = {25-09-2019 to 27-09-2019},
   language = {30},
   ISBN = {978-1-7281-0075-3, 978-1-7281-},
   ISSN = {2475-2304, 2473-1315},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.1109/AMPS.2019.8897759},
   author = {Luiso, M. and Rather, P. and Badura, H. and Chen, Y. and Mohns, E.}
}

@Proceedings { LandiGDCL2019,
   subid = {1345},
   title = {Design Approach for a Stand Alone Merging Unit},
   journal = {IMEKO TC10 2019 Conference Proceedings},
   year = {2019},
   month = {9},
   volume = {1},
   number = {1},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {107-112},
   keywords = {Power System Measurement,Power System Diagnostics,Stand Alone Merging Unit,Time Synchronization,Analog To Digital Converter},
   web_url = {https://zenodo.org/record/3600469},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IMEKO},
   event_place = {Berlin},
   event_name = {16th IMEKO TC10 Conference “Testing, Diagnostics \& Inspection as a comprehensive value chain for Quality \& Safety”},
   event_date = {03-09-2019 to 04-09-2019},
   language = {30},
   ISBN = {978-92-990084-1-6},
   ISSN = {978-92-990084-1-6},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {10.5281/zenodo.3600469},
   author = {Landi, C. and Gallo, D. and Delle Femine, A. and Cipolletta, G. and Luiso, M.}
}

@Proceedings { 50cc161b112019,
   subid = {1346},
   title = {Metrological Performances of Current Transformers Under Amplitude Modulated Currents},
   journal = {IMEKO TC10 2019 Conference Proceedings},
   year = {2019},
   month = {9},
   volume = {1},
   number = {1},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {101-106},
   keywords = {Current Transformer, Power System Diagnostics, Phasor Measurement Unit, Amplitude Modulations},
   web_url = {https://https://zenodo.org/record/3600440\#.Xh7728j7QdU},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IMEKO},
   address = {Budapest},
   event_place = {Berlin},
   event_name = {16th IMEKO TC10 Conference “Testing, Diagnostics \& Inspection as a comprehensive value chain for Quality \& Safety”},
   event_date = {03-09-2019 to 04-09-2019},
   language = {30},
   ISBN = {978-92-990084-1-6},
   ISSN = {978-92-990084-1-6},
   DOI = {10.5281/zenodo.3600440},
   stag_bib_extends_levelofaccess = {NA}
}

@Article { ReitzensteinSZBRDDDMWPOMKSSGSMoU2019,
   subid = {1363},
   title = {Method for direct coupling of a semiconductor quantum dot to an optical fiber for single-photon source applications},
   journal = {Optics Express},
   year = {2019},
   month = {9},
   volume = {27},
   number = {19},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {26772},
   keywords = {semiconductor quantum dot, single-photon source},
   web_url = {https://www.osapublishing.org/DirectPDFAccess/08FE2392-996C-94FE-814D27FFE5E6D46E_418606/oe-27-19-26772.pdf?da=1\&id=418606\&seq=0\&mobile=no},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.27.026772},
   stag_bib_extends_levelofaccess = {NA},
   author = {Reitzenstein, S. and Sęk, G. and Zschiedrich, L. and Burger, S. and Rodt, S. and Dłubek, M. and Dyrkacz, M. and Dybka, K. and Mergo, P. and W{\'o}jcik, G. and Poturaj, K. and Olszewski, J. and Mikulicz, M. and Kravets, O. and Schneider, P-I. and Schl{\"o}singer, M.J. and Gro{\ss}e, J. and Srocka, N. and Musiał, A. and Żołnacz, K. and Urbańczyk, W.}
}

@Article { Carlotti2019,
   subid = {1352},
   title = {Pushing down the lateral dimension of single and coupled magnetic dots to the nanometric scale: Characteristics and evolution of the spin-wave eigenmodes},
   journal = {Applied Physics Reviews},
   year = {2019},
   month = {9},
   volume = {6},
   number = {3},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {031304},
   keywords = {spin waves, confined modes, patterned magnetic media, magnonic crystals},
   web_url = {https://arxiv.org/abs/1908.11098v1},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {1931-9401},
   DOI = {10.1063/1.5110434},
   stag_bib_extends_levelofaccess = {NA},
   author = {Carlotti, G.}
}

@Article { KokHvvR2019,
   subid = {1380},
   title = {Current waveforms of household appliances for advanced meter testing},
   journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {Electromagnetic compatibility , static meters , interference , accuracy , testing , household appliances},
   web_url = {https://zenodo.org/record/3582391\#.XiG1P3u7KUl},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/AMPS.2019.8897771},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kok, G. and Hoogenboom, D. and van den Brom, H. and van Leeuwen, R. and Rietveld, G.}
}

@Article { RietveldKvWB2019,
   subid = {1377},
   title = {Detection Methods for Current Signals Causing Errors in Static Electricity Meters},
   journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {Power Quality  Electricity Meters  Short Time Fourier Transform  Wavelet Transform  Multiresolution Signal Decomposition  Wavelets  Smart Meters},
   web_url = {https://zenodo.org/record/3582153\#.XiGzUXu7KUm},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/EMCEurope.2019.8872120},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, G. and Kok, G.J.P and van den Brom, H.E. and Wright, P.S. and Barakou, F.}
}

@Article { LeferinkMHH2019_2,
   subid = {1384},
   title = {Why Frequency Domain Tests Like IEC 61000-4-19 Are Not Valid; a Call for Time Domain Testing},
   journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {5},
   keywords = {IEEE Keywords   Meters,  Standards,  Immunity testing,  Frequency-domain analysis,  Time-domain analysis,  Electromagnetic interference  INSPEC: Controlled Indexing   electromagnetic compatibility,  electromagnetic interference,  frequency-domain analysis,  IEC standards,  time-domain analysis  INSPEC: Non-Controlled Indexing   IEC 61000-4-19,  time domain testing,  electrical equipment testing,  electronic equipment,  differential mode disturbances,  electromagnetic interference,  time domain signals,  frequency domain tests,  static energy meters,  equipment immunity,  instance nonlinear effects,  digital sampling error effects,  nonlinear time invariant effects,  frequency 2.0 kHz to 150.0 kHz},
   web_url = {https://research.utwente.nl/en/publications/why-frequency-domain-tests-like-iec-61000-4-19-are-not-valid-a-ca},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2019.8872070},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leferink, F. and Moonen, N. and Hartman, T. and Have, B.t.}
}

@Article { vanLeeuwenHMvR2019,
   subid = {1378},
   title = {A Testbed for Static Electricity Meter Testing with Conducted EMI},
   journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {Static meters, energy measurement, standards, Electromagnetic Compatibility, EMC immunity testing, electricity meters.},
   web_url = {https://zenodo.org/record/3580444\#.XiG0OHu7KUk},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/EMCEurope.2019.8872130},
   stag_bib_extends_levelofaccess = {NA},
   author = {van Leeuwen, R. and Hoogenboom, D. and Marais, Z. and van den Brom, H.E. and Rietveld, G.}
}

@Article { LeferinkMHH2019_3,
   subid = {1383},
   title = {Inclination of Fast Changing Currents Effect the Readings of Static Energy Meters},
   journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {IEEE Keywords   Meters,  Impedance,  Current measurement,  Electromagnetic compatibility,  Power supplies,  Water pumps,  Regulators  INSPEC: Controlled Indexing   amplifiers,   electromagnetic interference,  fluorescent lamps,  LED lamps,  power meters  INSPEC: Non-Controlled Indexing   fast changing currents effect,  static energy meters,  energy readings,  reference meter,  electromagnetic interference,  fluorescent lightning,  light emitting diode lamps,  nondistorted mains power supply,  four-quadrant amplifier,  line impedance stabilization network,  pulsed current waveform},
   web_url = {https://research.utwente.nl/en/publications/inclination-of-fast-changing-currents-effect-the-readings-of-stat},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2019.8871982},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leferink, F. and Moonen, N. and Hartman, T. and Have, B.t.}
}

@Article { HoogenboomvRvMR2019,
   subid = {1379},
   title = {Sensitivity of static energy meter reading errors to changes in non-sinusoidal load conditions},
   journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {static energy meter; metering error; electromagnetic interference; accuracy; impedance; phase firing angle.},
   web_url = {https://zenodo.org/record/3580436\#.XiG00Xu7KUl},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/EMCEurope.2019.8872006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hoogenboom, D. and van Leeuwen, R. and Rietveld, G. and van den Brom, H.E. and Marais, Z. and Rens, J.}
}

@Article { LeferinkSAPH2019,
   subid = {1381},
   title = {On-site Waveform Characterization at Static Meters Loaded with Electrical Vehicle Chargers},
   journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {IEEE Keywords   Current measurement,  Meters,  Time measurement,  Electromagnetic interference,  Time-domain analysis,  Probes,   Battery charge measurement  INSPEC: Controlled Indexing   battery storage plants,  charge measurement,  electric vehicle charging,  electromagnetic interference,  statistical distributions,  time-domain analysis  INSPEC: Non-Controlled Indexing   electrical vehicle chargers,  static meter misreadings,  noisy waveforms,  electric vehicle charging stations,   on-site waveform characterization,  EV charging stations,  TEMPS software,  time domain electromagnetic interference measurement and post-processing system,  amplitude probability distribution,  APD,  EMI measurements,  baseband digitizer},
   web_url = {https://research.utwente.nl/en/publications/on-site-waveform-characterization-at-static-meters-loaded-with-el},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2019.8871469},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leferink, F. and Silva, F. and Azpurua, M.A. and Pous, M. and Hartman, T.}
}

@Article { TacheTMPMMH2019,
   subid = {1409},
   title = {Towards Accurate Analysis of Particle Size Distribution for Non-Spherically Shaped Nanoparticles as Quality Control Materials},
   journal = {Microscopy and Microanalysis},
   year = {2019},
   month = {8},
   day = {31},
   volume = {25},
   number = {Suppl. 2},
   number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements},
   pages = {2328-2329},
   keywords = {Imaging;Nanoparticles;Non-spherical;Particle size distribution;Reference material},
   web_url = {https://www.cambridge.org/core/services/aop-cambridge-core/content/view/CD48E9298865410124E22837D8CF73A0/S1431927619012376a.pdf/towards_accurate_analysis_of_particle_size_distribution_for_nonspherically_shaped_nanoparticles_as_quality_control_materials.pd},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Cambridge University Press},
   language = {30},
   ISSN = {1435-8115},
   DOI = {10.1017/S1431927619012376},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tache, O. and Testard, F. and Marguet, S. and  Pellegrino, F. and Maurino, V. and Mansfeld, U. and Hodoroaba, V.-D.}
}

@Proceedings { SauzayRJBBWS2019,
   subid = {1302},
   title = {Estimating Uncertainty in Loss Measurement of Power Transformers},
   journal = {Proceedings of the 21st International Symposium on High Voltage Engineering},
   year = {2019},
   month = {8},
   day = {30},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {power transformers, losses, measurement, uncertainty.},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   event_place = {Budapest},
   event_name = {21st International Symposium on High Voltage Engineering},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3559837},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sauzay, M. and Rietveld, G. and J{\"o}nsson, B. and Bergman, A. and Bergman, A. and Walmsley, J. and Sund, J-B.}
}

@Proceedings { CastroVWKHS2019,
   subid = {1202},
   title = {Stability of the surface passivation properties of atomic layer deposited aluminum oxide in damp heat conditions},
   journal = {AIP Conference Proceedings},
   year = {2019},
   month = {8},
   day = {27},
   volume = {2147},
   number = {1},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {050003},
   keywords = {Aluminium oxide, surface passivation, damp heat exposure, atomic layer deposition, degradation},
   web_url = {https://aip.scitation.org/doi/pdf/10.1063/1.5123852?class=pdf},
   misc2 = {EMPIR 2016: Energy},
   publisher = {AIP Publishing},
   event_place = {Leuven, Belgium},
   event_name = {SiliconPV 2019, THE 9TH INTERNATIONAL CONFERENCE ON CRYSTALLINE SILICON PHOTOVOLTAICS},
   event_date = {08-04-2019 to 10-04-2019},
   language = {30},
   ISBN = {978-0-7354-1892-9},
   ISSN = {1551-7616},
   DOI = {10.1063/1.5123852},
   stag_bib_extends_levelofaccess = {NA},
   author = {Castro, F.A. and V{\"a}h{\"a}nissi, V. and Wood, S. and Koutsourakis, G.  and Heikkinen, I.T.S. and Savin, H.}
}

@Proceedings { KhamlichiG2015,
   subid = {1097},
   title = {Calibration Setup For Traceable Measurements Of Very Fast Transients},
   journal = {Proceedings of IHS2019},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Calibration, setup, transients},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary},
   event_name = {International Symposium on High Voltage Engineering 2019},
   language = {30},
   DOI = {10.5281/zenodo.3238169},
   stag_bib_extends_levelofaccess = {NA},
   author = {Khamlichi, A. and Garnacho, F. and H{\"a}llstr{\"o}m, J. and Elg, A.P.}
}

@Proceedings { RoviraGSFA2019,
   subid = {1197},
   title = {Characterisation of high voltage dividers for X-ray measurements},
   journal = {Proceedings of IHS2019},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {High Voltage, Pulsed X-ray tube , Divider, Metrology},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary,},
   event_name = {The 21st International Symposium on High Voltage Engineering (ISH2019)},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3243494},
   author = {Rovira, J. and Garnacho, F. and Saadeddine, H. and Fortune, D. and Agazar, M.}
}

@Proceedings { HallstromMPE2019,
   subid = {1184},
   title = {High voltage topologies for very fast transient measurements},
   journal = {Proceedings of ISH2019},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {high voltage measurement, fast transients},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary},
   event_name = {21st International Symposium on High Voltage Engineering},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3244216},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"a}llstr{\"o}m, J. and Meisner, J. and Passon, S. and Elg, A-P.}
}

@Proceedings { ViniciusdLYHHFL2019,
   subid = {1187},
   title = {Comparison of Measuring Systems for Puncture Test According to IEC 61211},
   journal = {21st International Symposium on High Voltage Engineering},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {puncture test, measurement},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary},
   event_name = {21st International Symposium on High Voltage Engineering},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3243452},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Yan, W. and Li, Y. and Vinicius, M. and Filho, O. and Laiho, M.}
}

@Proceedings { KaramanDMEBHHRGG2019,
   subid = {1186},
   title = {Comparison of PD calibration capabilities in four National Metrology Institutes down to 0.1 pC},
   journal = {Proceedings of ISH2019},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {partial discharge, calibration},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary},
   event_name = {21st International Symposium on High Voltage Engineering},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3243449},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Bergman, A.E. and Elg, A-P. and Merev, A. and Dedeoğlu, S. and Karaman, I. and Rovira, J. and Garcia, T. and Garnacho, F.}
}

@Proceedings { NieminenHRGGE2019,
   subid = {1212},
   title = {Traceable measurement of transmitted overvoltages in instrument transformers},
   journal = {Proceedings of ISH2019},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Voltage instrument transformers, Transient overoltages, traceability},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary},
   event_name = {21st International Symposium on High Voltage Engineering (ISH2019)},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3244088},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nieminen, T. and H{\"a}llstr{\"o}m, J. and Rovira, J. and Garcia, T. and Garnacho, F. and Elg, A-P.}
}

@Proceedings { LehtonenHTSHM2019,
   subid = {1303},
   title = {Measuring Losses of an Air-Core Shunt Reactor with an Advanced Loss Measuring System},
   journal = {Proceedings of ISH 2019},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {Reactor, loss measurement, voltage divider, loss measuring system},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   event_place = {Budapest, Hungary},
   event_name = {21st International Symposium on High Voltage Engineering},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3521194},
   stag_bib_extends_levelofaccess = {NA},
   author = {Havunen, J. and Suomalainen, E-P. and Tornberg, J. and H{\"a}llstr{\"o}m, J. and Lehtonen, T. and Mervi{\"o}, A.}
}

@Inbook { RuttingerPGCPSKBJSBSWWS2019,
   subid = {1193},
   title = {European Research on Magnetic Nanoparticles for Biomedical Applications: Standardisation Aspects},
   year = {2019},
   month = {8},
   day = {23},
   volume = {Advances i},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {316-326},
   keywords = {magnetic nanoparticles, standardisation European research},
   web_url = {https://arxiv.org/abs/1905.08791},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer International Publishing},
   address = {Cham},
   booktitle = {Current Trends in Biomedical Engineering and Bioimages Analysis. PCBEE 2019.},
   language = {30},
   ISBN = {978-3-030-29884-5},
   DOI = {10.1007/978-3-030-29885-2_29},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"u}ttinger, Roman and Price, Alex and Gr{\"u}ttner, Cordula and Coisson, Marco and Pankhurst, Quentin and Southern, Paul and Kazakova, Olga and Baumgarten, Daniel and Johansson, Christer and Spassov, Simo and Barton, Craig and Schier, Peter and Wiekhorst, Frank and Wells, James and Steinhoff, Uwe}
}

@Article { FuenteSMDGQPR2019,
   subid = {1290},
   title = {Testing and Calibration of CDs as Radon Detectors at Highly Variable Radon Concentrations and Temperatures},
   journal = {International Journal of Environmental Research and Public Health},
   year = {2019},
   month = {8},
   day = {22},
   volume = {16},
   number = {17},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {3038},
   keywords = {radon; CD-method; blind comparison; extremely variable concentrations; unstabletemperature},
   web_url = {https://www.mdpi.com/1660-4601/16/17/3038/htm},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1660-4601},
   DOI = {10.3390/ijerph16173038},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fuente, I. and Sainz, C. and Mitev, K. and Dimitrova, I. and Georgiev, S. and Quindos Poncela, L.S. and Pressyanov, D. and Rabago, D.}
}

@Proceedings { VentreMDBCFPPRSTBASSGHBZFDKL2019,
   subid = {1200},
   title = {Metrology for Inductive Charging of Electric Vehicles (MICEV)},
   journal = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)},
   year = {2019},
   month = {8},
   day = {19},
   volume = {Electrical},
   number = {2019 AEIT},
   number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles},
   pages = {6 pages},
   keywords = {Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety},
   web_url = {http://arxiv.org/abs/1908.11108},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   event_place = {Turin (Italy)},
   event_name = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)},
   event_date = {02-07-2019 to 04-07-2019},
   language = {30},
   ISBN = {978-8-8872-3743-6},
   ISSN = {0018-9219},
   DOI = {10.23919/EETA.2019.8804498},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ventre, S. and Maffucci, A. and Dong, J. and Bauer, P. and Cirimele, V. and Freschi, F. and Pichon, L. and Puyal, E.L. and Romero, J.B. and Sainio, P. and Tammi, K. and Bergsten, T. and Ankarson, P. and Schmidt, M. and Schilling, F. and Guilizzoni, R. and Harmon, S. and Bottauscio, O. and Zucca, M. and Femia, N. and Di Capua, G. and Kuster, N. and Liorni, I.}
}

@Article { GomaZHB2019,
   subid = {1331},
   title = {Comparison of PENH, FLUKA and Geant4/TOPAS for absorbed dose calculations in air cavities representing ionization chambers in high‐energy photon and proton beams},
   journal = {Medical Physics},
   year = {2019},
   month = {8},
   day = {19},
   volume = {46},
   number = {10},
   number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398},
   pages = {4639-4653},
   keywords = {beam quality correction factors, dosimetry, high‐energy photon and proton radiation, Monte Carlo simulation, radiation therapy},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Wiley},
   language = {30},
   ISSN = {0094-2405, 2473-4209},
   DOI = {10.1002/mp.13737},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gom{\`a}, C. and Zink, K. and Horst, F. and Baumann, K.‐S.}
}

@Manual { WattsRKP2009,
   subid = {1199},
   title = {Good Practice Guide on Making Rectangular Waveguide Connections at Frequencies above 100 GHz},
   year = {2019},
   month = {8},
   day = {9},
   number2 = {17SIP08: NeWITT: New Waveguide Interfaces for Terahertz Technologies},
   keywords = {INSPEC B1310 Waveguides and microwave transmission lines, INSPEC B1320 Waveguide and microwave transmission line components, INSPEC B2180E Connectors, INSPEC B5210C Radiowave propagation,INSPEC B7130 Measurement standards and calibration},
   misc2 = {EMPIR 2017: Support for Impact},
   publisher = {Physikalisch-Technische Bundesanstalt (PTB)},
   address = {Braunschweig},
   language = {30},
   DOI = {10.7795/530.20190805},
   stag_bib_extends_levelofaccess = {NA},
   author = {Watts, J. and Ridler, N. and Kuhlmann, K. and Probst, T.}
}

@Article { WendischPMWIBABOKK2019,
   subid = {1057},
   title = {Optical Pulse-Drive for the Pulse-Driven AC Josephson Voltage Standard},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2019},
   month = {8},
   volume = {29},
   number = {5},
   number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages},
   pages = {1200205},
   keywords = {Optical pulses, Optical fibers, Optical distortion, High-speed optical techniques, Optical attenuators, Optical crosstalk},
   web_url = {https://ieeexplore.ieee.org/document/8643521},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {1051-8223, 1558-2515, 2378-707},
   DOI = {10.1109/TASC.2019.2899851},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wendisch, R. and Palafox, L. and Malmbekk, H. and Williams, J. and Ireland, J. and Behr, R. and Akram, M.N. and Bardalen, E. and Ohlckers, P.A. and Karlsen, B. and Kieler, O.}
}

@Article { AslanDSWZOY2019,
   title = {Comparison of two methods for the rapid radiochemical analysis of air dust samples in emergency situations},
   journal = {Applied Radiation and Isotopes},
   year = {2019},
   month = {8},
   volume = {150},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {120-126},
   keywords = {Emergency preparedness, airborne radioactivity, radiochemical analysis, extraction chromatography},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0969804317308229?dgcid=raven_sd_via_email},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   address = {230 Park Avenue Suite 800 Shantae McGee New York NY 10169-0935 United States},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2019.04.031},
   stag_bib_extends_levelofaccess = {NA},
   author = {Aslan, N. and Dirican, A. and Seferinoğlu, M. and Wershofen, H. and Zapata-Garc{\'i}a, D. and {\"O}z\c{c}ayan, G. and Y{\"u}cel, {\"U}.}
}

@Article { KajolinnaPP2019,
   subid = {1190},
   title = {SO2 emission measurement with the European standard reference method, EN 14791, and alternative methods – observations from laboratory and field studies},
   journal = {Journal of the Air \& Waste Management Association},
   year = {2019},
   month = {8},
   volume = {69},
   number = {9},
   number2 = {15NRM01: Sulf-Norm: Metrology for sampling and conditioning SO2 emissions from stacks},
   pages = {1122-1131},
   keywords = {SO2 emission measurement,  European standard reference method, EN 14791, alternative methods},
   web_url = {https://doi.org/10.1080/10962247.2019.1640809},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {1096-2247, 2162-2906},
   DOI = {10.1080/10962247.2019.1640809},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kajolinna, T. and Per{\"a}l{\"a}, M. and Pellikka, T.}
}

@Article { ColemanERGS2019,
   subid = {1191},
   title = {Uncertainty requirements of the European Union’s Industrial Emissions Directive for monitoring sulfur dioxide emissions: Implications from a blind comparison of sulfate measurements by accredited laboratories},
   journal = {Journal of the Air \& Waste Management Association},
   year = {2019},
   month = {8},
   volume = {69},
   number = {9},
   number2 = {15NRM01: Sulf-Norm: Metrology for sampling and conditioning SO2 emissions from stacks},
   pages = {1070-1078},
   keywords = {Uncertainty requirements, European Union’s Industrial Emissions Directive, monitoring sulfur dioxide emissions},
   web_url = {https://doi.org/10.1080/10962247.2019.1604449},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {1096-2247, 2162-2906},
   DOI = {10.1080/10962247.2019.1604449},
   stag_bib_extends_levelofaccess = {NA},
   author = {Coleman, M.D. and Ellison, M. and Robinson, R.A. and Gardiner, T.D. and Smith, T.O.M.}
}

@Article { RunzEMDKK2019,
   subid = {1205},
   title = {Polymer gel-based measurements of the isocenter accuracy in an MR-LINAC},
   journal = {Journal of Physics: Conference Series},
   year = {2019},
   month = {8},
   volume = {1305},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {012007},
   keywords = {MRgRT, dosimetry},
   web_url = {https://doi.org/10.1088/1742-6596/1305/1/012007},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1305/1/012007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Runz, A. and Elter, A. and Mann, P. and Dorsch, S. and Kl{\"u}ter, S. and Karger, C.P.}
}

@Article { CinelliNViePG2019,
   subid = {1216},
   title = {Qualitative overview of indoor radon surveys in Europe},
   journal = {Journal of Environmental Radioactivity},
   year = {2019},
   month = {8},
   volume = {204},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {163-174},
   keywords = {metroRADON, indoor radon surveys, representativeness},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0265-931X},
   DOI = {10.1016/j.jenvrad.2019.04.010},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cinelli, G. and Nikolić, J.K. and Vukanac, I. and Živanović, M. and Čeliković, I. and Pantelić, G. and Gruber, V.}
}

@Article { NahleMLKKEBBPRR2019,
   subid = {1235},
   title = {Development of a beta spectrometry setup using metallic magnetic calorimeters},
   journal = {Journal of Instrumentation},
   year = {2019},
   month = {8},
   volume = {14},
   number = {08},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {P08012-P08012},
   keywords = {Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/14/08/P08012},
   stag_bib_extends_levelofaccess = {NA},
   author = {N{\"a}hle, O. and Mariam, R. and Loidl, M. and Kossert, K. and Kempf, S. and Enss, C. and Bockhorn, L. and Beyer, J. and Paulsen, M. and Ranitzsch, P. and Rodrigues, M.}
}

@Article { KotilHHSK2019,
   subid = {1242},
   title = {Analysis of elemental composition and porosity of mesoporous iridium-titanium mixed oxide thin films for energy application by SEM/EDS},
   journal = {Microscopy and Microanalysis},
   year = {2019},
   month = {8},
   volume = {25},
   number = {S2},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {1770-1771},
   keywords = {oxide thin films},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Cambridge University Press (CUP)},
   language = {30},
   ISSN = {1431-9276, 1435-8115},
   DOI = {10.1017/S1431927619009589},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kotil, L. and Hertwig, A. and Hodoroaba, V.-D. and Sachse, R. and Kraehnert, R.}
}

@Article { GennserCPBBMCKCRMBJDH2019,
   subid = {1311},
   title = {Quantum tomography of electrical currents},
   journal = {Nature Communications},
   year = {2019},
   month = {7},
   day = {29},
   volume = {10},
   number = {1},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   keywords = {Electronic wavefunction, Quantum tomography},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-019-11369-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bisognin, R. and Marguerite, A. and Roussel, B. and Kumar, M. and Cabart, C. and Chapdelaine, C. and Mohammad-Djafari, A. and Berroir, J.-M. and Bocquillon, E. and Pla\c{c}ais, B. and Cavanna, A. and Gennser, U. and Jin, Y. and Degiovanni, P. and F{\`e}ve, G.}
}

@Article { OrtolanoARCETCZSCC2019,
   subid = {1227},
   title = {Mapping the conductivity of graphene with Electrical Resistance Tomography},
   journal = {Scientific Reports},
   year = {2019},
   month = {7},
   day = {23},
   volume = {9},
   number = {1},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   keywords = {graphene, electrical resistance tomography, conductivity, terahertz spectroscopy},
   web_url = {https://doi.org/10.1038/s41598-019-46713-8},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-46713-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ortolano, M. and Arnedo, I. and Redo-Sanchez, A. and Cordon, A. and Etayo, D. and Txoperena, O. and Centeno, A. and Zurutuza, A. and Serazio, D. and Cultrera, A. and Callegaro, L.}
}

@Article { SOCHOROVARLLKFDCCBBT2019,
   subid = {1285},
   title = {Activity measurements and determination of nuclear decay data of 166Ho in the MRTDosimetry project},
   journal = {Applied Radiation and Isotopes},
   year = {2019},
   month = {7},
   day = {20},
   volume = {153},
   number = {November 2},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   pages = {1-11},
   keywords = {Ho166, Activity standardization, gamma-spectrometry, Half-life measurements, Molecular radiotherapy, MRTDosimetry},
   misc2 = {EMPIR 2015: Health},
   publisher = {Elsevier},
   language = {30},
   DOI = {10.1016/j.apradiso.2019.108826},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sochorov{\'a}, J. and Robinson, A. and Lourenco, V. and L{\'e}py, M.C. and Keightley, J. and FENWICK, A. and Dry{\'a}k, P. and COLLINS, S. and CHISTE, V. and BOUCHARD, J. and Bobin, C. and THIAM, C.}
}

@Article { ShardCHS2019,
   subid = {1182},
   title = {Summary of ISO/TC 201 Standard: ISO 22415—Surface chemical analysis—Secondary ion mass spectrometry—Method for determining yield volume in argon cluster sputter depth profiling of organic materials},
   journal = {Surface and Interface Analysis},
   year = {2019},
   month = {7},
   day = {15},
   number2 = {15SIP02: ISOChemDepth: An International Standard for Reliable Chemical Depth Profiling of Organic Materials},
   keywords = {ISO, standard, SIMS, sputtering, yield volumes},
   web_url = {https://doi.org/10.1002/sia.6686},
   misc2 = {EMPIR 2015: Support for Impact},
   publisher = {Wiley},
   language = {30},
   ISSN = {0142-2421, 1096-9918},
   DOI = {10.1002/sia.6686},
   stag_bib_extends_levelofaccess = {NA},
   author = {Shard, A.G. and CLIFFORD, C. and Havelund, R. and Seah, M.P.}
}

@Article { RedshawQPMIHGEDBSRY2019,
   title = {Direct determination of the La138\(\beta\)-decay Q value using Penning trap mass spectrometry},
   journal = {Physical Review C},
   year = {2019},
   month = {7},
   day = {11},
   volume = {100},
   number = {1},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {014308},
   keywords = {138La, high-precision Q-values, mass spectrometry, Penning trap},
   web_url = {https://arxiv.org/abs/1904.12076v2},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9985, 2469-9993},
   DOI = {10.1103/PhysRevC.100.014308},
   stag_bib_extends_levelofaccess = {NA},
   author = {Redshaw, M. and Quarati, F. G. A. and Puentes, D. and Mougeot, X. and Izzo, C. and Hamaker, A. and Gulyuz, K. and Eibach, M. and Dissanayake, J. and Bollen, G. and Sandler, R. and Ringle, R. and Yandow, I.}
}

@Article { LandiGDL2019,
   subid = {1344},
   title = {The Design of a Low Cost Phasor Measurement Unit},
   journal = {MDPI Energies},
   year = {2019},
   month = {7},
   day = {10},
   volume = {12},
   number = {14},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {2648},
   keywords = {Power System Measurement, Phasor Measurement Unit, low cost, synchrophasor, voltage measurement, current measurement, synchronization},
   web_url = {https://www.mdpi.com/1996-1073/12/14/2648/htm},
   misc2 = {EMPIR 2017: Industry},
   publisher = {MDPI},
   language = {30},
   ISSN = {1996-1073},
   DOI = {10.3390/en12142648},
   stag_bib_extends_levelofaccess = {NA},
   author = {Landi, C. and Gallo, D. and Delle Femine, A. and Luiso, M.}
}

@Article { ImbraguglioDSMG2019,
   subid = {1178},
   title = {Determination of the thermodynamic temperature between 236 K and 430 K from speed of sound measurements in helium},
   journal = {Metrologia},
   year = {2019},
   month = {7},
   volume = {56},
   number = {4},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {045006},
   keywords = {Boltzmann constant, acoustic gas thermometry, primary thermometry, ITS-90},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab29a2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Imbraguglio, D and Dematteis, R. and Steur, P.P.M. and Madonna Ripa, D. and Gavioso, R.M.}
}

@Article { VasilatouAH2019_2,
   subid = {1220},
   title = {Facility for calibration of optical and condensation particle counters based on a turbulent aerosol mixing tube and a reference optical particle counter},
   journal = {Review of Scientific Instruments},
   year = {2019},
   month = {7},
   volume = {90},
   number = {7},
   number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality},
   pages = {075111},
   keywords = {optical particle counters, aerosol instrumentation, aerosol generation setup, turbulent flow tube, particle homogenization, isokinetic sampling ports, particle counter, Stable and reproducible aerosols, polystyrene latex particles},
   web_url = {https://aip.scitation.org/doi/10.1063/1.5095853},
   misc2 = {EMPIR 2016: Environment},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.5095853},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vasilatou, K. and Auderset, K. and Horender, S.}
}

@Article { Turrion2019,
   subid = {1221},
   title = {Theoretical evaluation of the impact of finite intervals in the measurement of the bidirectional reflectance distribution function},
   journal = {Journal of Coatings Technology and Research},
   year = {2019},
   month = {7},
   number2 = {16NRM08: BiRD: Bidirectional reflectance definitions},
   pages = {1-10},
   keywords = {Reflection BSDF, BRDF, and BTDF Scattering measurements Metrology},
   web_url = {https://link.springer.com/article/10.1007/s11998-019-00241-2},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1547-0091, 1935-3804},
   DOI = {10.1007/s11998-019-00241-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Turri{\'o}n, A.}
}

@Thesis { Tampellini2019,
   subid = {1228},
   title = {Coherent fibre-optic link: applications in Time and Frequency Metrology, Geodesy, Radioastronomy and Seismology},
   year = {2019},
   month = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {Time and Frequency metrology; frequency dissemination; optical fibres},
   web_url = {https://iris.polito.it/handle/11583/2742522?mode=simple.8877\#.XaRMLX_gpaQ},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Politecnico di Torino},
   address = {Torino},
   school = {Politecnico di Torino},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://iris.polito.it/retrieve/handle/11583/2742522/258655/Thesis_Tampellini.pdf},
   author = {Tampellini, A.}
}

@Article { CalonicoLPCB2019,
   title = {Spectral purity transfer with 5 \(\times\) 10−17 instability at 1 s using a multibranch Er:fiber frequency comb},
   journal = {Metrologia},
   year = {2019},
   month = {7},
   volume = {56},
   number = {4},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {045008},
   keywords = {optical frequency comb, multibranch Er:fiber comb, spectral purity transfer,ultrastable laser},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab2b0f},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calonico, D. and Levi, F. and Pizzocaro, M. and Clivati, C. and Barbieri, P.}
}

@Article { PollakowskiMKNDHB2019,
   subid = {1267},
   title = {Reference-free grazing incidence x-ray fluorescence and reflectometry as a methodology for independent validation of x-ray reflectometry on ultrathin layer stacks and a depth-dependent characterization},
   journal = {Journal of Vacuum Science \& Technology A},
   year = {2019},
   month = {7},
   volume = {37},
   number = {4},
   number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques},
   pages = {041502},
   keywords = {XRR, GIXRF, nanolayers},
   web_url = {https://arxiv.org/abs/1903.01196},
   misc2 = {EMPIR 2017: Support for Impact},
   publisher = {American Vacuum Society},
   language = {30},
   ISSN = {0734-2101, 1520-8559},
   DOI = {10.1116/1.5094891},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pollakowski, B. and M{\"u}hle, U. and Kayser, Y. and Nolot, E. and Detlefs, B. and Honicke, P. and Beckhoff, B.}
}

@Article { MichlerJPPON2019,
   subid = {1292},
   title = {Coherence and indistinguishability of highly pure single photons from non-resonantly and resonantly excited telecom C-band quantum dots},
   journal = {Applied Physics Letters},
   year = {2019},
   month = {7},
   volume = {115},
   number = {2},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {023103-5},
   keywords = {InAs/InGaAs/GaAs quantum dots, telecom C-band, Fourier-transform spectroscopy, two-photon excitation},
   web_url = {https://aip.scitation.org/doi/full/10.1063/1.5095196},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/1.5095196},
   stag_bib_extends_levelofaccess = {NA},
   author = {Michler, P. and Jetter, M. and Portalupi, S.L. and Paul, M. and Olbrich, F. and Nawrath, C.}
}

@Article { KeyerMHtL2019,
   subid = {1319},
   title = {Faulty Readings of Static Energy Meters Caused by Conducted Electromagnetic Interference from a Water Pump},
   journal = {Renewable Energy and Power Quality Journal},
   year = {2019},
   month = {7},
   volume = {17},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {15-19},
   keywords = {Static Meter, Smart Meter, Electronic Meter, Conducted Interference, Electromagnetic Compatibility},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {AEDERMACP (European Association for the Development of Renewable Energies and Power Quality)},
   language = {30},
   ISSN = {2172-038X},
   DOI = {doi.org/10.24084/repqj17.205},
   stag_bib_extends_levelofaccess = {NA},
   author = {Keyer, C. and Moonen, N. and Hartman, T. and ten Have, B. and Leferink, F.}
}

@Article { SchmidtCOHBMLK2019,
   subid = {1340},
   title = {A cryogenic radio-frequency ion trap for quantum logic spectroscopy of highly charged ions},
   journal = {Review of Scientific Instruments},
   year = {2019},
   month = {7},
   volume = {90},
   number = {7},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   pages = {073201},
   keywords = {Optical ClocksTrapped Ions},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.5100594},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmidt, P. O. and Crespo L{\'o}pez-Urrutia, J. R. and Ospelkaus, C. and Heip, J. C. and Bautista-Salvador, A. and Micke, P. and Leopold, T. and King, S. A.}
}

@Article { AdibekyanKMH2019,
   subid = {1287},
   title = {Characterization, calibration and validation of an industrial emissometer},
   journal = {Journal of Sensors and Sensor Systems},
   year = {2019},
   month = {6},
   day = {27},
   volume = {8},
   number = {1},
   number2 = {16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials},
   pages = {233-242},
   keywords = {emissivity, TIR 100-2 emissometer, characterization, calibration, reflective foils},
   web_url = {https://www.j-sens-sens-syst.net/8/233/2019/},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {2194-878X},
   DOI = {10.5194/jsss-8-233-2019},
   stag_bib_extends_levelofaccess = {NA},
   author = {Adibekyan, Albert and Kononogova, Elena and Monte, Christian and Hollandt, J{\"o}rg}
}

@Article { LeitoK2019,
   subid = {1408},
   title = {Generalization of Acid‐Base Diagrams Based on the Unified pH‐Scale},
   journal = {ChemPhysChem},
   year = {2019},
   month = {6},
   day = {26},
   volume = {20},
   number = {14},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   pages = {1779-1785},
   keywords = {electrochemistry nonaqueous solventspH-lgci diagramsproton transfer reactionsunified pH scale},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Wiley},
   language = {30},
   ISSN = {1439-4235, 1439-7641},
   DOI = {10.1002/cphc.201900388},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leito, I. and Kahlert, H.}
}

@Article { HibberdMOCORMOPVHC2019,
   subid = {1159},
   title = {Integrating informatics tools and portable sequencing technology for rapid detection of resistance to anti-tuberculous drugs},
   journal = {Genome Medicine},
   year = {2019},
   month = {6},
   day = {24},
   volume = {11},
   number = {1},
   number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance},
   pages = {41},
   keywords = {whole genome sequencing, drug resistance, tuberculosis},
   web_url = {https://genomemedicine.biomedcentral.com/articles/10.1186/s13073-019-0650-x},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1756-994X},
   DOI = {10.1186/s13073-019-0650-x},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hibberd, M.L. and McNerney, R. and O’Grady, J. and Campino, S. and Oppong, Y.E.A. and Ramos, J. and Machado, D. and O’Sullivan, D.M. and Phelan, J.E. and Viveiros, M. and Huggett, J.F. and Clark, T.G.}
}

@Article { IacomussiVR2019,
   subid = {1277},
   title = {Innovative Design And Metrological Approaches To Smart Lighting},
   journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE},
   year = {2019},
   month = {6},
   day = {24},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   keywords = {Smart lighting, Road lighting, ILMD detector, Pedestrian safety, Systemic Design, Design by Components, Design Network, SURFACE, EMPIR},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {International Commission on Illumination, CIE},
   language = {30},
   DOI = {10.25039/x46.2019.PO192},
   stag_bib_extends_levelofaccess = {NA},
   author = {Iacomussi, P. and Valpreda, Fab. and Rossi, G.}
}

@Article { DRONNEAUFBMG2019,
   subid = {1275},
   title = {Use Of An Imaging Luminance Measuring Device To Evaluate Road Lighting Performance At Different Angles Of Observation},
   journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE},
   year = {2019},
   month = {6},
   day = {24},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   keywords = {road lighting, dynamic luminance measurements, Imaging Luminance Measuring Device (ILMD), moving observer, angles of observation, 16NRM02},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {International Commission on Illumination, CIE},
   language = {30},
   DOI = {10.25039/x46.2019.OP75},
   stag_bib_extends_levelofaccess = {NA},
   author = {DRONNEAU, R. and FOURNELA, F. and BOUCHER, V. and Muzet, V. and GREFFIER, F.}
}

@Article { RossiI2019,
   subid = {1276},
   title = {Influence Of Material Characterization In The Design Of Tunnel Lighting Installations},
   journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE},
   year = {2019},
   month = {6},
   day = {24},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   keywords = {Road tunnel lighting, energy savings, SURFACE, EMPIR, luminance coefficient, r- tables.},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {International Commission on Illumination, CIE},
   language = {30},
   DOI = {10.25039/x46.2019.OP74},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rossi, G. and Iacomussi, P.}
}

@Article { VernyGM2019,
   subid = {1274},
   title = {Optimization Of Road Surface Reflections Properties And Lighting: Learning Of A Three-Year Experiment},
   journal = {Proceedings of the 29th Quadrennial Session of the CIE},
   year = {2019},
   month = {6},
   day = {24},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   keywords = {Road photometry, Adaptative road lighting, Real-site experiment, Time evolution, Obtrusive ligh, 16NRM02},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {International Commission on Illumination, CIE},
   language = {30},
   DOI = {10.25039/x46.2019.OP72},
   stag_bib_extends_levelofaccess = {NA},
   author = {Verny, P. and GREFFIER, F. and Muzet, V.}
}

@Article { GandonLegerTCMC2019,
   subid = {1278},
   title = {Towards An Optimization Of Urban Lighting Through A Combined Approach Of Lighting And Road Building Activities},
   journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE},
   year = {2019},
   month = {6},
   day = {24},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   keywords = {Road photometry, Road lighting design, Gonioreflectometer,16NRM02},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {International Commission on Illumination, CIE},
   language = {30},
   DOI = {10.25039/x46.2019.PP23},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gandon-Leger, P. and Toinette, M. and Colomb, M. and Muzet, V. and Christory, J.P.}
}

@Article { IacomussiR2019,
   subid = {1279},
   title = {The Veiling Luminance In Tunnel Lighting Installation},
   journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE},
   year = {2019},
   month = {6},
   day = {24},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   keywords = {Tunnel, lighting, 16NRM02},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {International Commission on Illumination, CIE},
   address = {Babenbergerstrasse 9/9A Vienna 1010 Austria},
   language = {30},
   DOI = {10.25039/x46.2019.PP28},
   stag_bib_extends_levelofaccess = {NA},
   author = {Iacomussi, P. and Rossi, G.}
}

@Article { BrinkmannMSBLI2019,
   subid = {1322},
   title = {3D nonrigid motion correction for quantitative assessment of hepatic lesions in DCE‐MRI},
   journal = {Magnetic Resonance in Medicine},
   year = {2019},
   month = {6},
   day = {22},
   volume = {82},
   number = {5},
   number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion},
   pages = {1753-1766},
   keywords = {quantification, nonrigid motion correction, hepatic lesions, DCE-MRI},
   misc2 = {EMPIR 2015: Health},
   publisher = {Wiley},
   language = {30},
   ISSN = {0740-3194, 1522-2594},
   DOI = {10.1002/mrm.27867},
   stag_bib_extends_levelofaccess = {NA},
   author = {Brinkmann, C. and Makowski, M. R. and Schaeffter, T. and Brenner, W. and Lukas, M. and Ippoliti, M.}
}

@Proceedings { KrokerWSDKB2019,
   subid = {1281},
   title = {Mueller matrix ellipsometry for enhanced optical form metrology of sub-lambda structures},
   journal = {Modeling Aspects in Optical Metrology VII},
   year = {2019},
   month = {6},
   day = {21},
   volume = {11057},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {155-165},
   keywords = {Plasmonics, Ellipsometry, Scanning electron microscopy, Numerical simulations, Metrology, Nanostructures, Near field optics},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {SPIE},
   event_place = {Munich},
   event_name = {International Society for Optics and Photonics Optical Metrology},
   event_date = {24-06-2019 to 27-06-2019},
   language = {30},
   DOI = {10.1117/12.2527419},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kroker, S. and Wurm, M. and Siefke, T. and Dickmann, J. and K{\"a}seberg, T. and Bodermann, B.}
}

@Proceedings { MontavonPS2019,
   subid = {1387},
   title = {Model-based interfacing of large-scale metrology instruments},
   journal = {Multimodal Sensing: Technologies and Applications},
   year = {2019},
   month = {6},
   day = {21},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   keywords = {Large-Scale Metrology, Internet of Production, Cyper Physical Production Systems},
   web_url = {http://arxiv.org/abs/2001.05897},
   misc2 = {EMPIR 2017: Industry},
   publisher = {SPIE},
   event_place = {Munich},
   event_name = {SPIE Optical Metrology},
   event_date = {24-06-2019 to 28-06-2019},
   language = {30},
   DOI = {10.1117/12.2527461},
   stag_bib_extends_levelofaccess = {NA},
   author = {Montavon, B. and Peterek, M. and Schmitt, R.H.}
}

@Article { PoikonenLGKKTDFPKI2019,
   subid = {1201},
   title = {Validation of the fisheye camera method for spatial non-uniformity corrections in luminous flux measurements with integrating spheres},
   journal = {Metrologia},
   year = {2019},
   month = {6},
   day = {18},
   volume = {56},
   number = {4},
   number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products},
   pages = {045002},
   keywords = {fisheye camera method, integrating sphere, luminous flux, spatial correction, angular intensity distribution, photometry, measurement uncertainty},
   web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/ab17fe/meta},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {-},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.1088/1681-7575/ab17fe},
   author = {Poikonen, T. and Ludwig, K. and Gerloff, T. and Klej, A. and Kliment, P. and Thorseth, A. and Dekker, P. and Ferrero, A. and Pulli, T. and Kokka, A. and Ikonen, E.}
}

@Article { PraakMUP2019,
   subid = {1327},
   title = {The Influence of the Cornea on Intraocular Pressure Measurement by ICARE PRO and ORA},
   journal = {Czech and Slovak Ophthalmology},
   year = {2019},
   month = {6},
   day = {15},
   volume = {75},
   number = {3},
   number2 = {16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements},
   pages = {111-118},
   keywords = {intraocular pressure, ICARE, ORA, corneal hysteresis, central corneal thickness},
   web_url = {http://www.cs-ophthalmology.cz/cs/journal/2019/3/1},
   misc2 = {EMPIR 2016: Research Potential},
   publisher = {Czech Society of Ophthalmology of the CzMA},
   language = {30},
   ISSN = {1211-9059, 1805-4447},
   DOI = {10.31348/2019/3/1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pluh{\'a}ček, F. and Unzeitigov{\'a}, A. and Marešov{\'a}, K. and Ryb{\'a}ř, J.}
}

@Article { MottonenRKBYFGK2019,
   subid = {1110},
   title = {Evidence for universality of tunable-barrier electron pumps},
   journal = {Metrologia},
   year = {2019},
   month = {6},
   day = {13},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Single electron pumps, electrical metrology, quantum electrical standards},
   web_url = {https://arxiv.org/abs/1901.05218},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab29a5},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\"o}tt{\"o}nen, M. and Rossi, A. and Kim, N. and Bae, M.H. and Yamahata, G. and Fujiwara, A. and Giblin, S. and Kataoka, M.}
}

@Article { HannNFSTK2019,
   subid = {1196},
   title = {FI-ICP-TOFMS for quantification of biologically essential trace elements in cerebrospinal fluid – high-throughput at low sample volume},
   journal = {The Analyst},
   year = {2019},
   month = {6},
   day = {11},
   volume = {144},
   number = {15},
   number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease},
   pages = {4653-4660},
   keywords = {cerebrospinal fluid, FI-ICP-TOFMS, quantification of biologically essential trace elements},
   web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2019/AN/C9AN00039A\#!divAbstract},
   misc2 = {EMPIR 2015: Health},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {0003-2654, 1364-5528},
   DOI = {10.1039/C9AN00039A},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hann, S. and Neumayer, S. and Fischer, L. and Schoeberl, A. and Theiner, S. and Koellensperger, G.}
}

@Article { ThorwarthDKP2019,
   subid = {1141},
   title = {A finite element method for the determination of the relative response of ionization chambers in MR-linacs: simulation and experimental validation up to 1.5 T},
   journal = {Physics in Medicine and Biology},
   year = {2019},
   month = {6},
   day = {10},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   keywords = {MRgRT, reference dosimetry, magnetic field},
   web_url = {https://doi.org/10.1088/1361-6560/ab2837},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/ab2837},
   stag_bib_extends_levelofaccess = {NA},
   author = {Thorwarth, D. and Dohm, O.S. and Kapsch, R.P. and Pojtinger, S.}
}

@Article { CelepPGDH2019,
   subid = {1070},
   title = {Harmonics Effects on Microwave Power Measurement Using Diode Sensors},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {6},
   volume = {68},
   number = {6},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {1852-1859},
   keywords = {Diode detector, Harmonic effect, Microwave measurements, Microwave power, Power sensor},
   web_url = {https://ieeexplore.ieee.org/document/8700278},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2019.2905885},
   stag_bib_extends_levelofaccess = {NA},
   author = {Celep, M. and Pavlicek, T. and Grajciar, J. and Drazil, K. and Hudlicka, M.}
}

@Article { BeckerGKDS2019,
   subid = {1104},
   title = {Electrometer Calibration With Sub-Part-Per-Million Uncertainty},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {6},
   volume = {68},
   number = {6},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {1887-1894},
   keywords = {Ammeters, calibration, current measurement, measurement standards, measurement uncertainty, precisionmeasurements},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2019.2900129},
   stag_bib_extends_levelofaccess = {NA},
   author = {Becker, U. and G{\"o}tz, M. and Krause, C. and Drung, D. and Scherer, H.}
}

@Article { PottieLATMQFCX2019,
   subid = {1117},
   title = {Two-Branch Fiber Link for International Clock Networks},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {6},
   volume = {68},
   number = {6},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {2195-2200},
   keywords = {Optical fiber links, phase lock loop, phase measurement, two-way noise compensation, ultrastable frequencytransfer},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2018.2886865},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pottie, P.E. and Lopez, O. and Amy-Klein, A. and Tuckey, P. and Meynadier, F. and Quintin, N. and Frank, F. and Cantin, E. and Xu, D.}
}

@Article { SchererGDG2019,
   subid = {1109},
   title = {Interlaboratory Nanoamp Current Comparison With Subpart-Per-Million Uncertainty},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {6},
   volume = {68},
   number = {6},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {1996-2002},
   keywords = {Small current measurements, high resistance measurements, interlab comparisons, ULCA, electrical transfer standards, transimpedance amplifiers},
   web_url = {https://arxiv.org/abs/1808.09741},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2018.2879126},
   stag_bib_extends_levelofaccess = {NA},
   author = {Scherer, H. and G{\"o}tz, M. and Drung, D. and Giblin, S.P.}
}

@Article { vandenBromHHBKWI2019,
   subid = {1154},
   title = {An Optoelectronic Pulse Drive for Quantum Voltage Synthesizer},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {6},
   volume = {68},
   number = {6},
   number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages},
   pages = {2066-2071},
   keywords = {Josephson arbitrary waveform synthesizer, Josephson arrays, measurement, metrology, optoelectronics, voltage measurement},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2018.2877562},
   stag_bib_extends_levelofaccess = {NA},
   author = {van den Brom, H.E. and Hornecker, R. and Houtzager, E. and Behr, R. and Kieler, O. and Williams, J. and Ireland, J.}
}

@Article { GulmezHGE2019,
   subid = {1137},
   title = {Reference Ultralow DC Current Source Between 1 fA and 100 pA at T{\"U}BİTAK UME},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {6},
   volume = {68},
   number = {6},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {2201-2207},
   keywords = {Capacitors,  Standards,  Voltage measurement,  Temperature measurement,  Temperature sensors,  Current measurement,  Uncertainty},
   web_url = {https://arxiv.org/abs/1907.01389},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2019.2895435},
   stag_bib_extends_levelofaccess = {NA},
   author = {G{\"u}lmez, Y. and Hayırlı, C. and G{\"u}lmez, G. and Erkan, {\"O}.}
}

@Article { RoscoeRJDW2019,
   subid = {1185},
   title = {Field Measurement of Frequency and ROCOF in the Presence of Phase Steps},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {6},
   volume = {68},
   number = {6},
   number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids},
   pages = {1688-1695},
   keywords = {ROCOF, Instruments, Frequency measurement, Phase measurement, Relays, Power system stability, Phasor measurement units, Sea measurements,},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2018.2882907},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roscoe, A. J. and Rietveld, G. and Johnstone, K. and Davis, P. and Wright, P..}
}

@Article { BursikovaKC2019,
   title = {Fast mechanical model for probe–sample elastic deformation estimation in scanning probe microscopy},
   journal = {Ultramicroscopy},
   year = {2019},
   month = {6},
   volume = {201},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   pages = {18-27},
   keywords = {Scanning Probe Microscopy,Uncertainty,Elastic deformation},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0304399118302638},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0304-3991},
   DOI = {10.1016/j.ultramic.2019.03.010},
   stag_bib_extends_levelofaccess = {NA},
   author = {Burš{\'i}kov{\'a}, V.  and Klapetek, P. and Charv{\'a}tov{\'a} Campbell, A.}
}

@Article { TeodoroFBS2019,
   subid = {1265},
   title = {3D-Simulation of a Bayard Alpert ionisation gauge using SIMION program},
   journal = {Vacuum},
   year = {2019},
   month = {6},
   volume = {164},
   number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge},
   pages = {300-307},
   keywords = {Vacuum measurementIonisation gaugeSimulationGauge sensitivity},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0042-207X},
   DOI = {doi.org/10.1016/j.vacuum.2019.03.039},
   stag_bib_extends_levelofaccess = {NA},
   author = {Teodoro, O. and Fonseca, A.L. and Bundaleski, N. and Silva, R.}
}

@Article { KorpelainenBDS2019,
   subid = {1297},
   title = {Tip wear and tip breakage in high-speed atomic force microscopes},
   journal = {Ultramicroscopy},
   year = {2019},
   month = {6},
   volume = {201},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   pages = {28-37},
   keywords = {Atomic force microscopy (AFM), High-speed AFM, Tip wear, Tip breakage, Tip characterization, Tip-sample interaction},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0304-3991},
   DOI = {10.1016/j.ultramic.2019.03.013},
   stag_bib_extends_levelofaccess = {NA},
   author = {Korpelainen, V. and Bergmann, D. and Dai, G. and Strahlendorff, T.}
}

@Proceedings { Buermann2019,
   subid = {1323},
   title = {Steps Towards Personalized Dosimetry in Computed Tomography},
   journal = {Book of Extended Synopses},
   year = {2019},
   month = {6},
   number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion},
   pages = {216-217},
   keywords = {dosimetry, personalised medicine, CT},
   misc2 = {EMPIR 2015: Health},
   publisher = {International Atomic Energy Agency},
   event_place = {Vienna, Austria},
   event_name = {International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry (IDOS 2019)},
   event_date = {18-06-2019 to 21-06-2019},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.iaea.org/sites/default/files/19/06/cn-273-book-extended-synopses.pdf},
   author = {B{\"u}ermann, L.}
}

@Article { LeferinkMHH2019,
   subid = {1382},
   title = {Misreadings of Static Energy Meters due to Conducted EMI caused by Fast Changing Current},
   journal = {2019 Joint International Symposium on Electromagnetic Compatibility, Sapporo and Asia-Pacific International Symposium on Electromagnetic Compatibility (EMC Sapporo/APEMC)},
   year = {2019},
   month = {6},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {4},
   keywords = {IEEE Keywords   Meters,  Regulators,  Water pumps,  Current measurement,  Impedance,  Power measurement,  Voltage measurement  INSPEC: Controlled Indexing   amplifiers,  electromagnetic interference,  power meters,  water pumps  INSPEC: Non-Controlled Indexing   static energy meters,  conducted EMI,  conducted electromagnetic interference ,   water pump,  speed regulators,  reference meter,  fast changing current,  four-quadrant amplifier},
   web_url = {https://research.utwente.nl/en/publications/misreadings-of-static-energy-meters-due-to-conducted-emi-caused-b},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.23919/EMCTokyo.2019.8893903},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leferink, F. and Moonen, N. and Hartman, T. and Have, B. t.}
}

@Proceedings { PeinerF2019,
   subid = {1404},
   title = {Entwicklung eines taktilen Mikrotaster-Messsystems f{\"u}r Hochgeschwindigkeitsmessung von Form, Rauheit und mechanischen Eigenschaften},
   journal = {20. GMA/ITG-Proceedings: Fachtagung Sensoren und Messsysteme 2019},
   year = {2019},
   month = {6},
   volume = {2019},
   number = {P2: Messsy},
   number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements},
   pages = {720-725},
   keywords = {Mikrotaster, Cantilever-Sensor, Kontaktresonanzspektroskopie, Modellierung, Messdatenauswertung},
   web_url = {https://www.ama-science.org/proceedings/details/3479},
   misc2 = {EMPIR 2017: Industry},
   publisher = {AMA Service GmbH},
   event_place = {N{\"u}rnberg},
   event_name = {20. GMA/ITG-Fachtagung Sensoren und Messsysteme 2019},
   event_date = {25-06-2019 to 26-06-2019},
   language = {43},
   ISBN = {978-3-9819376-0-2},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {DOI 10.5162/sensoren2019/P2.10},
   author = {Peiner, E. and Fahrbach, M.}
}

@Article { IvanovGWRBBR2019,
   subid = {1128},
   title = {Complete dissolution of solid matrices using automated borate fusion in support of nuclear decommissioning and production of reference materials},
   journal = {Journal of Radioanalytical and Nuclear Chemistry},
   year = {2019},
   month = {5},
   day = {28},
   volume = {321},
   number = {1},
   number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities},
   pages = {183-196},
   keywords = {Fusion, dissolution, radionuclide, decommissioning, reference material, characterisation},
   web_url = {https://link.springer.com/article/10.1007/s10967-019-06572-z},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Springer Science and Business Media LLC},
   address = {233 Spring St. New York NY 10013 United States},
   language = {30},
   ISSN = {0236-5731, 1588-2780},
   DOI = {10.1007/s10967-019-06572-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ivanov, P. and Garc{\'i}a-Miranda, M. and Woods, S. and Russell, B. and Braysher, E. and Bouchard, B. and Read, D.}
}

@Article { WolthausRLdvvW2019,
   subid = {1144},
   title = {Technical Note: Consistency of PTW 30013 and FC 65‐G ion chamber magnetic field correction factors},
   journal = {Medical Physics},
   year = {2019},
   month = {5},
   day = {27},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   keywords = {Reference dosimetry, MRgRT, ionisation chamber},
   misc2 = {EMPIR 2015: Health},
   publisher = {Wiley},
   language = {30},
   ISSN = {0094-2405, 2473-4209},
   DOI = {10.1002/mp.13623},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wolthaus, J.W.H and Raaymakers, B.W and Lagendijk, J.J.W and de Prez, L.A. and van Soest, T.L. and van Asselen, B. and Woodings, S.J.}
}

@Article { UrsinTSFC2019,
   subid = {1349},
   title = {Hong-Ou-Mandel interferometry on a biphoton beat note},
   journal = {npj Quantum Information},
   year = {2019},
   month = {5},
   day = {24},
   volume = {5},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   keywords = {quantum metrology, Hong-Ou-Mandel},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2056-6387},
   DOI = {10.1038/s41534-019-0161-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ursin, R. and Torres, J.P. and Steinlechner, F. and Fink, M. and Chen, Y.}
}

@Article { MainzBGWSZW2019,
   subid = {1206},
   title = {Photon flux determination of a liquid-metal jet X-ray source by means of photon scattering},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2019},
   month = {5},
   day = {23},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   keywords = {Liquid-metal jet, X-ray sources, photon flux determination,  elastic and inelastic photon scattering},
   web_url = {https://arxiv.org/abs/1903.06024},
   misc2 = {EMPIR 2016: Energy},
   language = {30},
   DOI = {10.1039/C9JA00127A},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mainz, R. and Beckhoff, B. and Genzel, C. and Weser, J. and Streeck, C. and Zech, C. and Wansleben, M.}
}

@Article { HohlsKGHKW2019,
   subid = {1126},
   title = {Quantum dot state initialization by control of tunneling rates},
   journal = {Physical Review B},
   year = {2019},
   month = {5},
   day = {20},
   volume = {99},
   number = {20},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {201409(R)},
   keywords = {quantum dot, single-electron, quantum state, electron quantum optics},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/physrevb.99.201409},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wenz, T. and Klochan, J. and Hohls, F. and Gerster, T. and Kashcheyevs, V. and H. W., Schumacher}
}

@Article { HohlsKGHKW20190,
   subid = {1126},
   title = {Quantum dot state initialization by control of tunneling rates},
   journal = {Physical Review B},
   year = {2019},
   month = {5},
   day = {20},
   volume = {99},
   number = {20},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {201409(R)},
   keywords = {quantum dot, single-electron, quantum state, electron quantum optics},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/physrevb.99.201409},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hohls, F. and Kashcheyevs, V. and Gerster, T. and Hohls, F. and Klochan, J. and Wenz, T.}
}

@Article { OliveroBOFCJGSPBFHBER2019,
   title = {Quantum Micro–Nano Devices Fabricated in Diamond by Femtosecond Laser and Ion Irradiation},
   journal = {Advanced Quantum Technologies},
   year = {2019},
   month = {5},
   day = {20},
   volume = {2},
   number = {5-6},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1900006},
   keywords = {diamond, ion‐beam irradiation, nitrogen vacancies ,NV magnetometry, quantum sensing, ultrafast laser writing},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Wiley},
   language = {30},
   ISSN = {2511-9044, 2511-9044},
   DOI = {10.1002/qute.201900006},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/2318/1704485},
   author = {Olivero, P. and Barclay, P.E. and Osellame, R. and Ferrari, M. and Chiappini, A. and Jedrkiewicz, O. and Giakoumaki, A.N. and Sotillo, B. and Picollo, F. and Bosia, F. and Forneris, J. and Hadden, J.P. and Bharadwaj, V. and Eaton, S.M. and Ramponi, R.}
}

@Article { ,
   title = {Universal Equation for Argon Gas Cluster Sputtering Yields},
   journal = {Journal of Physical Chemistry C},
   year = {2019},
   month = {5},
   day = {13},
   volume = {117},
   number = {(24),},
   number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices},
   pages = {pp 12622–12632},
   keywords = {gold, Irganox1010, OLED, polymers, silicon, silicon dioxide.},
   web_url = {http://pubs.acs.org/doi/abs/10.1021/jp402684c},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {ACS Publications},
   address = {Washington DC},
   language = {30},
   ISSN = {1932-7447},
   DOI = {10.1021/jp402684c},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2014-5-29},
   author = {Seah, M.P}
}

@Article { LuisoLGDC2019,
   subid = {1343},
   title = {Compensation of Current Transformers’ Nonlinearities by Tensor Linearization},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {5},
   day = {13},
   volume = {68},
   number = {10},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {3841 - 3849},
   keywords = {Current transformer (CT), frequency coupling matrix (FCM), harmonics, nonlinearity compensation, phase-dependent characteristics, power quality, power system measurements},
   web_url = {https://ieeexplore.ieee.org/document/8713410},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IEEE},
   language = {30},
   ISSN = {0018-9456},
   DOI = {10.1109/TIM.2019.2905908},
   stag_bib_extends_levelofaccess = {NA},
   author = {Luiso, M. and Langella, R. and Gallo, D. and Delle Femine, A. and Collin, A.J.}
}

@Article { DudekD2019,
   subid = {1236},
   title = {Propagation of the nuclear mean-field uncertainties with increasing distance from the parameter adjustment zone: Applications to superheavy nuclei},
   journal = {Physical Review C},
   year = {2019},
   month = {5},
   day = {10},
   volume = {99},
   number = {5},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   keywords = {Nuclear mean field theory, inverse problem, modeling stability conditions},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9985, 2469-9993},
   DOI = {10.1103/PhysRevC.99.054310},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dudek, J. and Dedes, I.}
}

@Article { SkalnikSLZ2019,
   title = {Mathematical approach to evaluate involute gear profile and helix deviations without using special gear software},
   journal = {Mechanism and Machine Theory},
   year = {2019},
   month = {5},
   volume = {135},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   pages = {150-164},
   keywords = {Coordinate measurementCylindrical gearProfile deviationHelix deviationGear measurement standardCAD model},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0094114X18306323?via\%3Dihub},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0094-114X},
   DOI = {10.1016/j.mechmachtheory.2019.01.030},
   stag_bib_extends_levelofaccess = {NA},
   author = {Skaln{\'i}k, P. and S{\'y}kora, J. and Linkeov{\'a}, I. and Zelen{\'y}, V.}
}

@Article { HeinrichPSDKFA2019,
   subid = {1067},
   title = {Influence of Microwave Probes on Calibrated On-Wafer Measurements},
   journal = {IEEE Transactions on Microwave Theory and Techniques},
   year = {2019},
   month = {5},
   volume = {67},
   number = {5},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {1892-1900},
   keywords = {Calibration, coplanar  waveguide, electromagnetic field simulation, multiline-thru-reflect-line, on-wafer probing, probes},
   web_url = {https://www.fbh-berlin.de/fileadmin/downloads/Publications/2019/FINAL_VERSION_repository.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9480, 1557-9670},
   DOI = {10.1109/TMTT.2019.2903400},
   stag_bib_extends_levelofaccess = {NA},
   author = {Heinrich, W. and Phung, G.N. and Schmuckle, F.J. and Doerner, R.  and Kahne, B. and Fritzsch, T. and Arz, U.}
}

@Article { LeferinktMH2019,
   subid = {1385},
   title = {Fast Magnetic Emission Tests for Continuous Measurements Around an Equipment Under Test},
   journal = {2019 ESA Workshop on Aerospace EMC (Aerospace EMC)},
   year = {2019},
   month = {5},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   keywords = {IEEE Keywords   Position measurement,  Time measurement,  Time-frequency analysis,  Magnetic field measurement,  Electromagnetic interference  INSPEC: Controlled Indexing   electromagnetic interference,  position measurement,  time-domain analysis  INSPEC: Non-Controlled Indexing   continuous measurements,  fast magnetic emission tests,  continuous positional measurement,  maximum emission,  maximum interference,  measurement positions,  time domain electromagnetic interference analyzers,  EMI test receiver,  long measurement time,  EUT,  radiated electromagnetic interference emission},
   web_url = {https://research.utwente.nl/en/publications/fast-magnetic-emission-tests-for-continuous-measurements-around-a},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.23919/AeroEMC.2019.8788950},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leferink, F. and ten Have, B. and Moonen, N. and Hartman, T.}
}

@Proceedings { SchulerREL2019,
   subid = {1247},
   title = {Zur Bestimmung des ILRS-Referenzpunktes am Satellite Observing System Wettzell},
   journal = {Photogrammetrie - Laserscanning - Optische 3D-Messtechnik},
   year = {2019},
   month = {4},
   day = {30},
   volume = {2019},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   pages = {162-175},
   keywords = {geometric reference points, VLBI, SLR, ILRS, geodesy, satellite, local tie vectors},
   web_url = {https://zenodo.org/record/3515831\#.XbG36dVCQ2w},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Wichmann Verlag},
   event_place = {Oldenburg},
   event_name = {18. Oldenburger 3D-Tage 2019},
   event_date = {06-02-2019 to 07-02-2019},
   language = {43},
   ISBN = {978-3-87907-660-4},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3515831},
   author = {Sch{\"u}ler, T. and Riepl, S. and Eschelbach, C. and L{\"o}sler, M.}
}

@Article { TibertoCCBMF2019,
   subid = {1266},
   title = {Infuence of shape, size and magnetostatic interactions on the hyperthermia properties of permalloy nanostructures},
   journal = {Scientific Reports},
   year = {2019},
   month = {4},
   day = {29},
   volume = {9},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {6591},
   keywords = {Magnetic nanostructures, Hysteresis losses, Micromagnetic modelling},
   web_url = {https://www.nature.com/articles/s41598-019-43197-4},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322 (online)},
   DOI = {https://doi.org/10.1038/s41598-019-43197-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tiberto, P. and Co{\"i}sson, M. and Celegato, F. and Barrera, G. and Manzin, A. and Ferrero, R.}
}

@Article { IacomussiRMLG2019,
   subid = {1255},
   title = {Road Surface Photometric Characterisation and Its Impact on Energy Savings},
   journal = {Coatings},
   year = {2019},
   month = {4},
   day = {26},
   volume = {9},
   number = {5},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   pages = {286},
   keywords = {road surface; luminance coefficient q; road lighting; energy savings; road users safety; EMPIR; EURAMET; Surface 16NRM02 project},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Paola Iacomussi},
   language = {30},
   ISSN = {2079-6412},
   DOI = {https://doi.org/10.3390/coatings9050286},
   stag_bib_extends_levelofaccess = {NA},
   author = {Iacomussi, P. and Rossi, G. and Muzet, V. and Lindgren, M. and Gidlund, H.}
}

@Manual { SchmucklePASHL2019,
   subid = {1084},
   title = {Guidelines for the design of calibration substrates, including the suppression of parasitic modes for frequencies up to and including 325 GHz},
   year = {2019},
   month = {4},
   day = {24},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Calibration, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), on-wafer probing, probes},
   web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424A},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Physikalisch-Technische Bundesanstalt (PTB)},
   language = {30},
   DOI = {10.7795/530.20190424A},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmuckle, F.J. and Phung, G.N. and Arz, U. and Spirito, M. and Heinrich, W. and Lozar, R.}
}

@Manual { HaddadiDLHGLHPZWHMSRKPASC2019,
   subid = {1085},
   title = {Best Practice Guide for Planar S-Parameter Measurements using Vector Network Analysers},
   year = {2019},
   month = {4},
   day = {24},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), microwave probes, extreme impedance measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise, vector network analyzer (VNA)},
   web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424B},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Physikalisch-Technische Bundesanstalt (PTB)},
   language = {30},
   DOI = {10.7795/530.20190424B},
   stag_bib_extends_levelofaccess = {NA},
   author = {Haddadi, K. and Dambrine, G. and Lozar, R. and Helmreich, K. and Gold, G. and Lomakin, K. and Heinrich, W. and Phung, G.N. and Zeier, M. and Wollensack, M. and Hoffmann, J. and Mubarak, F. and Shang, X. and Ridler, N. and Kuhlmann, K. and Probst, T. and Arz, U. and Spirito, M. and Clarke, R.}
}

@Article { GardiniVPC2019,
   subid = {1165},
   title = {Quantitative imaging of efflux pumps in planktonic and biofilm-associated bacteria through single-molecule localization microscopy - Biomedical Imaging and Sensing Conference},
   journal = {Biomedical Imaging and Sensing Conference},
   year = {2019},
   month = {4},
   day = {21},
   volume = {11140},
   number = {2019},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {170-174},
   keywords = {Quantitative imaging of efflux pumps in planktonic and biofilm-associated bacteria throughsingle-molecule localization microscopy},
   web_url = {https://www.spiedigitallibrary.org/conference-proceedings-of-spie/11140/2535451/Biomedical-Imaging-and-Sensing-Conference/10.1117/12.2535451.full},
   misc2 = {EMPIR 2015: Health},
   publisher = {SPIE},
   language = {30},
   ISSN = {0277-786X},
   DOI = {10.1117/12.2535451},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gardini, L. and Vignolini, T. and Pavone, F.S. and Capitanio, M.}
}

@Article { DudekR2019,
   subid = {1237},
   title = {New approach to the adiabaticity concepts in the collective nuclear motion: Impact for the collective-inertia tensor and comparisons with experiment},
   journal = {Physical Review C},
   year = {2019},
   month = {4},
   day = {19},
   volume = {99},
   number = {4},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   keywords = {Collective nuclear motion, adiabaticity, nuclear inertia tensor, cranking approximation},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9985, 2469-9993},
   DOI = {10.1103/PhysRevC.99.041303},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dudek, J. and Rouvel, D.}
}

@Article { WiekhorstSPLW2019,
   subid = {941},
   title = {Probing particle-matrix interactions during magnetic particle spectroscopy},
   journal = {Journal of Magnetism and Magnetic Materials},
   year = {2019},
   month = {4},
   volume = {475},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {421-428},
   keywords = {magnetic hyperthermia, magnetic nanoparticles},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0304-8853},
   DOI = {10.1016/j.jmmm.2018.11.109},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wiekhorst, F. and Steinhoff, U. and Paysen, H. and L{\"o}wa, N. and Wells, J.}
}

@Article { MartinezVerduVVBP2019,
   subid = {1014},
   title = {Graininess characterization by multidimensional scaling},
   journal = {Journal of Modern Optics},
   year = {2019},
   month = {4},
   volume = {67},
   number = {1},
   number2 = {16NRM08: BiRD: Bidirectional reflectance definitions},
   pages = {1-10},
   keywords = {graininess, special-effect pigments, multidimensional scaling algorithm, psychophysical experiment},
   web_url = {https://www.tandfonline.com/doi/full/10.1080/09500340.2019.1589006},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Taylor \& Francis},
   language = {30},
   ISSN = {1362-3044},
   DOI = {10.1080/09500340.2019.1589006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mart{\'i}nez-Verd{\'u}, F.M. and Viqueira, V. and Vilaseca, M. and Burgos, F.J. and Perales, E.}
}

@Article { RaaymakersJWvdWd2019,
   subid = {1046},
   title = {Direct measurement of ion chamber correction factors, k\(_{Q}\) and k\(_{B}\), in a 7 MV MRI-linac},
   journal = {Physics in Medicine and Biology},
   year = {2019},
   month = {4},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   keywords = {absorbed dose, MRgRT, kB, kQ, magnetic field},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/ab1511/pdf},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/ab1511},
   stag_bib_extends_levelofaccess = {NA},
   author = {Raaymakers, B.W. and Jansen, B.J. and Wolthaus, J.W.H. and van Asselen, B. and de Pooter, J.A. and Woodings, S.J. and de Prez, L.A.}
}

@Article { BergstenSSM2019,
   subid = {1076},
   title = {Four-Terminal Pair Digital Sampling Impedance Bridge up to 1MHz},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {4},
   volume = {68},
   number = {6},
   number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements},
   pages = {1860 - 1869},
   keywords = {Bridge circuits, Impedance, Topology, Uncertainty, Standards, Calibration, Multiplexing, impedance measurement, phase comparators, sampling methods, shunts (electrical)},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   language = {30},
   ISSN = {0018-9456},
   DOI = {10.1109/TIM.2019.2908649},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bergsten, T. and Skalicka, T. and Š{\'i}ra, M. and Maslan, S.}
}

@Article { XuLLALAGMWTLATSPDA2019,
   subid = {1116},
   title = {High-precision methanol spectroscopy with a widely tunable SI-traceable frequency-comb-based mid-infrared QCL},
   journal = {Optica},
   year = {2019},
   month = {4},
   volume = {6},
   number = {4},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {411},
   keywords = {Diode lasers; Laser beams; Laser sources; Optical components; Saturation spectroscopy; Tunable lasers;},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {2334-2536},
   DOI = {10.1364/OPTICA.6.000411},
   stag_bib_extends_levelofaccess = {NA},
   author = {Xu, D. and Lee, W.K. and Le Targat, R. and Alvarez-Martinez, H. and Le Coq, Y. and Abgrall, M. and Goncharov, A. and Mouhamad, H. and Wiotte, F. and Tokunaga, S.K. and Lopez, O. and Argence, B. and Tran, D.B.A. and Santagata, R. and Pottie, P.E. and Darqui{\'e}, B. and Amy-Klein, A.}
}

@Article { DarquieSPXATAWTLMAGLLAL2019,
   subid = {1116},
   title = {High-precision methanol spectroscopy with a widely tunable SI-traceable frequency-comb-based mid-infrared QCL},
   journal = {Optica},
   year = {2019},
   month = {4},
   volume = {6},
   number = {4},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {411},
   keywords = {optical Fiber, optical frequency transfer},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {2334-2536},
   DOI = {10.1364/OPTICA.6.000411},
   stag_bib_extends_levelofaccess = {NA},
   author = {Darqui{\'e}, B. and Santagata, R. and Pottie, P.E. and Xu, D. and Amy-Klein, A. and Tran, D.B.A. and Argence, B. and Wiotte, F. and Tokunaga, S.K. and Lopez, O. and Mouhamad, H. and Abgrall, M. and Goncharov, A. and Le Coq, Y. and Lee, W.K. and Alvarez-Martinez, H. and Le Targat, R.}
}

@Article { HanselaerAL2019,
   subid = {1223},
   title = {Development of an image-based gloss measurement instrument},
   journal = {Journal of Coatings Technology and Research},
   year = {2019},
   month = {4},
   volume = {16},
   number = {4},
   number2 = {16NRM08: BiRD: Bidirectional reflectance definitions},
   pages = {913-921},
   keywords = {specular gloss meterimage-based gloss measurementcontrast glossorange peel},
   web_url = {https://rdcu.be/bTtmT},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1547-0091, 1935-3804},
   DOI = {10.1007/s11998-019-00184-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hanselaer, P. and Audenaert, J. and Leloup, F.B.}
}

@Article { BuechelerTSALWCW2019,
   subid = {1241},
   title = {Time-resolved photoluminescence on double graded Cu(In,Ga)Se2 – Impact of front surface recombination and its temperature dependence},
   journal = {Science and Technology of Advanced Materials},
   year = {2019},
   month = {4},
   volume = {20},
   number = {1},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {313-323},
   keywords = {time-resolved photoluminescence},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {1468-6996, 1878-5514},
   DOI = {10.1080/14686996.2019.1586583},
   stag_bib_extends_levelofaccess = {NA},
   author = {Buecheler, S. and Tiwari, A.N. and Siebentritt, S. and Avancini, E. and L{\"o}ckinger, J. and Wolter, M.H. and Carron, R. and Weiss, T.P.}
}

@Proceedings { c5e7ca83da2019,
   subid = {1259},
   title = {Industrial Standards in the Intermediate Pressure-to-Vacuum Range},
   journal = {PTB-Bericht},
   year = {2019},
   month = {4},
   volume = {Th-10},
   number = {April 2019},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   pages = {326},
   keywords = {Pressure, vacuum, standard, measurement, calibration},
   web_url = {https://oar.ptb.de/files/download/5dc18f0e4c939056100060a2},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Physikalisch-Technische Bundesanstalt (PTB)},
   address = {Braunschweig},
   event_place = {RISE, Bor{\aa}s, Sweden},
   event_name = {Final Workshop},
   event_date = {16-05-2018 to 17-05-2018},
   language = {30},
   ISBN = {978-3-95606-466-1},
   ISSN = {1614-9327},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/110.20191105D}
}

@Article { MarquesTUWdLLLGHA2019,
   subid = {1369},
   title = {Topology Driven g-Factor Tuning in Type-II Quantum Dots},
   journal = {Physical Review Applied},
   year = {2019},
   month = {4},
   volume = {11},
   number = {4},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {044011},
   keywords = {quantum dots, optoelectronics, spin-orbit coupling, Aharonov-Bohm effect},
   web_url = {https://arxiv.org/abs/1710.08828},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.11.044011},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marques, G.E. and Teodoro, M.D. and Ulloa, J.M. and Wewi{\'o}r, L. and de Oliveira, E.R. Cardozo and L{\'o}pez-Richard, V. and Lopes-Oliveira, V. and Llorens, J.M. and Garc{\'i}a-Crist{\'o}bal, A. and Hai, G.-Q. and Al{\'e}n, B.}
}

@Article { MehlstaublerOBID2019,
   subid = {1040},
   title = {946-nm Nd:YAG digital-locked laser at 1.1 \(\times\) 10−16 in 1  s and transfer-locked to a cryogenic silicon cavity},
   journal = {Optics Letters},
   year = {2019},
   month = {3},
   day = {29},
   volume = {44},
   number = {7},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {1781},
   keywords = {Ultra-stable laser; Nd:YAG; Fabry-Perot cavity; time and frequency metrology; optical clock;},
   web_url = {https://arxiv.org/abs/1902.07012},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {0146-9592, 1539-4794},
   DOI = {10.1364/OL.44.001781},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mehlst{\"a}ubler, T.E. and Okhapkin, M. and Benkler, E. and Ignatovich, S. and Didier, A.}
}

@Article { TiwariBCFBW2019,
   subid = {1240},
   title = {Bulk and surface recombination properties in thin film semiconductors with different surface treatments from time-resolved photoluminescence measurements},
   journal = {Scientific Reports},
   year = {2019},
   month = {3},
   day = {29},
   volume = {9},
   number = {1},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   keywords = {thin filmsemiconductor},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-41716-x},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tiwari, A.N. and Buecheler, S. and Carron, R. and Feurer, T. and Bissig, B. and Weiss, T.P.}
}

@Article { LeviLG2019,
   subid = {1088},
   title = {Multipartite-entanglement tomography of a quantum simulator},
   journal = {New Journal of Physics},
   year = {2019},
   month = {3},
   day = {28},
   volume = {21},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   keywords = {entanglement, spin chain, long-range interaction, quantum phase transitions},
   misc2 = {EMPIR 2017: Fundamental},
   language = {30},
   DOI = {10.1088/1367-2630/aafb8c},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pezz{\`e}, L. and Gabbrielli, M. and Lepori, L.}
}

@Article { KoellenspergerNST2019,
   subid = {1195},
   title = {FI-ICP-TOFMS for high-throughput and low volume multi-element analysis in environmental and biological matrices},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2019},
   month = {3},
   day = {28},
   volume = {34},
   number = {6},
   number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease},
   pages = {1272-1278},
   keywords = {low volume multi-element analysis, FI-ICP-TOFMS, analysis in environmental and biological matrices},
   web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2019/JA/C9JA00022D\#!divAbstract},
   misc2 = {EMPIR 2015: Health},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {0267-9477, 1364-5544},
   DOI = {10.1039/C9JA00022D},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koellensperger, G. and Neumayer, S. and Schoeberl, A. and Theiner, S.}
}

@Article { BurgerZB2019,
   subid = {1058},
   title = {An auxiliary field approach for computing optical resonances in dispersive media},
   journal = {Journal of the European Optical Society-Rapid Publications},
   year = {2019},
   month = {3},
   day = {27},
   volume = {15},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {3},
   keywords = {Maxwell’s equations, Material dispersion, Nonlinear eigenvalue problems, Auxiliary field approach},
   misc2 = {EMPIR 2017: Fundamental},
   language = {30},
   DOI = {10.1186/s41476-019-0098-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Burger, S. and Zschiedrich, L. and Binkowski, F.}
}

@Article { MeesSF2019,
   subid = {1026},
   title = {Traceability of form measurements of freeform surfaces: metrological reference surfaces},
   journal = {Optical Engineering},
   year = {2019},
   month = {3},
   day = {26},
   volume = {58},
   number = {9},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {092602-1-7},
   keywords = {metrology; freeform; reference artifact; traceability; interferometry; measurement comparison},
   misc2 = {EMPIR 2015: SI Broader Scope},
   language = {30},
   DOI = {10.1117/1.OE.58.9.092602},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mee{\ss}, R. and Schulz, M. and Fortmeier, I.}
}

@Proceedings { BurgerZHS2019,
   subid = {1217},
   title = {Using Gaussian process regression for efficient parameter reconstruction},
   journal = {Metrology, Inspection, and Process Control for Microlithography XXXIII},
   year = {2019},
   month = {3},
   day = {26},
   volume = {10959},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1095911},
   keywords = {computational  metrology,  optical  metrology,  computational  lithography,  Bayesian  optimization,machine learning, finite-element methods, nanooptics},
   web_url = {https://arxiv.org/abs/1903.12128},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {SPIE},
   event_place = {San Jose, USA},
   event_name = {Metrology, Inspection, and Process Control for Microlithography XXXIII},
   event_date = {24-02-2019 to 28-02-2019},
   language = {30},
   DOI = {10.1117/12.2513268},
   stag_bib_extends_levelofaccess = {NA},
   author = {Burger, S. and Zschiedrich, L. and Hammerschmidt, M. and Schneider, P-I.}
}

@Article { MarquardtJ2019,
   subid = {1069},
   title = {On the Effectiveness of airborne infrasound in eliciting vestibular-evoked myogenic responses},
   journal = {Journal of Low Frequency Noise, Vibration and Active Control},
   year = {2019},
   month = {3},
   day = {25},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {146134841983386},
   keywords = {Vestibular-evoked myogenic potentials, wind turbines, infrasound and low-frequency hearing, wind-turbine noise syndrome, hearing and balance},
   misc2 = {EMPIR 2015: Health},
   publisher = {SAGE Publications},
   language = {30},
   ISSN = {1461-3484, 2048-4046},
   DOI = {10.1177/1461348419833868},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marquardt, T. and Jurado, C.}
}

@Article { KiselevDMFVPABBLXBHD2019,
   subid = {1024},
   title = {Long Slender Piezo-Resistive Silicon Microprobes for Fast Measurements of Roughness and Mechanical Properties inside Micro-Holes with Diameters below 100 µm},
   journal = {Sensors 2019},
   year = {2019},
   month = {3},
   day = {22},
   volume = {19(6)},
   number = {1410},
   number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements},
   keywords = {cantilever microprobe; high-speed; contact resonance; tip wear; piezo-resistive; mechanical damping; tip-testing standard},
   web_url = {https://www.mdpi.com/1424-8220/19/6/1410},
   misc2 = {EMPIR 2017: Industry},
   publisher = {MDPI AG},
   address = {Basel},
   language = {30},
   DOI = {10.3390/s19061410},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kiselev, I. and Doering, L. and Mickan, B. and Frank, T. and V{\"o}llmeke, S. and Peiner, E. and Ahbe, T. and B{\"u}tefisch, S. and Behle, H. and Langfahl-Klabes, J. and XU, M. and Brand, U. and Hauptmannl, M. and Drexel, M.}
}

@Article { OelfkeBBD2019_2,
   subid = {1047},
   title = {The effect of magnetic field strength on the response of Gafchromic EBT-3 film},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {3},
   day = {14},
   volume = {64},
   number = {6},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {06NT03},
   keywords = {MRI-Linac, MRI-guided radiotherapy, film dosimetry, magnetic field},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/ab0503},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/ab0503},
   stag_bib_extends_levelofaccess = {NA},
   author = {Oelfke, U. and Bouchard, H. and Billas, I. and Duane, S.}
}

@Article { BraunBRSB2019,
   subid = {1033},
   title = {Measurement and Analysis of PMU Reporting Latency for Smart Grid Protection and Control Applications},
   journal = {IEEE Access},
   year = {2019},
   month = {3},
   day = {12},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {1-1},
   keywords = {Phasor measurement units, Ethernet, Hardware, Real-time systems, Synchronization, Task analysis},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2169-3536},
   DOI = {10.1109/ACCESS.2019.2903929},
   stag_bib_extends_levelofaccess = {NA},
   author = {Braun, J.P. and Burt, G.M. and Roscoe, A.J. and Syed, M.H. and Blair, S.M.}
}

@Article { KurlyandskayaSCMBACT2019,
   subid = {944},
   title = {Specific loss power measurements by calorimetric and thermal methods on \(\gamma\)-Fe2O3 nanoparticles for magnetic hyperthermia},
   journal = {Journal of Magnetism and Magnetic Materials},
   year = {2019},
   month = {3},
   volume = {473},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {403-409},
   keywords = {Magnetic hyperthermia, Fe-oxide, Magnetic nanoparticles},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0304-8853},
   DOI = {10.1016/j.jmmm.2018.10.107},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kurlyandskaya, G.V. and Safronov, A.P. and Celegato, F. and Martino, L. and Barrera, G. and Appino, C. and Co{\"i}sson, M. and Tiberto, P.}
}

@Article { PisaniBE2019,
   subid = {1000},
   title = {High-Index Glass Ball Retroreflectors for Measuring Lateral Positions},
   journal = {Sensors},
   year = {2019},
   month = {3},
   volume = {19},
   number = {5},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   pages = {1082},
   keywords = {backscattering, retroreflectors, glory, ray tracing, high index ball lenses},
   web_url = {https://www.mdpi.com/1424-8220/19/5/1082},
   misc2 = {EMPIR 2017: Industry},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s19051082},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pisani, M. and Balsamo, A. and Egidi, A.}
}

@Proceedings { ThalmannMBK2019,
   subid = {1030},
   title = {CT machine geometry changes under thermal load},
   journal = {Nondestructive Testing},
   year = {2019},
   month = {3},
   number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry},
   pages = {23681},
   keywords = {CT machine geometry, thermal influences, geometry measurement system, metrology},
   web_url = {http://www.ndt.net/?id=23681},
   misc2 = {EMPIR 2017: Industry},
   publisher = {NDT.net},
   event_place = {Padova},
   event_name = {9th Conference on Industrial Computed Tomography (iCT) 2019},
   event_date = {13-02-2019 to 15-02-2019},
   language = {30},
   ISSN = {1435-4934},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2019/papers/iCT2019_Full_paper_47.pdf},
   author = {Thalmann, R. and Meli, F. and Bircher, B.A. and K{\"u}ng, A.}
}

@Proceedings { ThalmannMBK2019_2,
   subid = {1029},
   title = {CT geometry determination using individual radiographsof calibrated multi-sphere standards},
   journal = {Nondestructive Testing},
   year = {2019},
   month = {3},
   number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry},
   pages = {23677},
   keywords = {CT machine geometry, correction, multi-sphere standard, metrology},
   web_url = {https://www.ndt.net/search/docs.php3?showForm=off\&id=23677},
   misc2 = {EMPIR 2017: Industry},
   publisher = {NDT.net},
   event_place = {Padova},
   event_name = {9th Conference on Industrial Computed Tomography (iCT) 2019},
   event_date = {13-02-2019 to 15-02-2019},
   language = {30},
   ISSN = {1435-4934},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2019/papers/iCT2019_Full_paper_43.pdf},
   author = {Thalmann, R. and Meli, F. and Bircher, B.A. and K{\"u}ng, A.}
}

@Article { SafronovaPTLSHP2019,
   subid = {1051},
   title = {Optical clock comparison for Lorentz symmetry testing},
   journal = {Nature},
   year = {2019},
   month = {3},
   volume = {567},
   number = {7747},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {204-208},
   keywords = {optical clock, Lorentz symmetry violation, ytterbium, ion trap},
   web_url = {https://arxiv.org/abs/1809.10742\#},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0028-0836, 1476-4687},
   DOI = {10.1038/s41586-019-0972-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Safronova, M.S. and Peik, E. and Tamm, C. and Lange, R. and Sanner, C. and Huntemann, N. and Porsev, S.G.}
}

@Proceedings { SchulzFDSPH2019,
   subid = {1064},
   title = {Crosstalk Effects of Differential Thin-Film Microstrip Lines in Multilayer Motherboards},
   journal = {2019 12th German Microwave Conference (GeMiC)},
   year = {2019},
   month = {3},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {178-181},
   keywords = {crosstalk effects, discontinuities, microstrip},
   web_url = {https://www.fbh-berlin.com/fileadmin/downloads/Publications/2019/2019_02_20_GeMiC_GNP_repository.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   address = {445 Hoes Lane Piscataway NJ 08855-1331 United States},
   event_place = {Stuttgart},
   event_name = {2019 12th German Microwave Conference (GeMiC)},
   event_date = {25-03-2019 to 27-03-2019},
   language = {30},
   DOI = {10.23919/GEMIC.2019.8698163},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schulz, S. and Fritzsch, T. and Doerner, R.  and Schmuckle, F. J. and Phung, G. N. and Heinrich, W.}
}

@Article { PitreLHHCSPCGLZ2019,
   subid = {1167},
   title = {A high-stability quasi-spherical resonator in SPRIGT for microwave frequency measurements at low temperatures},
   journal = {Science Bulletin},
   year = {2019},
   month = {3},
   volume = {64},
   number = {5},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {286-288},
   keywords = {Refractive Index, Primary Thermometry, resonance frequencies},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2095-9273},
   DOI = {10.1016/j.scib.2019.01.018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pitre, L. and Luo, E. and Hu, J. and Han, D. and Chen, H. and Song, Y. and Pan, C. and Chen, Y. and Gao, B. and Liu, W. and Zhang, H.}
}

@Article { HuKPHNKNC2019,
   subid = {1306},
   title = {Determination of tip transfer function for quantitative MFM using frequency domain filtering and least squares method},
   journal = {Scientific Reports},
   year = {2019},
   month = {3},
   volume = {9},
   number = {1},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   keywords = {quantitative MFM},
   web_url = {https://www.nature.com/articles/s41598-019-40477-x\#additional-information},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-40477-x},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hu, X. and Kazakova, O. and Puttock, R. and Havl{\'i}ček, M. and Neu, V. and Klapetek, P. and Nečas, D. and Corte-Le{\'o}n, H.}
}

@Article { GramegnaRPARVDG2019,
   subid = {1006},
   title = {Optimal estimation of entanglement and discord in two-qubit states},
   journal = {Scientific Reports},
   year = {2019},
   month = {2},
   day = {28},
   volume = {9},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {1-9},
   keywords = {quantum technologies},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-39334-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gramegna, M. and Ruo Berchera, I. and Piacentini, F. and Avella, A. and Rebufello, E. and Virz{\`i}, S. and Degiovanni, I.P. and Genovese, M.}
}

@Article { GramegnaRPARVDG20190,
   subid = {1006},
   title = {Optimal estimation of entanglement and discord in two-qubit states},
   journal = {Scientific Reports},
   year = {2019},
   month = {2},
   day = {28},
   volume = {9},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1-9},
   keywords = {quantum technologies},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-39334-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gramegna, M. and Ruo Berchera, I. and Piacentini, F. and Avella, A. and Rebufello, E. and Virz{\`i}, S. and Degiovanni, I.P. and Genovese, M.}
}

@Article { GramegnaRPARVDG20191,
   subid = {1006},
   title = {Optimal estimation of entanglement and discord in two-qubit states},
   journal = {Scientific Reports},
   year = {2019},
   month = {2},
   day = {28},
   volume = {9},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {1-9},
   keywords = {quantum technologies},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-39334-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gramegna, M. and Ruo Berchera, I. and Piacentini, F. and Avella, A. and Rebufello, E. and Virz{\`i}, S. and Degiovanni, I.P. and Genovese, M.}
}

@Article { SchulzFSSE2019,
   subid = {1027},
   title = {SimOptDevice: a library for virtual optical experiments},
   journal = {Journal of Sensors and Sensor Systems},
   year = {2019},
   month = {2},
   day = {27},
   volume = {8},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {105 - 110},
   keywords = {SimOptDevice, opto-mechanical virtual experiments,},
   web_url = {https://www.j-sens-sens-syst.net/8/105/2019/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Copernicus Publications},
   language = {30},
   DOI = {10.5194/jsss-8-105-2019},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schulz, M. and Fortmeier, I. and Stavridis, M. and Schachtschneider, R. and Elster, C.}
}

@Article { RaaymakersWHMv2019,
   subid = {1142},
   title = {Monte Carlo simulations of out-of-field surface doses due to the electron streaming effect in orthogonal magnetic fields},
   journal = {Physics in Medicine and Biology},
   year = {2019},
   month = {2},
   day = {26},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   keywords = {out-of-field dose, MRgRT},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/ab0aa0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Raaymakers, B.W. and Wolthaus, J.W.H. and Hackett, S.L. and Malkov, V.N. and van Asselen, B.}
}

@Article { PezzeSGS2019,
   subid = {1091},
   title = {Fast and optimal generation of entanglement in bosonic Josephson junctions},
   journal = {Physical Review A},
   year = {2019},
   month = {2},
   day = {25},
   volume = {99},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   keywords = {Entanglement, Bose Einstein condensate,},
   web_url = {https://arxiv.org/abs/1511.01835},
   misc2 = {EMPIR 2017: Fundamental},
   language = {30},
   DOI = {10.1103/PhysRevA.99.022329},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sorelli, G. and Smerzi, A. and Gessner, M. and Pezz{\`e}, L.}
}

@Article { ChunnilallKBGRKLPRGD2019,
   subid = {1012},
   title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source},
   journal = {Metrologia},
   year = {2019},
   month = {2},
   day = {22},
   volume = {56},
   number = {2},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {025004},
   keywords = {single-photon sources, quantum technologies, quantum characterization},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab022e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chunnilall, C.J. and K{\"u}ck, S. and Brida, G. and Gramegna, M. and Ruo Berchera, I. and Kirkwood, R.A. and L{\'o}pez, M. and Piacentini, F. and Rebufello, E. and Genovese, M. and Degiovanni, I.P.}
}

@Article { ChunnilallKBGRKLPRGD20190,
   subid = {1012},
   title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source},
   journal = {Metrologia},
   year = {2019},
   month = {2},
   day = {22},
   volume = {56},
   number = {2},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {025004},
   keywords = {single-photon sources, quantum technologies, quantum characterization},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab022e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chunnilall, C.J. and K{\"u}ck, S. and Brida, G. and Gramegna, M. and Ruo Berchera, I. and Kirkwood, R.A. and L{\'o}pez, M. and Piacentini, F. and Rebufello, E. and Genovese, M. and Degiovanni, I.P.}
}

@Article { ChunnilallKBGRKLPRGD20191,
   subid = {1012},
   title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source},
   journal = {Metrologia},
   year = {2019},
   month = {2},
   day = {22},
   volume = {56},
   number = {2},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {025004},
   keywords = {single-photon sources, quantum technologies, quantum characterization},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab022e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chunnilall, C.J. and K{\"u}ck, S. and Brida, G. and Gramegna, M. and Ruo Berchera, I. and Kirkwood, R.A. and L{\'o}pez, M. and Piacentini, F. and Rebufello, E. and Genovese, M. and Degiovanni, I.P.}
}

@Inbook { SanderTK2019,
   subid = {1131},
   title = {Optically Pumped Magnetometers for MEG},
   year = {2019},
   month = {2},
   day = {21},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {1-12},
   keywords = {Optically pumped magnetometer, Magnetoencephalography, Superconducting quantum interference device, Magnetocardiography, Multichannel, Electron spin resonance, Microelectromechanical system, Alkali-metal vapor cell, Atomic magnetometer, Optical magnetometer},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer International Publishing},
   booktitle = {Magnetoencephalography},
   language = {30},
   ISBN = {978-3-319-62657-4},
   DOI = {10.1007/978-3-319-62657-4_49-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sander, T. and Trahms, L. and Knappe, S.}
}

@Miscellaneous { Dawkins,
   subid = {1017},
   title = {Sensor data set radial forging at AFRC testbed},
   journal = {Zenodo Community},
   year = {2019},
   month = {2},
   day = {20},
   volume = {n/a},
   number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future},
   keywords = {forming, forge, sensors},
   web_url = {https://doi.org/10.5281/zenodo.2573860},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Zenodo},
   language = {30},
   DOI = {10.5281/zenodo.2573860},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dawkins, J.}
}

@Thesis { Nysten2019,
   subid = {1072},
   title = {Characterization and Monte Carlo evaluation of positioning uncertainty of an MAFM.},
   year = {2019},
   month = {2},
   day = {19},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   keywords = {metrologia mittaus ep{\"a}varmuus pinnat metrology measurement uncertainty surfaces},
   web_url = {http://urn.fi/URN:NBN:fi:jyu-201902191567},
   misc2 = {EMPIR 2015: SI Broader Scope},
   school = {University of Jyv{\"a}skyl{\"a}},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://jyx.jyu.fi/handle/123456789/62847},
   author = {Nysten, J.}
}

@Article { WolthausRvHM2019,
   subid = {1142},
   title = {Monte Carlo simulations of out-of-field skin dose due to spiralling contaminant electrons in a perpendicular magnetic field},
   journal = {Medical Physics},
   year = {2019},
   month = {2},
   day = {14},
   volume = {46},
   number = {3},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {1467-1477},
   keywords = {MRgRT, Monte Carlo, dosimetry, magnetic field},
   web_url = {https://aapm.onlinelibrary.wiley.com/doi/full/10.1002/mp.13392},
   misc2 = {EMPIR 2015: Health},
   publisher = {Wiley},
   language = {30},
   ISSN = {0094-2405},
   DOI = {10.1002/mp.13392},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wolthaus, Jochem W. H. and Raaymakers, B.W. and van Asselen, B. and Hackett, S.L. and Malkov, V.N.}
}

@Article { NeuCJBPKC2019,
   subid = {1305},
   title = {Frontiers of magnetic force microscopy},
   journal = {Journal of Applied Physics},
   year = {2019},
   month = {2},
   day = {14},
   volume = {125},
   number = {6},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {060901},
   keywords = {MFM},
   web_url = {https://aip.scitation.org/doi/10.1063/1.5050712},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0021-8979, 1089-7550},
   DOI = {10.1063/1.5050712},
   stag_bib_extends_levelofaccess = {NA},
   author = {Neu, V. and Corte-Le{\'o}n, H. and Jaafar, M. and Barton, C. and Puttock, R. and Kazakova, O. and Corte-Leon, Hector}
}

@Article { HallstromH2019,
   subid = {1055},
   title = {Application of Charge-Sensitive Preamplifier for the Calibration of Partial Discharge Calibrators Below 1 pC},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {2},
   day = {12},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   pages = {1-7},
   keywords = {Voltage measurement, Uncertainty, Partial discharges, Capacitors, Charge measurement, Calibration, Measurement uncertainty},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2019.2895437},
   stag_bib_extends_levelofaccess = {NA},
   author = {Havunen, J. and H{\"a}llstr{\"o}m, J.}
}

@Article { MendezSBCKSD2019,
   subid = {1021},
   title = {Characterization of an analog-to-digital converter frequency response by a Josephson arbitrary waveform synthesizer},
   journal = {Measurement Science and Technology},
   year = {2019},
   month = {2},
   day = {11},
   volume = {30},
   number = {3},
   number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements},
   pages = {035006},
   keywords = {quantum standard, digital converter, Josephson arbitrary waveform synthesizer, programmable Josephson voltage standard, Monte Carlo method, Sine fitting algorithms, artificial neural network (ANN)},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/aafb27/meta},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aafb27},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\'e}ndez, A. and Sanmamed, Y.A. and Behr, R. and Caballero, R. and Kieler, O. and Salinas, J.R. and Diaz de Aguilar, J.}
}

@Article { KargerSM2019,
   subid = {1044},
   title = {Absolute dosimetry with polymer gels—a TLD reference system},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {2},
   day = {11},
   volume = {64},
   number = {4},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {045010},
   keywords = {radiation dosimeters, absolute dosimetry, 3D dosimetry, polymer gel, thermoluminescence dosimetry, TLD},
   web_url = {https://doi.org/10.1088/1361-6560/aafd41},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aafd41},
   stag_bib_extends_levelofaccess = {NA},
   author = {Karger, C.P. and Schwahofer, A. and Mann, P.}
}

@Article { McPeakBHGW2019,
   subid = {1059},
   title = {Correlation of circular differential optical absorption with geometric chirality in plasmonic meta-atoms},
   journal = {Optics Express},
   year = {2019},
   month = {2},
   day = {11},
   volume = {27},
   number = {4},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {5097},
   keywords = {circular differential optical absorption, chirality, plasmonics},
   misc2 = {EMPIR 2017: Fundamental},
   language = {30},
   DOI = {10.1364/OE.27.005097},
   stag_bib_extends_levelofaccess = {NA},
   author = {McPeak, K.M. and Burger, S. and Herrmann, S. and Gutsche, P. and Wilson, J.C.}
}

@Article { SiasDPDD2019,
   subid = {998},
   title = {A compact radiofrequency drive based on interdependent resonant circuits for precise control of ion traps},
   journal = {Review of Scientific Instruments},
   year = {2019},
   month = {2},
   volume = {90},
   number = {2},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   pages = {023201},
   keywords = {RF drive, Resonant circuits},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.5063305},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sias, C. and Duca, L. and Perego, E. and De Pas, M. and Detti, A.}
}

@Article { DittmannFHGBHKWPSDM2019,
   subid = {1001},
   title = {Results of four European round-robins on short-circuit current temperature coefficient measurements of photovoltaic devices of different size},
   journal = {Solar Energy},
   year = {2019},
   month = {2},
   volume = {179},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   pages = {424-436},
   keywords = {Photovoltaics, Short-circuit current temperature coefficient intercomparisons, Spectral temperature coefficients, Bare cells to full-size modules},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0038-092X},
   DOI = {10.1016/j.solener.2018.10.051},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dittmann, S. and Friesen, G. and Hohl-Ebinger, J. and Gandy, T. and Bothe, K. and Hinken, D. and Kr{\"o}ger, I. and Winter, S. and Pavanello, D. and Salis, E. and Dubard, J. and M{\"u}llejans, H.}
}

@Article { JohnenRMDEK2019,
   subid = {1052},
   title = {Compatibility of 3D printing materials and printing techniques with PAGAT gel dosimetry},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {2},
   volume = {64},
   number = {4},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {04NT02},
   keywords = {MRgRT},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aafef0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Johnen, W. and Runz, A. and Mann, P. and Dorsch, S. and Elter, A. and Karger, C.P.}
}

@Article { LazzeriniDGVKYB2019,
   subid = {1074},
   title = {Design and performance of a test rig for evaluation of nanopositioning stages},
   journal = {Measurement Science and Technology},
   year = {2019},
   month = {2},
   volume = {30},
   number = {3},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   pages = {035002},
   keywords = {multi-axis positioning stages, traceability, nanopositioning, dimensional metrology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aafd03},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lazzerini, Giovanni M and Dongmo, Herve and Grolich, Petr and Valtr, Miroslav and Klapetek, Petr and Yacoot, Andrew and Bridges, Angus}
}

@Article { OrtolanoCMC2019,
   subid = {1226},
   title = {A correlation noise spectrometer for flicker noise measurement in graphene samples},
   journal = {Measurement Science and Technology},
   year = {2019},
   month = {2},
   volume = {30},
   number = {3},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   pages = {035102},
   keywords = {electrical noise, graphene, flicker, spectrometer},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/aafcab},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aafcab},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ortolano, M. and Cultrera, A. and Marzano, M. and Callegaro, L.}
}

@Article { WittkamperPJdd2019,
   subid = {1140},
   title = {Corrigendum: Comparison of k Q factors measured with a water calorimeter in flattening filter free (FFF) and conventional flattening filter (cFF) photon beams (de Prez et al 2018 Phys. Med. Biol. 63 045023)},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {1},
   day = {31},
   volume = {64},
   number = {3},
   number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398},
   pages = {039501},
   keywords = {dosimetry, primary standard, flattening filter free, absorbed dose to water, kQ, code of practice, ion chamber},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/aaaa93/pdf},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aafa85},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wittk{\"a}mper, F. and Perik, T. and Jansen, B. and de Pooter, J. and de Prez, L.}
}

@Article { SchumacherS2019,
   subid = {1107},
   title = {Single-Electron Pumps and Quantum Current Metrology in the Revised SI},
   journal = {Annalen der Physik},
   year = {2019},
   month = {1},
   day = {30},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {1800371},
   keywords = {electrical metrology, low current measurements, quantum metrological triangle, SI units, single-electron pumps},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Wiley-VCH},
   language = {30},
   DOI = {10.1002/andp.201800371},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schumacher, H.W. and Scherer, H.}
}

@Article { KokvvWWJddR2019,
   subid = {1045},
   title = {Commissioning of a water calorimeter as a primary standard for absorbed dose to water in magnetic fields},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {1},
   day = {29},
   volume = {64},
   number = {3},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {035013},
   keywords = {dosimetry, MRgRT, primary standard, magnetic field, MRI-linac, calorimetry},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/aaf975},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aaf975},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kok, J. and van Soest, T. and van Asselen, B. and Wolthaus, J. and Woodings, S. and Jansen, B. and de Pooter, J. and de Prez, L. and Raaymakers, B.}
}

@Article { HarrisDBSKDS2019,
   subid = {1160},
   title = {Children With Cystic Fibrosis Are Infected With Multiple Subpopulations of Mycobacterium abscessus With Different Antimicrobial Resistance Profiles},
   journal = {Clinical Infectious Diseases},
   year = {2019},
   month = {1},
   day = {26},
   number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance},
   keywords = {lung transplant, whole-genome sequencing, within-patient diversity, macrolides, physiological niches},
   misc2 = {EMPIR 2015: Health},
   publisher = {Oxford University Press (OUP)},
   language = {30},
   ISSN = {1058-4838, 1537-6591},
   DOI = {10.1093/cid/ciz069},
   stag_bib_extends_levelofaccess = {NA},
   author = {Harris, K.A. and Dixon, G. and Balloux, F. and Spencer, H. and Kavaliunaite, E. and Doyle, R.M. and Shaw, L.P.}
}

@Article { DegiovanniB2019,
   subid = {1011},
   title = {Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology},
   journal = {Metrologia},
   year = {2019},
   month = {1},
   day = {25},
   volume = {56},
   number = {2},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {024001},
   keywords = {quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf7b2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Degiovanni, I.P. and Berchera, I.R.}
}

@Article { DegiovanniB20190,
   subid = {1011},
   title = {Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology},
   journal = {Metrologia},
   year = {2019},
   month = {1},
   day = {25},
   volume = {56},
   number = {2},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {024001},
   keywords = {quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf7b2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Degiovanni, I.P. and Berchera, I.R.}
}

@Article { DegiovanniB20191,
   subid = {1011},
   title = {Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology},
   journal = {Metrologia},
   year = {2019},
   month = {1},
   day = {25},
   volume = {56},
   number = {2},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {024001},
   keywords = {quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf7b2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Degiovanni, I.P. and Berchera, I.R.}
}

@Article { JohnsonKCE2019,
   subid = {1148},
   title = {Energy relaxation in hot electron quantum optics via acoustic and optical phonon emission},
   journal = {Physical Review B},
   year = {2019},
   month = {1},
   day = {22},
   volume = {99},
   number = {4},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {045306},
   keywords = {electron quantum optics, hot electron, energy relaxation, phonon},
   web_url = {https://arxiv.org/abs/1807.11814},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/PhysRevB.99.045306},
   stag_bib_extends_levelofaccess = {NA},
   author = {Emary, C. and Clark, L.A. and Kataoka, M. and Johnson, N.}
}

@Article { KochKBWHBISIK2019,
   title = {Does airborne ultrasound lead to activation of the auditory cortex?},
   journal = {Biomedical Engineering / Biomedizinische Technik},
   year = {2019},
   month = {1},
   day = {18},
   number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound},
   keywords = {airborne ultrasound; brain imaging; hearingthreshold},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Walter de Gruyter GmbH},
   language = {30},
   ISSN = {1862-278X, 0013-5585},
   DOI = {10.1515/bmt-2018-0048},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koch, C. and K{\"u}hler, R. and Bauer, M. and Weichenberger, M. and Hensel, J. and Br{\"u}hl, R. and Ihlenfeld, A. and Sander, T. and Ittermann, B. and K{\"u}hn, S.}
}

@Article { PiacentiniGRAVVMDG2019,
   subid = {1005},
   title = {Theoretical description and experimental simulation of quantum entanglement near open time-like curves via pseudo-density operators},
   journal = {Nature Communications},
   year = {2019},
   month = {1},
   day = {14},
   volume = {10},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {1-7},
   keywords = {quantum entanglement, pseudo-density operators,},
   web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-018-08100-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Piacentini, F. and Gramegna, M. and Rebufello, E. and Avella, A. and Virz{\`i}, S. and Vedral, V. and Marletto, C. and Degiovanni, I.P. and Genovese, M.}
}

@Proceedings { SavinA2019,
   subid = {977},
   title = {On-Wafer Residual Error Correction Through Adaptive Filtering of Verification Line Measurements},
   journal = {2018 International Workshop on Computing, Electromagnetics, and Machine Intelligence (CEMi)},
   year = {2019},
   month = {1},
   day = {14},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {79-80},
   keywords = {uncertainty,calibration,standards,measurement uncertainty,coplanar waveguides,scattering, parameters,microwave measurement},
   web_url = {https://doi.org/10.1109/CEMI.2018.8610566},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Stellenbosch, South Africa},
   event_name = {2018 International Workshop on Computing, Electromagnetics, and Machine Intelligence (CEMi)},
   event_date = {21-11-2018 to 24-11-2018},
   language = {30},
   ISBN = {978-1-5386-7845-9},
   DOI = {10.7795/EMPIR.14IND02.CA.20190403F},
   stag_bib_extends_levelofaccess = {NA},
   author = {Savin, A. and Arz, U.}
}

@Article { PiacentiniGRAVVMDG20190,
   subid = {1005},
   title = {Theoretical description and experimental simulation of quantum entanglement near open time-like curves via pseudo-density operators},
   journal = {Nature Communications},
   year = {2019},
   month = {1},
   day = {14},
   volume = {10},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1-7},
   keywords = {quantum entanglement, pseudo-density operators,},
   web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-018-08100-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Piacentini, F. and Gramegna, M. and Rebufello, E. and Avella, A. and Virz{\`i}, S. and Vedral, V. and Marletto, C. and Degiovanni, I.P. and Genovese, M.}
}

@Proceedings { Horneckervv2019,
   subid = {1147},
   title = {Characterization of DC current sensors under distorted conditions for railway applications},
   journal = {2018 IEEE International Conference on Electrical Systems for Aircraft, Railway, Ship Propulsion and Road Vehicles \& International Transportation Electrification Conference (ESARS-ITEC)},
   year = {2019},
   month = {1},
   day = {14},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   keywords = {current sensor, current measurement function, energy measurement function, railway application},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   event_place = {Nottingham, UK,},
   event_name = {Conference on Electrical Systems for Aircraft, Railway, Ship Propulsion and Road Vehicles (ESARS) \& International Transportation Electrification Conference (ITEC)},
   event_date = {07-11-2018 to 09-11-2018},
   language = {30},
   DOI = {10.5281/zenodo.3265659},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hornecker, R. and van Leeuwen, R. and van den Brom, H.E.}
}

@Article { SchererGDK2019,
   subid = {1106},
   title = {Noise-optimized ultrastable low-noise current amplifier},
   journal = {Review of Scientific Instruments},
   year = {2019},
   month = {1},
   day = {11},
   volume = {90},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {014706},
   keywords = {Transimpedance amplifier, noise, metrology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   DOI = {10.1063/1.5078572},
   stag_bib_extends_levelofaccess = {NA},
   author = {Scherer, H. and G{\"o}tz, M. and Drung, D. and Krause, C.}
}

@Article { HashadEJS2019,
   subid = {805},
   title = {Characterization of a force-balanced piston gauge as a primary pressure standard},
   journal = {Measurement},
   year = {2019},
   month = {1},
   volume = {131},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   pages = {723-729},
   keywords = {Primary pressure standard, Effective area, FPG characterization, Rarefied gas flow,},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0263224118308443},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2018.09.016},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hashad, A.S. and Ehlers, S. and Jusko, O. and Sabuga, W.}
}

@Article { SampleCL2019,
   subid = {972},
   title = {Electrical performance of bifacial silicon PV modules under different indoor mounting configurations affecting the rear reflected irradiance},
   journal = {Solar Energy},
   year = {2019},
   month = {1},
   volume = {177},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   pages = {471-482},
   keywords = {Bifacial, PV performance, Silicon modules},
   web_url = {https://ac.els-cdn.com/S0038092X18311514/1-s2.0-S0038092X18311514-main.pdf?_tid=b01e03f6-6af8-4d95-84c6-97f340a4e315\&acdnat=1548743260_0bede7742e05c52fb725fc5b521b678c},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0038-092X},
   DOI = {10.1016/j.solener.2018.11.051},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sample, T. and Casado, A. and Lopez-Garcia, J.}
}

@Article { JarosovaKBPN2019,
   subid = {975},
   title = {Intraocular Pressure Response to Short-Term Extreme Normobaric Hypoxia Exposure},
   journal = {Frontiers in Endocrinology},
   year = {2019},
   month = {1},
   volume = {9},
   number = {785},
   number2 = {16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements},
   pages = {1-7},
   keywords = {intraocular pressure, hypoxia, normobaric hypoxia, glaucoma, oxygen saturation},
   web_url = {https://www.frontiersin.org/research-topics/6935/the-role-of-hypoxia-in-the-regulation-of-metabolism},
   misc2 = {EMPIR 2016: Research Potential},
   publisher = {Frontiers Media SA},
   language = {30},
   ISSN = {1664-2392},
   DOI = {10.3389/fendo.2018.00785},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jarošov{\'a}, J. and Krejč{\'i}, J. and Botek, M. and Pluh{\'a}ček, F. and Najmanov{\'a}, E.}
}

@Article { OliveroDFGRBLKTMCKGD2019,
   subid = {1007},
   title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range},
   journal = {Metrologia},
   year = {2019},
   month = {1},
   volume = {56},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {015016},
   keywords = {colour centers, single-photon source, metrology for quantum technologies},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf6c8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Olivero, P. and Ditalia Tchernij, S. and Forneris, J. and Gramegna, M. and Ruo-Berchera, I. and Brida, G. and L{\'o}pez, M. and Kirkwood, R.A. and Traina, P. and Moreva, E. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.}
}

@Article { ZschiedrichFRBHG2019,
   subid = {1060},
   title = {Decomposition of scattered electromagnetic fields into vector spherical wave functions on surfaces with general shapes},
   journal = {Physical Review B},
   year = {2019},
   month = {1},
   volume = {99},
   number = {4},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {045406},
   keywords = {light scattering, vector spherical wave functions},
   web_url = {https://arxiv.org/abs/1808.02315},
   misc2 = {EMPIR 2017: Fundamental},
   language = {30},
   DOI = {10.1103/PhysRevB.99.045406},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zschiedrich, L. and Fernandez-Corbaton, I. and Rockstuhl, C. and Burger, S. and Hammerschmidt, M. and Garcia Santiago, X.}
}

@Article { OliveroDFGRBLKTMCKGD20190,
   subid = {1007},
   title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range},
   journal = {Metrologia},
   year = {2019},
   month = {1},
   volume = {56},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {015016},
   keywords = {colour centers, single-photon source, metrology for quantum technologies},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf6c8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Olivero, P. and Ditalia Tchernij, S. and Forneris, J. and Gramegna, M. and Ruo-Berchera, I. and Brida, G. and L{\'o}pez, M. and Kirkwood, R.A. and Traina, P. and Moreva, E. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.}
}

@Article { OliveroDFGRBLKTMCKGD20191,
   subid = {1007},
   title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range},
   journal = {Metrologia},
   year = {2019},
   month = {1},
   volume = {56},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {015016},
   keywords = {colour centers, single-photon source, metrology for quantum technologies},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf6c8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Olivero, P. and Ditalia Tchernij, S. and Forneris, J. and Gramegna, M. and Ruo-Berchera, I. and Brida, G. and L{\'o}pez, M. and Kirkwood, R.A. and Traina, P. and Moreva, E. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.}
}

@Article { GiblinL2019,
   subid = {1112},
   title = {Exploring a new ammeter traceability route for ionisation chamber measurements},
   journal = {Review of Scientific Instruments},
   year = {2019},
   month = {1},
   volume = {90},
   number = {1},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {014705},
   keywords = {Ionisation chambers, small current measurement, radionuclide metrology, small current traceability},
   web_url = {https://arxiv.org/abs/1808.09217},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.5052717},
   stag_bib_extends_levelofaccess = {NA},
   author = {Giblin, S.P. and Lorusso, G.}
}

@Article { PintoSP2019,
   subid = {1139},
   title = {Calculation of kQ factors for Farmer-type ionization chambers following the recent recommendations on new key dosimetry data},
   journal = {Physica Medica},
   year = {2019},
   month = {1},
   volume = {57},
   number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398},
   pages = {221-230},
   keywords = {kQ factors, Monte Carlo, Farmer Chambers, IAEA TRS398},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1120-1797},
   DOI = {10.1016/j.ejmp.2018.12.006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pinto, M. and Silvi, L. and Pimpinella, M.}
}

@Article { ThevenotSDP2019,
   subid = {1143},
   title = {The ampere and the electrical units in the quantum era},
   journal = {Comptes Rendus Physique},
   year = {2019},
   month = {1},
   volume = {20},
   number = {1-2},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {92-128},
   keywords = {Quantum electrical standards, Quantum hall devices, Small current traceability, Cryogenic Current Comparators, Quantum metrology triangle, SI redefinition, Ampere, base units, programmable quantum current generator, quantum calibrator},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1631-0705},
   DOI = {10.1016/j.crhy.2019.02.003},
   stag_bib_extends_levelofaccess = {NA},
   author = {Poirier, W. and Djordjevic, S. and Schopfer, F. and Thevenot, O.}
}

@Article { PlimmerLHCLGCSZCSP2019,
   subid = {1168},
   title = {Thermal response characteristics of a SPRIGT primary thermometry system},
   journal = {Cryogenics},
   year = {2019},
   month = {1},
   volume = {97},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {1-6},
   keywords = {Cryogenics, Cryogen-free cryostat, Pulse-tube cooler, Single-pressure refractive index gas thermometry, Thermal switch, Temperature, Metrology, Primary thermometry},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0011-2275},
   DOI = {10.1016/j.cryogenics.2018.10.015},
   stag_bib_extends_levelofaccess = {NA},
   author = {Plimmer, M. and Luo, E. and Han, D. and Chen, H. and Liu, W. and Gao, B. and Changzhao, P. and Song, Y. and Zhang, H. and Chen, Y. and Sparasci, F. and Pitre, L.}
}

@Article { HimbertSPP2019,
   subid = {1179},
   title = {Determinations of the Boltzmann constant},
   journal = {Comptes Rendus Physique},
   year = {2019},
   month = {1},
   volume = {20},
   number = {1-2},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {129-139},
   keywords = {Boltzmann constant, Primary thermometry, International System of Units (SI)},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1631-0705},
   DOI = {10.1016/j.crhy.2018.11.007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Himbert, M.E. and Sparasci, F. and Plimmer, M.D. and Pitre, L.}
}

@Article { ThevenotSDP20190,
   subid = {1143},
   title = {The ampere and the electrical units in the quantum era},
   journal = {Comptes Rendus Physique},
   year = {2019},
   month = {1},
   volume = {20},
   number = {1-2},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {92-128},
   keywords = {Quantum electrical standards, Quantum hall devices, Small current traceability, Cryogenic Current Comparators, Quantum metrology triangle, SI redefinition, Ampere, base units, programmable quantum current generator, quantum calibrator},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1631-0705},
   DOI = {10.1016/j.crhy.2019.02.003},
   stag_bib_extends_levelofaccess = {NA},
   author = {Thevenot, O. and Schopfer, F. and Djordjevic, S. and Poirier, W.}
}

@Techreport { Sutton2019,
   subid = {1209},
   title = {The NPL Standard Flame: Operating Instructions},
   journal = {NPL Report},
   year = {2019},
   month = {1},
   volume = {N/A},
   number = {N/A},
   number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2},
   keywords = {Flame thermometry, combustion thermometry, portable standard flame},
   misc2 = {EMPIR 2017: Industry},
   publisher = {NPL},
   language = {30},
   ISSN = {1754-2987},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://eprintspublications.npl.co.uk/8259/},
   author = {Sutton, G.}
}

@Techreport { VukanaciePNCG2019,
   subid = {1288},
   title = {Literature review of indoor radon surveys in Europe},
   journal = {JRC Technical Reports},
   year = {2019},
   month = {1},
   volume = {EUR 29613},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   keywords = {atmospheric pollutant, carcinogenic substance, chemical product, Europe, rare gas, research report, scientific research, toxic substance},
   web_url = {https://op.europa.eu/en/publication-detail/-/publication/1ae688eb-1555-11e9-81b4-01aa75ed71a1/language-en/format-PDF/source-109153861},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Publications Office of the European Union},
   language = {30},
   ISBN = {978-92-79-97643-8},
   ISSN = {1831-9424},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://dx.doi.org/10.2760/977726},
   author = { Vukanac, I. and Živanović, M. and Čeliković, I. and  Pantelić, G. and  Nikolić, J.K. and  Cinelli, G. and Gruber, V.}
}

@Article { ElsterSCWKL2019,
   subid = {1324},
   title = {Large-Scale Bayesian Spatial-Temporal Regression with Application to Cardiac MR-Perfusion Imaging},
   journal = {SIAM Journal on Imaging Sciences},
   year = {2019},
   month = {1},
   volume = {12},
   number = {4},
   number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion},
   pages = {2035-2062},
   keywords = {Bayesian spatial-temporal regression, cardiac MR, uncertainty quantification},
   misc2 = {EMPIR 2015: Health},
   publisher = {Society for Industrial \& Applied Mathematics (SIAM)},
   language = {30},
   ISSN = {1936-4954},
   DOI = {10.1137/19M1246274},
   stag_bib_extends_levelofaccess = {NA},
   author = {Elster, C. and Schaeffter, T. and Chiribiri, A. and W{\"u}bbeler, G. and Kolbitsch, C. and Lehnert, J.}
}

@Article { HashadVVNS2019,
   subid = {1020},
   title = {Computation of the effective area and associated uncertainties of non-rotating piston gauges FPG and FRS},
   journal = {Metrologia},
   year = {2019},
   volume = {56},
   number = {015004},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   pages = {1-10},
   keywords = {primary pressure standard, effective area, rarefied gas dynamics, FPG and FRS characterization},
   web_url = {https://doi.org/10.1088/1681-7575/aaee18},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1681-7575/19/015004+10$33.00},
   DOI = {10.1088/1681-7575/aaee18},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hashad, A.S. and Valougeorgis, D. and Vasileiadis, N. and Naris, S. and Sabuga, W.}
}

@Article { MohnsHBHR2019,
   subid = {1041},
   title = {Comparison of Reference Setups for Calibrating Power Transformer Loss Measurement Systems},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {power transformers, loss measurement, power transformer losses, load loss, shunt reactor, power measurement, comparison, calibration, high voltage, uncertainty.},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.1109/TIM.2018.2879171},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mohns, Enrico and Houtzager, Ernest and Badura, Henrik and Hoogenboom, Dennis and Rietveld, Gert}
}

@Article { LandiGGDCL2019,
   subid = {1038},
   title = {Measurement of the Absolute Phase Error of Digitizers},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   volume = {Early acce},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {1-8},
   keywords = {Calibration, Digital Low-Power Instrument Transformer (DLPIT), digitizer, Discrete Fourier Transform (DFT), phase measurement, Phasor Measurement Unit (PMU) ,power system measurements.},
   web_url = {https://ieeexplore.ieee.org/document/8624467},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2018.2888919},
   stag_bib_extends_levelofaccess = {NA},
   author = {Landi, C. and Giordano, D. and Gallo, D. and Delle Femine, A. and Crotti, G. and Luiso, M.}
}

@Article { BaduraCMR2019,
   subid = {1042},
   title = {A Fundamental Step-Up Method for Standard Voltage Transformers Based on an Active Capacitive High-Voltage Divider},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {Capacitors, Standards, Voltage measurement, Calibration, Uncertainty, Gain, Voltage transformersCapacitive divider, high voltage, inductive voltage divider (IVD), phase displacement, ratio error},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.7795/EMPIR.17NRM01.CA.20190408},
   stag_bib_extends_levelofaccess = {NA},
   author = {Badura, H. and Chunyang, J. and Mohns, E. and Raether, P.}
}

@Article { AkramMNBKKO2019,
   subid = {1056},
   title = {Pulsation of InGaAs photodiodes in liquid helium for driving Josephson arrays in ac voltage realization},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2019},
   volume = {29},
   number = {7},
   number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages},
   pages = {1200308},
   keywords = {Photodiodes, Integrated circuits, Josephson junctions, Optical distortion, Junctions, Bit rate, Optical pulses},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {1051-8223, 1558-2515, 2378-707},
   DOI = {10.1109/TASC.2019.2901573},
   stag_bib_extends_levelofaccess = {NA},
   author = {Akram, M.N. and Malmbekk, H. and Nguyen, T.A.T. and Behr, R. and Kieler, O. and Karlsen, B. and Ohlckers, P.A.}
}

@Article { SerazioPMZ2019,
   subid = {1071},
   title = {1 kV Wideband Voltage Transducer, a Novel Method for Calibration and a Voltage Measurement Chain},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   volume = {Online},
   number = {Early Acce},
   number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles},
   pages = {1-12},
   keywords = {Voltage measurement, Calibration, Probes, Transducers, Measurement uncertainty},
   web_url = {https://ieeexplore.ieee.org/abstract/document/8703141/authors\#authors},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   language = {30},
   ISSN = {Print ISSN: 0018-9456 Electron},
   DOI = {10.1109/TIM.2019.2912589},
   stag_bib_extends_levelofaccess = {NA},
   author = {Serazio, D. and Pogliano, U. and Modarres, M. and Zucca, M.}
}

@Article { RydlerB2019,
   subid = {1138},
   title = {Realization of Absolute Phase and AC Resistance of Current Shunts by Ratio Measurements},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   volume = {68},
   number = {6},
   number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements},
   pages = {2041-2046},
   keywords = {Capacitance, current shunt,impedance measurement, inductance, measurement standards, phase measurement, resistance},
   web_url = {https://ieeexplore.ieee.org/document/8608020},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   language = {30},
   ISSN = {1557-9662},
   DOI = {10.1109/TIM.2018.2882927},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rydler, K.E. and Bergsten, T.}
}

@Thesis { Cvelbar2019,
   subid = {1161},
   title = {Določanje in kvantifikacija mutacije humanega virusa citomegalije (CMV) za odpornost proti zdravilu ganciklovir},
   year = {2019},
   number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection,traceable monitoring and evaluation of antimicrobial resistance},
   keywords = {Humani virus citomegalije, odpornost, kvantitativni PCR, digitalni PCR},
   web_url = {https://plus.si.cobiss.net/opac7/bib/5046607},
   misc2 = {EMPIR 2015: Health},
   school = {Univerza V Ljubljana},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://repozitorij.uni-lj.si/IzpisGradiva.php?id=106576\&lang=eng},
   author = {Cvelbar, Tašja}
}

@Inbook { PriceRBSW2019,
   subid = {1192},
   title = {Standardisation of magnetic nanomaterials: Steps towards magnetic reference particles},
   year = {2019},
   volume = {PTB-Berich},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {200-208},
   keywords = {standardisation, magnetic nanomaterials, reference materials,},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Fachverlag NW in Carl Ed. Sch{\"u}nemann KG},
   address = {Bremen},
   booktitle = {NanoWorkshop 2018: Workshop on Reference Nanomaterials},
   language = {30},
   ISBN = {978-3-95606-440-1},
   ISSN = {0179-0609},
   DOI = {10.7795/110.20190412},
   stag_bib_extends_levelofaccess = {NA},
   author = {Price, A. and R{\"u}ttinger, R. and Bleul, R. and Steinhoff, U. and Wiekhorst, F.}
}

@Article { XUZWNZX2019,
   subid = {1203},
   title = {Self-calibration of in situ monoscopic deflectometric measurement in precision optical manufacturing},
   journal = {Optics Express},
   year = {2019},
   volume = {27},
   number = {5},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {7523-7536},
   keywords = {deflectometry; optical manufacturing; metrology; self-calibration;},
   web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-27-5-7523},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.27.007523},
   stag_bib_extends_levelofaccess = {NA},
   author = {XU, M. and ZHU, Y. and Wang, W. and NIU, Z. and Zhang, X. and XU, X.}
}

@Article { GodDCBYDDRW2019,
   subid = {1238},
   title = {High-rank Symmetries in Nuclei: Challenges for Prediction Capacities of the Nuclear Mean-field Theories},
   journal = {Acta Physica Polonica B},
   year = {2019},
   volume = {50},
   number = {3},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {685},
   keywords = {Nuclear mean field theory, modeling prediciton capacities, nuclear point group symmetreis, high-rank symmetries},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Jagiellonian University},
   language = {30},
   ISSN = {0587-4254, 1509-5770},
   DOI = {10.5506/APhysPolB.50.685},
   stag_bib_extends_levelofaccess = {NA},
   author = {G{\'o}źdź, A. and Dickel, T. and Curien, D. and Baran, A. and Yang, J. and Dedes, I. and Dudek, J. and Rouvel, D. and Wang, H.L.}
}

@Proceedings { BuzoianuRF2019,
   subid = {1244},
   title = {Recent progress in chemical measuring capabilities in INM as a result of EMRP/EMPIR Programme},
   journal = {19th International Congress of Metrology (CIM2019)},
   year = {2019},
   number = {20004 (2019)},
   number2 = {16RPT01: ChemMet-Cap: Development of scientific and technical capabilities in the field of chemical analysis},
   pages = {1-13},
   keywords = {ICP-MS, gas chromatography},
   misc2 = {EMPIR 2016: Research Potential},
   publisher = {EDP Sciences},
   event_place = {LNE},
   event_name = {CIM 2019 - 19th International Metrology Congress},
   event_date = {16-09-2019 to 21-09-2019},
   language = {30},
   DOI = {https://doi.org/10.1051/metrology/201920004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Buzoianu, M. and Radu, M. and Fisicaro, P.}
}

@Proceedings { Buzoianu2019,
   subid = {1245},
   title = {Work at the INM to Develop Measurement Capabilities to Assign Reference Values in Proficiency Testing Schemes},
   journal = {-},
   year = {2019},
   volume = {-},
   number = {-},
   number2 = {16RPT01: ChemMet-Cap: Development of scientific and technical capabilities in the field of chemical analysis},
   keywords = {Proficiency Testing Schemes},
   web_url = {http://www.pt-conf.org/2019/wp-content/uploads/2019/09/Proceedings-PT-Conf-2019.pdf},
   misc2 = {EMPIR 2016: Research Potential},
   publisher = {-},
   address = {1 rue Gaston Boissier},
   event_place = {LNE},
   event_name = {7TH INTERNATIONAL PROFICIENCY TESTING CONFERENCE},
   event_date = {10-09-2019 to 13-09-2019},
   language = {30},
   ISBN = {-},
   ISSN = {-},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.pt-conf.org/2019/wp-content/uploads/2019/09/Proceedings-PT-Conf-2019.pdf},
   author = {Buzoianu, M.}
}

@Article { NeufeldKCLLK2019,
   subid = {1304},
   title = {Novel Method and Procedure for Evaluating Compliance of Sources With Strong Gradient Magnetic Fields Such as Wireless Power Transfer Systems},
   journal = {IEEE Transactions on Electromagnetic Compatibility},
   year = {2019},
   volume = {ea},
   number = {ea},
   number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles},
   pages = {1-10},
   keywords = {Basic restrictions, compliance testing, magnetic field (MF) gradient, near-field source, standards, wireless power transfers (WPTs)},
   web_url = {https://ieeexplore.ieee.org/document/8789646},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9375, 1558-187X},
   DOI = {10.1109/TEMC.2019.2924519},
   stag_bib_extends_levelofaccess = {NA},
   author = {Neufeld, E. and Kuehn, S. and Capstick, M.H. and Lisewski, T. and Liorni, I. and Kuster, N.}
}

@Thesis { Kokka2019,
   subid = {1318},
   title = {Spatial and Spectral Corrections for Integrating Sphere Photometry and Radiometry},
   year = {2019},
   number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products},
   keywords = {metrology, integrating sphere, camera, photometry, radiometry},
   web_url = {https://aaltodoc.aalto.fi/handle/123456789/37563},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Aalto University},
   school = {Aalto University},
   language = {30},
   ISBN = {978-952-60-8541-8},
   ISSN = {1799-4942},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://aaltodoc.aalto.fi/handle/123456789/37563},
   author = {Kokka, A.}
}

@Article { VavassoriASCGPRCC2019,
   subid = {1307},
   title = {Magnetic imaging using geometrically constrained nano-domain walls},
   journal = {Nanoscale},
   year = {2019},
   volume = {11},
   number = {10},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {4478-4488},
   keywords = {MFM},
   web_url = {https://pubs.rsc.org/en/content/articlelanding/2019/NR/C8NR07729K\#!divAbstract},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2040-3364, 2040-3372},
   DOI = {10.1039/C8NR07729K},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vavassori, P. and Antonov, V. and Snoeck, E. and Cox, D. and Gatel, C. and Pancaldi, M. and Rodr{\'i}guez, L A. and Corte-Le{\'o}n, H. and Corte-Le{\'o}n, H.}
}

@Article { HughesPMP2019,
   subid = {1388},
   title = {Artifact-free coordinate registration of heterogeneous Large-Scale Metrology systems},
   journal = {CIRP Annals},
   year = {2019},
   volume = {68},
   number = {1},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   pages = {503-506},
   keywords = {Metrology, Sensor, Uncertainty},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0007-8506},
   DOI = {10.1016/j.cirp.2019.04.077},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hughes, B. and Peterek, M. and Montavon, B. and Pfeifer, T.}
}

@Proceedings { SPINELLICTVDKWMDDD2019,
   subid = {1405},
   title = {EURAMET EMPIR 18HLT06 RaCHy Project: Radiotherapy coupled with Hyperthermia (Induced by HITU)},
   journal = {unavailable},
   year = {2019},
   number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept},
   pages = {1032-1036},
   keywords = {External beam radiotherapy, EBRT, HITU, Ultrasound, Hyperthermia},
   web_url = {http://publications.rwth-aachen.de/record/767416},
   misc2 = {EMPIR 2018: Health},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik},
   event_place = {Aachen, Germany},
   event_name = {23rd International Congress on Acoustics : integrating 4th EAA Euroregio},
   event_date = {09-09-2019 to 13-09-2019},
   language = {30},
   ISBN = {978-3-939296-15-7},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {10.18154/RWTH-CONV-238838},
   author = {SPINELLI, A. and CACCIA, B. and TER HAAR, G. and VAN RHOON, G. and de Pooter, J. and Karab{\"o}ce, B. and Wilkens, V. and MILORO, P. and Durando, G. and DENKOWA, A. and DIJKEMA, R.}
}

@Article { SchererBKDG2018,
   subid = {1105},
   title = {Calibrating Ultrastable Low-Noise Current Amplifiers of the Second Generation With a Cryogenic Current Comparator},
   journal = {IEEE TRANSACTIONS ON INSTRUMENTATION AND MEASUREMENT},
   year = {2018},
   month = {12},
   day = {21},
   volume = {68},
   number = {6},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {2027-2033},
   keywords = {Calibration, current comparator, current measurement, low-noise amplifiers, measurement uncertainty.},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   language = {30},
   ISSN = {0018-9456},
   DOI = {10.1109/TIM.2018.2884060},
   stag_bib_extends_levelofaccess = {NA},
   author = {Scherer, H. and Becker, U. and Krause, C. and Drung, D. and G{\"o}tz, M.}
}

@Article { Giblin2018,
   subid = {1111},
   title = {Re-evaluation of uncertainty for calibration of 100 MΩ and 1 GΩ resistors at NPL},
   journal = {Metrologia},
   year = {2018},
   month = {12},
   day = {21},
   volume = {56},
   number = {1},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {015014},
   keywords = {Resistance traceability, resistance standards, small current measurements, Cryogenic Current Comparators},
   web_url = {https://arxiv.org/abs/1808.09214},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf52d},
   stag_bib_extends_levelofaccess = {NA},
   author = {Giblin, S.P.}
}

@Article { SchumacherPMWHMRFMGHU2018,
   subid = {1127},
   title = {Robust formation of quantum dots in GaAs/AlGaAs heterostructures for single-electron metrology},
   journal = {Metrologia},
   year = {2018},
   month = {12},
   day = {21},
   volume = {56},
   number = {1},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {014002},
   keywords = {quantum dot, single-electron, GaAs/AlGaAs, fabrication},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf4aa},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schumacher, H.W. and Pierz, K. and Marx, H. and Weimann, T. and Hinze, P. and Maradan, D. and Reifert, D. and Freise, L. and M{\"u}ller, A. and Gerster, T. and Hohls, F. and Ubbelohde, N.}
}

@Proceedings { HrabinaiPeHi2018,
   subid = {1129},
   title = {Investigating the use of the hydrogen cyanide (HCN) as an absorption media for laser spectroscopy},
   journal = {21st Czech-Polish-Slovak Optical Conference on Wave and Quantum Aspects of Contemporary Optics},
   year = {2018},
   month = {12},
   day = {18},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   keywords = {SI metre realisation, HCN gas, molecular spectroscopy, hyperfine transition, optical frequency comb},
   web_url = {https://arxiv.org/abs/1905.07272},
   misc2 = {EMPIR 2017: Industry},
   publisher = {SPIE},
   event_place = {Lednice, Czech Republic},
   event_name = {21st Czech-Polish-Slovak Optical Conference on Wave and Quantum Aspects of Contemporary Optics},
   event_date = {03-09-2018 to 07-09-2018},
   language = {30},
   DOI = {10.1117/12.2517761},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hrabina, J. and Č{\'i}žek, M. and Pravdova, L. and Rerucha, S. and Hošek, M. and Č{\'i}p, O.}
}

@Article { MerevK2018_2,
   subid = {1213},
   title = {Implementation and Analysis of a Reference Partial Discharge Measurement System},
   journal = {MAPAN},
   year = {2018},
   month = {12},
   day = {11},
   volume = {34},
   number = {1},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   pages = {43-48},
   keywords = {Partial discharge; Partial discharge measurement; Charge measurement; Calibration; Reference partialdischarge calibrator},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Springer Nature},
   address = {233 Spring St. New York NY 10013 United States},
   language = {30},
   ISSN = {0970-3950, 0974-9853},
   DOI = {10.1007/s12647-018-0296-y},
   stag_bib_extends_levelofaccess = {NA},
   author = {Merev, Ahmet and  Karaman,  Ismail}
}

@Article { SchioppoNMMLLIHCFBBBBAWSLWZZZ2018,
   subid = {958},
   title = {New bounds on dark matter coupling from a global network of optical atomic clocks},
   journal = {Science Advances},
   year = {2018},
   month = {12},
   volume = {4},
   number = {12},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {eaau4869},
   keywords = {optical atomic clocks, sensor network, dark matter},
   web_url = {http://advances.sciencemag.org/content/4/12/eaau4869.full},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Association for the Advancement of Science (AAAS)},
   language = {30},
   ISSN = {2375-2548},
   DOI = {10.1126/sciadv.aau4869},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schioppo, M. and Nicolodi, D. and Morzyński, P. and McGrew, W. and Ludlow, A. and Lodewyck, J. and Ido, T. and Hachisu, H. and Ciuryło, R. and Fasano, R. and Brown, R. and Bober, M. and Bilicki, S. and Beloy, K. and Ablewski, P. and Wcisło, P. and Sekido, M. and Le Targat, R. and Wolf, P. and Zhang, X. and Zjawin, B. and Zawada, M.}
}

@Article { MubarakRGMRS2018,
   subid = {984},
   title = {Noise Behavior and Implementation of Interferometer-Based Broadband VNA},
   journal = {IEEE Transactions on Microwave Theory and Techniques},
   year = {2018},
   month = {12},
   volume = {67},
   number = {1},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {249-260},
   keywords = {extreme  impedance  measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise,  vector  network  analyzer},
   web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=8566175},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9480, 1557-9670},
   DOI = {10.1109/TMTT.2018.2874667},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mubarak, F.A. and Romano, R. and Galatro, L. and Mascolo, V. and Rietveld, G. and Spirito, M.}
}

@Article { CrespoLopezUrrutiaKSS2018,
   subid = {980},
   title = {Highly charged ions: Optical clocks and applications in fundamental physics},
   journal = {Reviews of Modern Physics},
   year = {2018},
   month = {12},
   volume = {90},
   number = {4},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   keywords = {optical clocks},
   web_url = {https://arxiv.org/abs/1803.06532},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States},
   language = {30},
   ISSN = {0034-6861, 1539-0756},
   DOI = {10.1103/RevModPhys.90.045005},
   stag_bib_extends_levelofaccess = {NA},
   author = {Crespo L{\'o}pez-Urrutia, J.R. and Kozlov, M.G. and Schmidt, P. O. and Safronova, M.S.}
}

@Proceedings { nceABADU2018,
   subid = {1023},
   title = {Development of Dynamic Calibration Machine for Pressure Transducers},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {12},
   volume = {1065},
   number = {2018},
   number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures},
   pages = {162013},
   keywords = {dynamic pressure, dynamic calibration, pressure measurement, pressure calibration, pressure transducer, traceability, signal conditioning, drop mass},
   web_url = {https://doi.org/10.1088/1742-6596/1065/16/162013},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IOP Publishing},
   event_place = {Belfast},
   event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   ISBN = {1742-6588, 1742-6596},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/16/162013},
   stag_bib_extends_levelofaccess = {NA},
   author = {İnce, A.T. and Akşahin, E. and Bağcı, E. and Aydemir, B. and Durgut, Y. and Uslukılı\c{c}, U.}
}

@Proceedings { FateevPDJAWSSHSLAS2018,
   subid = {1022},
   title = {Development of measurement and calibration techniques for dynamic pressures and temperatures (DynPT): background and objectives of the 17IND07 DynPT project in the European Metrology Programme for Innovation and Research (EMPIR)},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {12},
   volume = {1065},
   number = {2018},
   number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures},
   pages = {162015},
   keywords = {dynamic pressure, dynamic temperature, traceability, measurement standard, calibration method, calibration procedure, measurement uncertainty, validation, reliability, pressure measurement, temperature measurement},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IOP Publishing},
   event_place = {Belfast},
   event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   DOI = {10.1088/1742-6596/1065/16/162015},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fateev, A. and Peruzzi, A. and Durgut, Y. and J{\"o}nsson, G. and Arrh{\'e}n, F. and Wynands, R. and Sutton, G. and Sarraf, C. and H{\"o}gstr{\"o}m, R. and Saxholm, S. and Liverts, M. and Adolfse, C. and Saxholm, S.}
}

@Thesis { Li2018,
   subid = {1125},
   title = {Single electron manipulation in silicon nanowires for quantum technologies},
   year = {2018},
   month = {12},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {single electron, silicon nanowire, quantum technologies},
   misc2 = {EMPIR 2015: SI Broader Scope},
   school = {University of Southampton},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://eprints.soton.ac.uk/id/eprint/426612},
   author = {Li, Z.}
}

@Article { LuoLYHLSPZGCGHP2018,
   subid = {1170},
   title = {Ultra-stable pressure is realized for Chinese single pressure refractive index gas thermometry in the range 30–90 kPa},
   journal = {Science Bulletin},
   year = {2018},
   month = {12},
   volume = {63},
   number = {24},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {1601-1603},
   keywords = {primary thermometry, low temperature, refractive index, microwave resonator},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2095-9273},
   DOI = {10.1016/j.scib.2018.12.001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Luo, E. and Liu, Y. and Yu, B. and Hu, J. and Liu, W. and Song, Y. and Pan, C. and Zhang, H. and Gambette, P. and Chen, H. and Gao, B. and Han, D. and Pitre, L.}
}

@Thesis { BrunPicard2018,
   title = {Une nouvelle g{\'e}n{\'e}ration d'{\'e}talons quantiques fond{\'e}e sur l'effet Hall quantique},
   year = {2018},
   month = {12},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Graph{\`e}ne, effet Hall quantique, m{\'e}trologie},
   web_url = {https://hal.archives-ouvertes.fr/tel-01973021},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Universit{\'e} Paris-Saclay},
   school = {Paris-Saclay},
   language = {37},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {2018SACLS549},
   author = {Brun-Picard, J.}
}

@Techreport { KleinHDBBK2018,
   subid = {1413},
   title = {NanoWorkshop 2018: Workshop on Reference Nanomaterials; Current Situation and needs: development, measurement, Standardization},
   journal = {PTB bericht},
   year = {2018},
   month = {12},
   volume = {F-61},
   number = {F-61},
   number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements},
   pages = {1-315},
   keywords = {Comparability of Measurement Results;Nanomaterial Properties;Nanometrology;Nanoparticle Characterization;Reference Nanomaterials;Standardization},
   web_url = {https://oar.ptb.de/resources/show/10.7795/110.20190412},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Physikalisch-Technische Bundesanstalt},
   language = {30},
   ISBN = {78-3-95606-440-1},
   ISSN = {0179-0609},
   DOI = {10.7795/110.20190412},
   stag_bib_extends_levelofaccess = {NA},
   author = {Klein, T. and Hodoroaba, V.-D. and Dziomba, T. and Buhr, E. and Bosse, H. and Krumrey, M.}
}

@Article { ColemanGKBDR2018,
   subid = {970},
   title = {Flow rate measurement in stacks with cyclonic flow – Error estimations using CFD modelling},
   journal = {Measurement},
   year = {2018},
   month = {12},
   volume = {129},
   number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions},
   pages = {167-183},
   keywords = {flow measurement, cyclonic flow, velocity measurements, standard reference method, ultrasonic flow measurement, EN ISO 16911-2, validated computational fluid dynamics (CFD) modelling, OpenFoam software, Emissions Trading System},
   web_url = {https://arxiv.org/ftp/arxiv/papers/1808/1808.10159.pdf},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2018.06.032},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gersl, J. and Knotek, S. and Belligoli, Z. and Dwight, R.P. and Robinson, R.A. and Coleman, M.D.}
}

@Article { DorscherASBSSPOHHSL2018,
   subid = {1054},
   title = {Towards an optical clock for space: Compact, high-performance optical lattice clock based on bosonic atoms},
   journal = {Physical Review A},
   year = {2018},
   month = {11},
   day = {29},
   volume = {98},
   number = {5},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {053443},
   keywords = {optical clocks, optical lattice clock, isotope shift, clock comparisons},
   web_url = {https://www.ptb.de/cms/fileadmin/internet/fachabteilungen/abteilung_4/4.3_quantenoptik_und_laengeneinheit/4.32/ori18.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.98.053443},
   stag_bib_extends_levelofaccess = {NA},
   author = {D{\"o}rscher, S. and Al-Masoudi, A. and Schwarz, R. and Bongs, K. and Singh, Y. and Schiller, S. and Pramod, M.S. and Origlia, S. and Herbers, S. and H{\"a}fner, S. and Sterr, U. and Lisdat, C.}
}

@Proceedings { SiboldTH2018,
   subid = {1049},
   title = {Delayed authentication and delayed measurement application in one-way synchronization},
   journal = {Proceedings of: 2018 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)},
   year = {2018},
   month = {11},
   day = {22},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {1-6},
   keywords = {time synchronization, Network Time Security (NTS), Time Security, security, authentication, integrity, Network Time Protocol (NTP)},
   web_url = {https://doi.org/10.1109/ISPCS.2018.8543083},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IEEE},
   event_place = {Geneva, Switzerland},
   event_name = {2018 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)},
   event_date = {30-09-2018 to 05-10-2018},
   language = {30},
   ISBN = {978-1-5386-4263-4},
   ISSN = {1949-0313},
   DOI = {10.7795/EMPIR.17IND06.CA.20190410A},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sibold, D. and Teichel, K. and Hildermeier, G.}
}

@Proceedings { PeinerXBVKF2018,
   subid = {1025},
   title = {Optimizing a Cantilever Measurement System towards High Speed, Nonreactive Contact-Resonance-Profilometry},
   journal = {Proceedings},
   year = {2018},
   month = {11},
   day = {21},
   volume = {2},
   number = {13},
   number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements},
   pages = {889},
   keywords = {contact resonance spectroscopy; layer analysis; piezoresistive; tactile cantilever;automatic gain control; phase-locked-loop},
   web_url = {https://www.mdpi.com/2504-3900/2/13/889},
   misc2 = {EMPIR 2017: Industry},
   publisher = {MDPI AG},
   event_place = {Graz, Austria},
   event_name = {Eurosensors 2018},
   event_date = {09-09-2018 to 12-09-2018},
   language = {30},
   ISSN = {2504-3900},
   DOI = {10.3390/proceedings2130889},
   stag_bib_extends_levelofaccess = {NA},
   author = {Peiner, E. and Xu, J. and Bertke, M. and Voss, T. and Krieg, L. and Fahrbach, M.}
}

@Proceedings { TeichelH2018,
   subid = {1050},
   title = {Experimental Evaluation of Attacks on TESLA-Secured Time Synchronization Protocols},
   journal = {Security Standardisation Research},
   year = {2018},
   month = {11},
   day = {21},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {37-55},
   keywords = {Time synchronization protocols, TESLA, Authentication, Experimental attack analysis, ASTS, TinySeRSync},
   web_url = {https://doi.org/10.1007/978-3-030-04762-7_3},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Springer International Publishing},
   event_place = {Darmstadt, Germany},
   event_name = {International Conference on Research in Security Standardisation},
   event_date = {26-11-2018 to 27-11-2018},
   language = {30},
   ISBN = {978-3-030-04761-0, 978-3-030-0},
   ISSN = {0302-9743, 1611-3349},
   DOI = {10.7795/EMPIR.17IND06.CA.20190410B},
   stag_bib_extends_levelofaccess = {NA},
   author = {Teichel, K. and Hildermeier, G.}
}

@Article { NewellHMRLKHCPYKE2018,
   subid = {994},
   title = {Confocal laser scanning microscopy for rapid optical characterization of graphene},
   journal = {Communications Physics},
   year = {2018},
   month = {11},
   day = {20},
   volume = {1},
   number = {1},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   keywords = {Confocal microscopy, graphene.},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer Nature America, Inc},
   language = {30},
   ISSN = {2399-3650},
   DOI = {10.1038/s42005-018-0084-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Newell, D.B. and Hight Walker, A.R. and Melios, C. and Rigosi, A.F. and Liu, C.I. and Kruskopf, M. and Hu, J. and Cheng, G. and Panchal, V. and Yang, Y. and Kazakova, O. and Elmquist, R.E.}
}

@Article { VasilatouE2018,
   subid = {895},
   title = {Characterization of a new miniCAST with diffusion flame and premixed flame options: Generation of particles with high EC content in the size range 30 nm to 200 nm},
   journal = {Aerosol Science and Technology},
   year = {2018},
   month = {11},
   day = {15},
   number2 = {16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols},
   pages = {1-16},
   keywords = {soot, black carbon, miniCAST, aerosol},
   web_url = {https://www.tandfonline.com/doi/full/10.1080/02786826.2018.1536818},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {0278-6826, 1521-7388},
   DOI = {10.1080/02786826.2018.1536818},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vasilatou, K. and Ess, M.N.}
}

@Article { KainzZMKNL2018,
   subid = {938},
   title = {Novel mechanistic model and computational approximation for electromagnetic safety evaluations of electrically short implants},
   journal = {Physics in Medicine \& Biology},
   year = {2018},
   month = {11},
   day = {12},
   volume = {63},
   number = {22},
   number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles},
   pages = {225015},
   keywords = {implants, safety, mechanistic model, electromagnetic fields, numerical dosimetry, standardization activities},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aae94c/pdf},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aae94c},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kainz, W. and Zastrow, E. and Murbach, M. and K{\"u}hn, S. and Neufeld, E. and Liorni, I.}
}

@Article { JaksiMODPCMTSSKDHLDGF2018,
   subid = {1009},
   title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond},
   journal = {ACS Photonics},
   year = {2018},
   month = {11},
   day = {12},
   volume = {5},
   number = {12},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {4864-4871},
   keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2330-4022, 2330-4022},
   DOI = {10.1021/acsphotonics.8b01013},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jakšić, M. and Meijer, J. and Olivero, P. and Degiovanni, I. P. and Pezzagna, S. and Celegato, F. and Moreva, E. and Traina, P. and Signorile, M. and Santonocito, S. and K{\"u}pper, J. and Damin, A. and Herzig, T. and L{\"u}hmann, T. and Ditalia Tchernij, S. and Genovese, P. M. and Forneris, J.}
}

@Article { JaksiMODPCMTSSKDHLDGF20180,
   subid = {1009},
   title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond},
   journal = {ACS Photonics},
   year = {2018},
   month = {11},
   day = {12},
   volume = {5},
   number = {12},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {4864-4871},
   keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2330-4022, 2330-4022},
   DOI = {10.1021/acsphotonics.8b01013},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jakšić, M. and Meijer, J. and Olivero, P. and Degiovanni, I. P. and Pezzagna, S. and Celegato, F. and Moreva, E. and Traina, P. and Signorile, M. and Santonocito, S. and K{\"u}pper, J. and Damin, A. and Herzig, T. and L{\"u}hmann, T. and Ditalia Tchernij, S. and Genovese, P. M. and Forneris, J.}
}

@Article { WinterRKP2018,
   title = {Multidimensional model to correct PV device performance measurements taken under diffuse irradiation to reference conditions},
   journal = {Solar Energy},
   year = {2018},
   month = {11},
   volume = {174},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {431-444},
   keywords = {Modeling; PV metrology; Calibration; Angle of incidence; Diffuse irradiance; Optical losses; Numerical method},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0038092X18308429?via\%3Dihub},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0038-092X},
   DOI = {10.1016/j.solener.2018.08.072},
   stag_bib_extends_levelofaccess = {NA},
   author = {Winter, S. and Riechelmann, S. and Kr{\"o}ger, I. and Plag, F.}
}

@Proceedings { DambrineRVMMDRH2018,
   subid = {1002},
   title = {On-Wafer Broadband Microwave Measurement of High Impedance Devices-CPW Test Structures with Integrated Metallic Nano-Resistances},
   journal = {2018 48th European Microwave Conference (EuMC)},
   year = {2018},
   month = {11},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {25-28},
   keywords = {S-parameters, microwave, uncertainty, on-wafer,},
   web_url = {https://hal.archives-ouvertes.fr/hal-02056825},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Madrid},
   event_name = {EuMC 2018},
   event_date = {23-09-2018 to 27-09-2018},
   language = {30},
   DOI = {10.23919/EuMC.2018.8541607},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dambrine, G. and Ridler, N.M. and Votsi, H. and Mascolo, V. and Mubarak, F. and Daff{\'e}, K. and Roch, I. and Haddadi, K.}
}

@Article { MartinezVerduCPVF2018,
   subid = {1008},
   title = {Definition of a measurement scale of graininess from reflectance and visual measurements},
   journal = {Optics Express},
   year = {2018},
   month = {11},
   volume = {26},
   number = {23},
   number2 = {16NRM08: BiRD: Bidirectional reflectance definitions},
   pages = {30116},
   keywords = {Graininess, texture effects, reflectance and traceability},
   web_url = {https://www.osapublishing.org/oe/fulltext.cfm?uri=oe-26-23-30116\&id=400717},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.26.030116},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mart{\'i}nez Verd{\'u}, F.M. and Campos, J. and Perales, E. and Vel{\'a}zquez, J.L.  and Ferrero, A.}
}

@Article { FarooqAMLPLVF2018,
   subid = {1028},
   title = {Autoignition studies of Liquefied Natural Gas (LNG) in a shock tube and a rapid compression machine},
   journal = {Fuel},
   year = {2018},
   month = {11},
   volume = {232},
   number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel},
   pages = {423-430},
   keywords = {Alternative fuels, combustion, kinetics, LNG, Shock tube, RCM},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0016236118308238},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0016-2361},
   DOI = {10.1016/j.fuel.2018.04.168},
   stag_bib_extends_levelofaccess = {NA},
   author = {Farooq, A. and AlAbbad, M. and Moshammer, K. and Lucassen, A. and Patel, V. and Lele, A.D. and Vallabhuni, S.K. and Fernandes, R.X.}
}

@Thesis { Teodoro2018,
   subid = {1263},
   title = {Investigation and Characterization of materials towards building ionization vacuum gauges},
   year = {2018},
   month = {11},
   number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge},
   keywords = {IISEYIonization gaugeXPSWork Function},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {FCT/UNL},
   address = {Lisbon},
   school = {Faculty of Sciences and Technology, Nova University of Lisbon},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/10362/52578},
   author = {Teodoro, Orlando}
}

@Thesis { 08690081512018,
   subid = {1264},
   title = {Desenvolvimento de um man{\'o}metro de ioniza\c{c}{\~a}o de elevada estabilidade},
   year = {2018},
   month = {11},
   number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge},
   keywords = {man{\'o}metro de ioniza\c{c}{\~a}o, simula\c{c}{\~a}o ,estabilidade, metrologia,SIMION},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Nova University of Lisbon},
   address = {Lisbon},
   school = {Faculty of Sciences and Technology, Nova University of Lisbon},
   language = {92},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/10362/59610}
}

@Article { CalossoPDPDS2018,
   subid = {997},
   title = {A scalable hardware and software control apparatus for experiments with hybrid quantum systems},
   journal = {Review of Scientific Instruments},
   year = {2018},
   month = {11},
   volume = {89},
   number = {11},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   pages = {113116},
   keywords = {Experiment control system, experiment control program, FPGA},
   web_url = {https://doi.org/10.1063/1.5049120},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1901.04851},
   author = {Calosso, C.E. and Pomponio, M. and Detti, A. and Perego, E. and Duca, L. and Sias, C.}
}

@Article { BarreraFigueroa2018,
   title = {Free-field reciprocity calibration of measurement microphones at frequencies up to 150 kHz},
   journal = {The Journal of the Acoustical Society of America},
   year = {2018},
   month = {10},
   day = {31},
   volume = {144},
   number = {4},
   number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound},
   pages = {2575-2583},
   keywords = {airborne noise assessment, ultrasound in air, microphone calibration, free-field reciprocity},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Acoustical Society of America (ASA)},
   language = {30},
   ISSN = {0001-4966},
   DOI = {10.1121/1.5063815},
   stag_bib_extends_levelofaccess = {NA},
   author = {Barrera-Figueroa, S.}
}

@Article { VargasBCMPR2018,
   subid = {894},
   title = {An Unmanned Aircraft System to Detect a Radiological Point Source Using RIMA Software Architecture},
   journal = {Remote Sensing},
   year = {2018},
   month = {10},
   day = {30},
   volume = {10},
   number = {11},
   number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident},
   pages = {1712},
   keywords = {UAS, CZT, UAS software Architecture, radiological detection},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2072-4292},
   DOI = {10.3390/rs10111712},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vargas, A. and Barrado, C. and Cuadrado, R. and Macias, M. and Pastor, E. and Royo, P.}
}

@Proceedings { HallstromH2018,
   subid = {854},
   title = {Application of Charge-Sensitive Preamplifier for the Calibration of Partial Discharge Calibrators Below 1 pC},
   journal = {2018 Conference on Precision Electromagnetic Measurements},
   year = {2018},
   month = {10},
   day = {22},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {calibration, measurement, measurement techniques, measurement uncertainty, partial discharge},
   web_url = {https://ieeexplore.ieee.org/document/8501003},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Paris, France},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   DOI = {10.5281/zenodo.1470240},
   stag_bib_extends_levelofaccess = {NA},
   author = {Havunen, J. and H{\"a}llstr{\"o}m, J.}
}

@Proceedings { JohannHDM2018,
   subid = {856},
   title = {Reference system for the Practical Peak Voltage calibration in Radiology and diagnostic applications},
   journal = {2018 Conference on Precision Electromagnetic Measurements},
   year = {2018},
   month = {10},
   day = {22},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {X-ray, High voltage, Transient, Impulse voltage, D{\'e}convolution, Practical Peak Voltage},
   web_url = {https://ieeexplore.ieee.org/document/8500915},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Paris},
   event_name = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   ISBN = {978-1-5386-0974-3},
   ISSN = {2160-0171},
   DOI = {10.5281/zenodo.1471188},
   stag_bib_extends_levelofaccess = {NA},
   author = {Johann, P. and Hanane, S. and Dominique, F. and Mohamed, A.}
}

@Proceedings { Elg2018,
   subid = {917},
   title = {Qualifying a transient recorder for traceable measurements of very fast transients},
   journal = {2018 Conference on Precision Electromagnetic Measurements},
   year = {2018},
   month = {10},
   day = {22},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Fast transients, high voltage, measurment uncertainty, traceability},
   web_url = {https://ieeexplore.ieee.org/document/8500980},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Paris, France},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   DOI = {10.5281/zenodo.1473324},
   stag_bib_extends_levelofaccess = {NA},
   author = {Elg, A.P.}
}

@Article { JakubowskiLKNPTRES2018,
   subid = {937},
   title = {Gadolinium in human brain sections and colocalization with other elements},
   journal = {Neurology - Neuroimmunology Neuroinflammation},
   year = {2018},
   month = {10},
   day = {19},
   volume = {6},
   number = {1},
   number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease},
   pages = {e515},
   keywords = {Gadolinium, Gadolinium-based contrast agents, Human brain, MRI, LA-ICP-MS, Iron, Copper, Phosphorus},
   web_url = {http://nn.neurology.org/content/6/1/e515/},
   misc2 = {EMPIR 2015: Health},
   publisher = {Ovid Technologies (Wolters Kluwer Health)},
   language = {30},
   ISSN = {2332-7812},
   DOI = {10.1212/NXI.0000000000000515},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jakubowski, N. and Linscheid, M.W. and Koch, A. and Neumann, B. and Paul, F. and Trog, S. and Radbruch, H. and El-Khatib, A.H. and Schellenberger, E.}
}

@Thesis { Spiess2018,
   subid = {1366},
   title = {Setup of a vibration-suppressed},
   year = {2018},
   month = {10},
   day = {17},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   keywords = {Optical ClockTrapped Ions},
   web_url = {https://pure.mpg.de/rest/items/item_3005557_2/component/file_3005558/content},
   misc2 = {EMPIR 2017: Fundamental},
   school = {University of Heidelberg},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/21.11116/0000-0002-5FDF-A},
   author = {Spiess, L.J.}
}

@Article { ClarkPLPBDMSSS2018,
   subid = {883},
   title = {Crystallographic texture can be rapidly determined by electrochemical surface analytics},
   journal = {Acta Materialia},
   year = {2018},
   month = {10},
   day = {15},
   volume = {159},
   number = {1},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {89-101},
   keywords = {Orientation mapping, Crystallographic characterisation, Electrochemical jet processing,},
   web_url = {https://www.sciencedirect.com/science/article/pii/S1359645418305998},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1359-6454},
   DOI = {10.1016/j.actamat.2018.07.059},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clark, M. and Patel, R. and Li, W. and Pieris, D. and Bisterov, I. and Dryburgh, P. and Mitchell-Smith, J. and Su, R. and Speidel, A. and Su, R.}
}

@Article { HuldSBGD2018,
   title = {Energy-based metric for analysis of organic PV devices in comparison with conventional industrial technologies},
   journal = {Renewable and Sustainable Energy Reviews},
   year = {2018},
   month = {10},
   volume = {93},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {76-89},
   keywords = {Energy, Transport and Climate},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1364-0321},
   DOI = {10.1016/j.rser.2018.04.029},
   stag_bib_extends_levelofaccess = {NA},
   author = {Huld, T. and Salis, E. and Bardizza, G. and Gracia-Amillo, A.M. and Dunlop, E.D.}
}

@Article { Chretien2018,
   title = {A note on computing the smallest conic singular value},
   journal = {Journal of Computational and Applied Mathematics},
   year = {2018},
   month = {10},
   volume = {340},
   number = {1},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   pages = {221-230},
   keywords = {Conic singular value, subdifferential, Lagrange duality, Newton's method},
   web_url = {https://arxiv.org/pdf/1807.02589.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0377-0427},
   DOI = {10.1016/j.cam.2018.02.035},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chretien, S.}
}

@Article { MehdiSouzaniANA2018,
   subid = {863},
   title = {A novel hybrid trust region minimax fitting algorithm for accurate dimensional metrology of aspherical shapes},
   journal = {Measurement},
   year = {2018},
   month = {10},
   volume = {127},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {134-140},
   keywords = {Trust region methods, Aspheric shapes, Minimax, Chebyshev fitting, Minimization, Form error, Dimensional metrology, Ultra-high precision engineering},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2018.05.071},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mehdi-Souzani, C. and Anwer, N. and Nouira, H. and Arezki, Y.}
}

@Article { KuosmanenTHWV2018,
   title = {Uncertainty analysis of phase and amplitude of harmonic components of bearing inner ring four-point roundness measurement},
   journal = {Precision Engineering},
   year = {2018},
   month = {10},
   volume = {54},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   pages = {118-130},
   keywords = {Monte-Carlo simulation, Phase uncertainty, Harmonic component uncertainty, Uncertainty evaluation, Bearing excitation, Odd and even harmonic components, Four-point method, Three-point method},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0141635918302368},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0141-6359},
   DOI = {10.1016/j.precisioneng.2018.05.008},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kuosmanen, P. and Tammi, K. and Hemming, B. and Widmaier, T. and Viitala, R.}
}

@Article { TarletonHD2018,
   subid = {932},
   title = {Consistent determination of geometrically necessary dislocation density from simulations and experiments},
   journal = {International Journal of Plasticity},
   year = {2018},
   month = {10},
   volume = {109},
   number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials},
   pages = {18-42},
   keywords = {density},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0749-6419},
   DOI = {10.1016/j.ijplas.2018.05.001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tarleton, E. and Hofmann, F. and Das, S.}
}

@Article { LandiGGFCL2018,
   subid = {1039},
   title = {Measurement of Absolute Phase Error of Digitizers},
   journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {10},
   volume = {1},
   number = {1},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {1-2},
   keywords = {Phase Measurement,Data Acquisition System,Calibration,Power System Measurements,DFT,PMU,LPIT},
   web_url = {https://doi.org/10.5281/zenodo.2628739},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IEEE},
   language = {30},
   ISSN = {2160-0171},
   DOI = {10.1109/TIM.2018.2888919},
   stag_bib_extends_levelofaccess = {NA},
   author = {Landi, C. and Giordano, D. and Gallo, D. and Femine, A.D. and Crotti, G. and Luiso, M.}
}

@Article { SymmondsDLLFDWL2018,
   subid = {1079},
   title = {Measurements of ultrasonic deterrents and an acoustically branded hairdryer: Ambiguities in guideline compliance},
   journal = {The Journal of the Acoustical Society of America},
   year = {2018},
   month = {10},
   volume = {144},
   number = {4},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {2565-2574},
   keywords = {ultrasound public sources},
   misc2 = {EMPIR 2015: Health},
   publisher = {Acoustical Society of America (ASA)},
   language = {30},
   ISSN = {0001-4966},
   DOI = {10.1121/1.5064279},
   stag_bib_extends_levelofaccess = {NA},
   author = {Symmonds, M. and Dennison, S.R. and Lineton, B. and Lloyd Jones, S. and Fletcher, M.D. and Dolder, C.N. and White, P.R. and Leighton, T.G.}
}

@Article { Leighton2018,
   subid = {1081},
   title = {Ultrasound in air—Guidelines, applications, public exposures, and claims of attacks in Cuba and China},
   journal = {The Journal of the Acoustical Society of America},
   year = {2018},
   month = {10},
   volume = {144},
   number = {4},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {2473-2489},
   keywords = {Ultrasound editorial Cuba},
   misc2 = {EMPIR 2015: Health},
   publisher = {Acoustical Society of America (ASA)},
   language = {30},
   ISSN = {0001-4966},
   DOI = {10.1121/1.5063351},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leighton, T.G.}
}

@Article { LinetonLDWLF2018,
   subid = {1078},
   title = {Effects of very high-frequency sound and ultrasound on humans. Part II: A double-blind randomized provocation study of inaudible 20-kHz ultrasound},
   journal = {The Journal of the Acoustical Society of America},
   year = {2018},
   month = {10},
   volume = {144},
   number = {4},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {2521-2531},
   keywords = {ultrasound inaudible},
   misc2 = {EMPIR 2015: Health},
   publisher = {Acoustical Society of America (ASA)},
   language = {30},
   ISSN = {0001-4966},
   DOI = {10.1121/1.5063818},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lineton, B. and Leighton, T.G. and Dolder, C.N. and White, P.R. and Lloyd Jones, S. and Fletcher, M.D.}
}

@Article { LinetonLDWLF2018_2,
   subid = {1078},
   title = {Effects of very high-frequency sound and ultrasound on humans. Part I: Adverse symptoms after exposure to audible very-high frequency sound},
   journal = {The Journal of the Acoustical Society of America},
   year = {2018},
   month = {10},
   volume = {144},
   number = {4},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {2511-2520},
   keywords = {ultrasound audible symptoms},
   misc2 = {EMPIR 2015: Health},
   publisher = {Acoustical Society of America (ASA)},
   language = {30},
   ISSN = {0001-4966},
   DOI = {10.1121/1.5063819},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lineton, B. and Leighton, T.G. and Dolder, C.N. and White, P.R. and Lloyd Jones, S. and Fletcher, M.D.}
}

@Article { LeightonLDWLF2018,
   subid = {1080},
   title = {Public exposure to ultrasound and very high-frequency sound in air},
   journal = {The Journal of the Acoustical Society of America},
   year = {2018},
   month = {10},
   volume = {144},
   number = {4},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {2554-2564},
   keywords = {ultrasound public exposure},
   misc2 = {EMPIR 2015: Health},
   publisher = {Acoustical Society of America (ASA)},
   language = {30},
   ISSN = {0001-4966},
   DOI = {10.1121/1.5063817},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leighton, T.G. and Lineton, B. and Dolder, C.N. and White, P.R. and Lloyd Jones, S. and Fletcher, M.D.}
}

@Article { SimonsenMO2018,
   subid = {1273},
   title = {An investigation into a calibration scheme for a light pipe based temperature probe},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {10},
   volume = {29},
   number = {11},
   number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2},
   pages = {115004},
   keywords = {pyrometry, optical thermometry, uncertainty, temperature, traceability, light piping},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Institute of Physics},
   address = {London},
   language = {30},
   ISSN = {1361-6501},
   DOI = {10.1088/1361-6501/aade6f},
   stag_bib_extends_levelofaccess = {NA},
   author = {Simonsen, S. and Mathisen, H. and Olsen, A.A.F.}
}

@Article { PepperRFJGFSSREJJK2018,
   subid = {1113},
   title = {LO-Phonon Emission Rate of Hot Electrons from an On-Demand Single-Electron Source in a GaAs/AlGaAs Heterostructure},
   journal = {Physical Review Letters},
   year = {2018},
   month = {9},
   day = {26},
   volume = {121},
   number = {13},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Single electron pumps, hot electron transport, phonon emission, phonon relaxation, optical phonons, edge states, electron optics, electron quantum optics},
   web_url = {https://arxiv.org/abs/1712.09031},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.121.137703},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pepper, M. and Ritchie, D.A. and Farrer, I. and Jones, G.A.C. and Griffiths, J.P. and Fletcher, J.D. and See, P. and Sim, H.S. and Ryu, S. and Emary, C. and Johnson, N. and Janssen, T.J.B.M. and Kataoka, M.}
}

@Article { RuttTTHLHILS2018,
   subid = {1122},
   title = {Manipulation of random telegraph signals in a silicon nanowire transistor with a triple gate},
   journal = {Nanotechnology},
   year = {2018},
   month = {9},
   day = {25},
   volume = {29},
   number = {47},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {475201},
   keywords = {random telegraph signal, silicon nanowire, quantum dot, MOSFET},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/aadfa6/meta\#back-to-top-target},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-4484, 1361-6528},
   DOI = {10.1088/1361-6528/aadfa6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rutt, H. and Tsuchiya, Y. and Tomita, I. and Hillier, J. and Li, Z. and Husain, M.H. and Ibukuro, K. and Liu, F. and Saito, S.}
}

@Thesis { 8b84df27fc2018,
   subid = {1416},
   title = {LYSO-SiPM-ilmaisintekniikkaan perustuvan digitaalisen PET-kameran suorituskyvyn arviointi H215O-torsofantomilla},
   year = {2018},
   month = {9},
   day = {25},
   number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion},
   keywords = {PET},
   web_url = {https://www.utupub.fi/handle/10024/146026},
   misc2 = {EMPIR 2015: Health},
   publisher = {University of Turku},
   school = {Turun yliopisto - University of Turku},
   language = {36},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://urn.fi/URN:NBN:fi-fe2018092736833}
}

@Article { ChebenVMOHLSWH2018,
   subid = {873},
   title = {Tilted subwavelength gratings: controlling anisotropy in metamaterial nanophotonic waveguides},
   journal = {Optics Letters},
   year = {2018},
   month = {9},
   day = {21},
   volume = {43},
   number = {19},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {4691},
   keywords = {Subwavelength, anisotropy, silicon, waveguides},
   web_url = {https://riuma.uma.es/xmlui/handle/10630/16695},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {0146-9592, 1539-4794},
   DOI = {10.1364/OL.43.004691},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cheben, P. and Velasco, A.V. and Molina-Fernandez, I. and Ortega-Monux, A. and Herrero-Bermello, A. and Luque-Gonz{\'a}lez, J.M. and Schmid, J.H. and Wang, S. and Halir, R.}
}

@Article { UrbachVG2018,
   subid = {953},
   title = {Role of Radial Charges on the Angular Momentum of Electromagnetic Fields: Spin-3/2 Light},
   journal = {Physical Review Letters},
   year = {2018},
   month = {9},
   day = {21},
   volume = {121},
   number = {12},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {123202-1},
   keywords = {Angular Momentum of Light, Electromagnetism, Helmholtz Natural Modes, Spin-orbit coupling, Light propagation, transmission and absorption, Metrology, Optical vortices, Classical field theory},
   misc2 = {EMPIR 2016: Energy},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.121.123202},
   stag_bib_extends_levelofaccess = {NA},
   author = {Urbach, H.P. and Van Mechelen, T. and Gawhary, O.E.}
}

@Article { ZibordiT2018,
   subid = {960},
   title = {Non-linear response of a class of hyper-spectral radiometers},
   journal = {Metrologia},
   year = {2018},
   month = {9},
   day = {21},
   volume = {55},
   number = {5},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   pages = {747-758},
   keywords = {Non-linearity, Hyperspectral radiometry, Ocean colour},
   web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/aadd7f/pdf},
   misc2 = {EMPIR 2016: Environment},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aadd7f},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zibordi, G. and Talone, M.}
}

@Article { BurianovaVS2018,
   subid = {810},
   title = {Tissue-equivalence of 3D-printed plastics for medical phantoms in radiology},
   journal = {Journal of Instrumentation},
   year = {2018},
   month = {9},
   day = {20},
   volume = {13},
   number = {09},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   pages = {P09018-P09018},
   keywords = {Medical phantom; radiology; ionizing radiation; 3D print; linear attenuation coefficient; Hounsfield unit},
   web_url = {http://mrtdosimetry-empir.eu/?page_id=1166},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/13/09/P09018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Burianov{\'a}, L. and Vrba, T. and Solc, J.}
}

@Article { HisamotoRHLASTYTLSK2018,
   subid = {595},
   title = {Quantum Dipole Effects in a Silicon Transistor under High Electric Fields},
   journal = {Journal of the Physical Society of Japan},
   year = {2018},
   month = {9},
   day = {15},
   volume = {87},
   number = {9},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {094801},
   keywords = {Si, CMOS, transistor, quantum dipole, Heisenberg model},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Physical Society of Japan},
   language = {30},
   ISSN = {0031-9015, 1347-4073},
   DOI = {10.7566/jpsJ.87.094801},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hisamoto, D. and Rutt, H.N. and Husain, M.K. and Liu, F. and Arimoto, H. and Sasago, Y. and Tsuchiya, Y. and Yoshimoto, H, and Tomita, I. and Li, Z. and Saito, S. and Kurihara, S.}
}

@Article { KonijnenbergGMGGCGR2018,
   subid = {825},
   title = {EANM practical guidance on uncertainty analysis for molecular radiotherapy absorbed dose calculations},
   journal = {European Journal of Nuclear Medicine and Molecular Imaging},
   year = {2018},
   month = {9},
   day = {14},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   keywords = {Dosimetry, Absorbed Dose},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature America, Inc},
   language = {30},
   ISSN = {1619-7070, 1619-7089},
   DOI = {10.1007/s00259-018-4136-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Konijnenberg, M. and Glatting, G. and Murray, I. and Gleisner, K.S. and Gustafsson, J. and Cox, M.G. and Gear, J.I. and Robinson, A.}
}

@Proceedings { CarabelliDPDFTMGR2018,
   subid = {1414},
   title = {Color centres in diamond from single photon sources to ODMR in cells},
   journal = {Quantum Photonic Devices 2018},
   year = {2018},
   month = {9},
   day = {11},
   volume = {10733},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1073304},
   keywords = {Diamond,Color centers,Confocal microscopy,Electroluminescence,Single photon},
   web_url = {https://iris.unito.it/handle/2318/1685641\#.XjvhgWhKhPY},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {SPIE},
   event_place = {San Diego, California, United States},
   event_name = {SPIE NanoScience + Engineering},
   event_date = {19-08-2018 to 23-08-2018},
   language = {30},
   DOI = {10.1117/12.2323102},
   stag_bib_extends_levelofaccess = {NA},
   author = {Carabelli, V. and Degiovanni, I.P. and Picollo, F. and Ditalia Tchernij, S. and Forneris, J. and Traina, P. and Moreva, E. and Genovese, M. and Ruo Berchera, I.}
}

@Article { KuosmanenWV2018,
   title = {Subcritical vibrations of a large flexible rotor efficiently reduced by modifying the bearing inner ring roundness profile},
   journal = {Mechanical Systems and Signal Processing},
   year = {2018},
   month = {9},
   volume = {110},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   pages = {42-58},
   keywords = {Rotor dynamics, Dynamic run-out, Low-order bearing waviness, Four-point method},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0888327018301298},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0888-3270},
   DOI = {10.1016/j.ymssp.2018.03.010},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kuosmanen, P. and Widmaier, T. and Viitala, R.}
}

@Article { FlueggeNFSHDS2018,
   subid = {709},
   title = {Metrological large range magnetic force microscopy},
   journal = {Review of Scientific Instruments},
   year = {2018},
   month = {9},
   volume = {89},
   number = {9},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {093703},
   keywords = {metrological magnetic force microscopy, large range, stray field},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.5035175},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fluegge, J. and Neu, V. and Fern{\'a}ndez Scarioni, A. and Sievers, S. and Hu, X. and Dai, G. and Schumacher, H.W.}
}

@Article { HaddadiGDDD2018,
   subid = {783},
   title = {On-Wafer Series-Through Broadband Measurement of Sub-fF55-nm MOS RF Voltage-Tunable Capacitors},
   journal = {IEEE Microwave and Wireless Components Letters},
   year = {2018},
   month = {9},
   volume = {28},
   number = {9},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {831-833},
   keywords = {Microwave, on-wafer, S-parameters, capacitor, uncertainty},
   web_url = {https://hal.archives-ouvertes.fr/hal-01873048},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {445 Hoes Lane Piscataway NJ 08855-1331 United States},
   language = {30},
   ISSN = {1531-1309, 1558-1764},
   DOI = {10.1109/LMWC.2018.2851386},
   stag_bib_extends_levelofaccess = {NA},
   author = {Haddadi, K. and Gaquiere, C. and Durand, C. and Dambrine, G. and Daff{\'e}, K.}
}

@Article { KonemannOWESFS2018,
   subid = {806},
   title = {Selection and Characterization of Liquids for a Low Pressure Interferometric Liquid Column Manometer},
   journal = {Measurement},
   year = {2018},
   month = {9},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   keywords = {primary pressure standard, low pressure, liquid column manometer, vacuum oil, gas saturation},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2018.09.017},
   stag_bib_extends_levelofaccess = {NA},
   author = {K{\"o}nemann, J. and Ott, O. and Wolf, H. and Ehlers, S. and Šetina, J. and Furtado, A. and Sabuga, W.}
}

@Proceedings { ProbstHDSPA2018_2,
   subid = {939},
   title = {Impact of Substrate Modes on mTRL-Calibrated CPW Measurements in G Band},
   journal = {2018 48th European Microwave Conference (EuMC)},
   year = {2018},
   month = {9},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {on-wafer  probes,  coplanar  waveguides  (CPW), substrate modes, calibration},
   web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/impact-of-substrate-modes-on-mtrl-calibrated-cpw-measurements-in-g-band},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Madrid},
   event_name = {2018 48th European Microwave Conference},
   event_date = {23-09-2018 to 28-09-2018},
   language = {30},
   DOI = {10.23919/EuMC.2018.8541813},
   stag_bib_extends_levelofaccess = {NA},
   author = {Probst, T. and Heinrich, W. and Doerner, R.  and Schmuckle, F.J. and Phung, G.N. and Arz, U.}
}

@Proceedings { SteinhoffWMW2018,
   subid = {952},
   title = {Metrology and Standardisation of Magnetic Nanoparticles for Biomedical Applications},
   journal = {Biomedical Engineering / Biomedizinische Technik},
   year = {2018},
   month = {9},
   volume = {63},
   number = {s1},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {S261},
   keywords = {Magnetic nanoparticles, standardisation},
   web_url = {https://www.degruyter.com/downloadpdf/j/bmte.2018.63.issue-s1/bmt-2018-6048/bmt-2018-6048.xml},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Walter de Gruyter GmbH},
   event_place = {Aachen},
   event_name = {2018 Annual Meeting of the German Society of Biomedical Engineering},
   event_date = {26-09-2018 to 28-09-2018},
   language = {30},
   ISSN = {1862-278X, 0013-5585},
   DOI = {10.1515/bmt-2018-6048},
   stag_bib_extends_levelofaccess = {NA},
   author = {Steinhoff, U. and Wells, J. and Marks, G. and Wiekhorst, F.}
}

@Article { VanhaeckeCL2018_2,
   subid = {971},
   title = {Ultra-trace Cu isotope ratio measurements via multi-collector ICP-mass spectrometry using Ga as internal standard: an approach applicable to micro-samples},
   journal = {Analytica Chimica Acta},
   year = {2018},
   month = {9},
   volume = {1025},
   number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease},
   pages = {69-79},
   keywords = {MC-ICP-MS; Copper; Gallium; Isotope ratio; Interferences; Micro-samples},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0003267018306147?via\%3Dihub},
   misc2 = {EMPIR 2015: Health},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0003-2670},
   DOI = {10.1016/j.aca.2018.05.025},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vanhaecke, F. and Costas-Rodr{\'i}guez, M. and Lauwens, S.}
}

@Article { LangellaGDCL2018,
   subid = {1037},
   title = {Compensation of Current Transformers' Non-Linearities by Means of Frequency Coupling Matrices},
   journal = {2018 IEEE 9th International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2018},
   month = {9},
   volume = {1},
   number = {1},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {1-6},
   keywords = {Current Transformer, Calibration, Non-linearity, Power System Measurement, Harmonics, Compensation},
   web_url = {https://zenodo.org/record/2628408\#.XKYZ3pgzaCo},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IEEE},
   language = {30},
   ISSN = {2475-2304},
   DOI = {10.5281/zenodo.2628408},
   stag_bib_extends_levelofaccess = {NA},
   author = {Langella, R. and Gallo, D. and Delle Femine, A. and Collin, A.J. and Luiso, M.}
}

@Article { MarquardtJ2018,
   subid = {1068},
   title = {Amplitude Modulation May Be Confused with Infrasound},
   journal = {Acta Acustica united with Acustica},
   year = {2018},
   month = {9},
   volume = {104},
   number = {5},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {825-829},
   keywords = {Infrasound, auditory perception, psychoacoustic},
   misc2 = {EMPIR 2015: Health},
   publisher = {S. Hirzel Verlag},
   language = {30},
   ISSN = {1610-1928},
   DOI = {10.3813/AAA.919232},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marquardt, T. and Jurado, C.}
}

@Article { LandiGDRGCLM2018,
   subid = {1146},
   title = {Pantograph-to-OHL Arc: Conducted Effects in DC Railway Supply System},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2018},
   month = {9},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   keywords = {DC railway system, Electric arc, Rail transportation Pantograph–catenary, Predictive maintenance},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/TIM.2019.2902805},
   stag_bib_extends_levelofaccess = {NA},
   author = {Landi, C. and Gallo, D. and Delle Femine, A. and Roccato, P. and Giordano, D. and Crotti, G. and Luiso, M. and Mariscotti, A.}
}

@Article { LandiGDGCL2018,
   subid = {1145},
   title = {A Testbed for Static and Dynamic Characterization of DC Voltage and Current Transducers},
   journal = {2018 IEEE 9th International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2018},
   month = {9},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   keywords = {DC railway system, power and energy measurement, voltage and current transducer, static and dynamic characterizzation},
   web_url = {https://doi.org/10.1109/AMPS.2018.8494873},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   language = {30},
   DOI = {10.5281/zenodo.3265102},
   stag_bib_extends_levelofaccess = {NA},
   author = {Landi, C. and Gallo, D. and Delle Ferninc, A. and Giordano, D. and Crotti, G. and Luiso, M.}
}

@Article { YangBJCJTS2018,
   title = {Individualized magnetoencephalography using optically pumped magnetometers with an anatomy derived sensor holder},
   journal = {Biomedical Engineering / Biomedizinische Technik},
   year = {2018},
   month = {9},
   volume = {63},
   number = {s1},
   number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound},
   pages = {240},
   keywords = {OPM, SQUID, SQUID-MEG, signal-to-noise ratio},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Walter de Gruyter GmbH},
   address = {Berlin},
   language = {30},
   ISSN = {1862-278X, 0013-5585},
   DOI = {10.1515/bmt-2018-6045},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yang, T. and Br{\"u}hl, R. and  Jodko-Władzińska, A. and Cotic Smole, P. and Jazbinšek, V. and Trahms, L. and Sander-Th{\"o}mmes, T.}
}

@Proceedings { AllalARJG2018,
   subid = {1032},
   title = {Efficient Experimental Assessment of The Specific Absorption Rate (SAR) Induced by MIMO Wireless Communication Devices; Application of Vector Near-Field Measurement System},
   journal = {2018 IEEE Conference on Antenna Measurements \& Applications (CAMA)},
   year = {2018},
   month = {9},
   number2 = {16NRM07: Vector SAR: SAR measurement using vector probes},
   pages = {1-4},
   keywords = {SAR, MIMO, Planar Near-Field Measurement System, Vector Field Measurement},
   web_url = {https://hal.archives-ouvertes.fr/hal-02376333},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IEEE},
   event_place = {Vasteras},
   event_name = {2018 IEEE Conference on Antenna Measurements \& Applications (CAMA)},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   DOI = {10.1109/CAMA.2018.8530621},
   stag_bib_extends_levelofaccess = {NA},
   author = {Allal, D. and Aberbour, L. and Ramdani, M. and Jawad, O. and Giry, P.}
}

@Article { LeuenbergerPHMVN2018,
   title = {Effect of moisture on the adsorption of ammonia},
   journal = {Applied Physics B},
   year = {2018},
   month = {8},
   day = {30},
   volume = {124},
   number = {9},
   number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air},
   pages = {189},
   keywords = {Ammonia, adsorption, moisture},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Springer Nature America, Inc},
   language = {30},
   ISSN = {0946-2171, 1432-0649},
   DOI = {10.1007/s00340-018-7054-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leuenberger, D. and Persijn, S. and Halonen, L. and Mets{\"a}l{\"a}, M. and Vaittinen, O. and Niederhauser, B.}
}

@Proceedings { SenC2018,
   subid = {836},
   title = {Improved Just-Before-Test Verification Methods with VNA for Conducted EMC Tests},
   journal = {2018 International Symposium on Electromagnetic Compatibility (EMC EUROPE)},
   year = {2018},
   month = {8},
   day = {30},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {1-6},
   keywords = {Conducted Emission, Conducted Immunity, EMC, Verification},
   web_url = {http://rfmw.cmi.cz/documents/papers/Sen_EMCEurope2018OA.pdf},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   address = {Piscataway, USA},
   event_place = {Amsterdam, The Netherlands},
   event_name = {2018 International Symposium on Electromagnetic Compatibility (EMC EUROPE)},
   event_date = {27-08-2018 to 30-08-2018},
   language = {30},
   ISBN = {978-1-4673-9698-1},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2018.8485179},
   stag_bib_extends_levelofaccess = {NA},
   author = {Şen, O. and \c{C}akır, S.}
}

@Article { HaasSSRBH2018,
   title = {A gravitational telescope deformation model for geodetic VLBI},
   journal = {Journal of Geodesy},
   year = {2018},
   month = {8},
   day = {29},
   volume = {93},
   number = {5},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {669-680},
   keywords = {VLBI, Telescope deformation, Systematic errors, Terrestrial reference frames},
   web_url = {http://link.springer.com/article/10.1007/s00190-018-1188-1},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0949-7714, 1432-1394},
   DOI = {10.1007/s00190-018-1188-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Haas, R. and Svantesson, C.G. and Spetz, J. and Rieck, C. and Bergstrand, S. and Herbertsson, M.}
}

@Article { CastroBW2018,
   subid = {786},
   title = {Assessing the Validity of Transient Photovoltage Measurements and Analysis for Organic Solar Cells},
   journal = {Physical Review Applied},
   year = {2018},
   month = {8},
   day = {24},
   volume = {10},
   number = {2},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {024038},
   keywords = {photovoltaics, transient photovoltage, transient photocurrent, organic solar cells, finite-element method, organic semiconductors},
   web_url = {https://journals.aps.org/prapplied/abstract/10.1103/PhysRevApplied.10.024038},
   misc2 = {EMPIR 2016: Energy},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.10.024038},
   stag_bib_extends_levelofaccess = {NA},
   author = {Castro, F.A. and Blakesley, J.C. and Wood, S.}
}

@Article { StrupinskiUOGPMPMPWKB2018,
   subid = {992},
   title = {Electrical Homogeneity Mapping of Epitaxial Graphene on Silicon Carbide},
   journal = {ACS Applied Materials \& Interfaces},
   year = {2018},
   month = {8},
   day = {21},
   volume = {10},
   number = {37},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   pages = {31641-31647},
   keywords = {conductivity; graphene; metrology; micro four-point probe; SiC; terahertz spectroscopy},
   web_url = {https://pubs.acs.org/doi/10.1021/acsami.8b11428},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {1944-8244, 1944-8252},
   DOI = {10.1021/acsami.8b11428},
   stag_bib_extends_levelofaccess = {NA},
   author = {Strupinski, W. and U. Jepsen, P. and {\O}sterberg, F.W. and Gallop, J. and Pasternak, I. and Melios, C. and Petersen, D.H. and Mackenzie, D.M.A. and Panchal, V. and Whelan, P.R. and Kazakova, O. and B{\o}ggild, P.}
}

@Article { IldayCEHe2018,
   subid = {1075},
   title = {Tailored Design of Mode-Locking Dynamics for Low-Noise Frequency-Comb Generation},
   journal = {Physical Review Applied},
   year = {2018},
   month = {8},
   day = {20},
   volume = {10},
   number = {2},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {024027},
   keywords = {frequency comb, low-noise},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1905.01116},
   author = {Ilday, F.O. and \c{C}elik, M. and Erdoğan, C. and Hamid, R. and Şenel, C.}
}

@Article { Garnacho2015,
   subid = {1135},
   title = {Characterization of partial discharge measuring instruments by the generation of reference insulation defects in an experimental setup},
   journal = {IEEE},
   year = {2018},
   month = {8},
   day = {18},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Partial discharges; insulation testing; performance evaluation},
   web_url = {https://doi.org/10.5281/zenodo.3251532},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   language = {30},
   DOI = {10.5281/zenodo.3251532},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garnacho, F.}
}

@Article { Garnacho2015_2,
   subid = {1134},
   title = {Generation of Reproducible Reference Insulation Defects in Experimental Tests Cells for Controlled PD monitoring},
   journal = {IEEE},
   year = {2018},
   month = {8},
   day = {18},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Partial discharges; insulation testing; insulation defect},
   web_url = {https://doi.org/10.5281/zenodo.3251542},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   language = {30},
   DOI = {10.5281/zenodo.3251542},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garnacho, F.}
}

@Article { Garnacho2015_3,
   subid = {1136},
   title = {Development of a programmable partial discharge generator for the evaluation of partial discharge measuring devices},
   journal = {IEEE},
   year = {2018},
   month = {8},
   day = {18},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Partial discharges; insulation testing; performance evaluation},
   web_url = {https://doi.org/10.5281/zenodo.3251544},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   language = {30},
   DOI = {10.5281/zenodo.3251544},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garnacho, F.}
}

@Article { KoppmannHGRAMO2018,
   title = {A large-area blackbody for in-flight calibration of an infrared interferometer deployed on board a long-duration balloon for stratospheric research},
   journal = {Atmospheric Measurement Techniques},
   year = {2018},
   month = {8},
   day = {14},
   volume = {11},
   number = {8},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {4757-4762},
   keywords = {GLORIA, Calibration},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-11-4757-2018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koppmann, R. and Hollandt, J. and Gutschwager, B. and Reiniger, M. and Adibekyan, A. and Monte, C. and Olschewski, F.}
}

@Article { UllischNelkenWK2018,
   subid = {718},
   title = {Analysis of the noise exposure and the distribution of machine types at ultrasound related industrial workplaces in Germany},
   journal = {Acta Acustica united with Acustica},
   year = {2018},
   month = {8},
   day = {14},
   volume = {104},
   number = {2018},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {733-736},
   keywords = {German national guidelines; Machine categories; airborne ultrasound exposure; threshold transgression; ultrasonic appliances},
   web_url = {http://www.ingentaconnect.com/search/article?option1=tka\&value1=Analysis+of+the+noise+exposure+and+the+distribution+of+machine+types+at+ultrasound+related+industrial\&pageSize=10\&index=1\#Refs},
   misc2 = {EMPIR 2015: Health},
   publisher = {S. Hirzel Verlag},
   language = {30},
   ISSN = {1610-1928},
   DOI = {10.3813/AAA.919212},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ullisch-Nelken, C. and Wolff, A. and Kusserow, H.}
}

@Article { SieversYSHGBTCBF2018,
   subid = {996},
   title = {Excitation and coherent control of magnetization dynamics in magnetic tunnel junctions using acoustic pulses},
   journal = {Applied Physics Letters},
   year = {2018},
   month = {8},
   day = {13},
   volume = {113},
   number = {7},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   keywords = {Excitation, Coherent control, Magnetization dynamics, magnetic tunnel junctions, acoustic pulses},
   web_url = {https://arxiv.org/abs/1804.10503},
   misc2 = {EMPIR 2015: SI Broader Scope},
   language = {30},
   DOI = {10.1063/1.5037780},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sievers, S. and Yang, H.F. and Schumacher, H.W. and Hu, X.K. and Garcia-Sanchez, F. and B{\"o}hnert, T. and Tarequzzaman, M. and Costa, J.D. and Bieler, M. and Ferreira, R.}
}

@Article { YooSWWIAKR2018,
   subid = {842},
   title = {Extrusion 3D Printing of Paracetamol Tablets from a Single Formulation with Tunable Release Profiles Through Control of Tablet Geometry},
   journal = {AAPS PharmSciTech},
   year = {2018},
   month = {8},
   day = {10},
   volume = {19},
   number = {11},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   keywords = {3D printing; paracetamol; sustained release; immediate release; personalised medicine; geometry},
   web_url = {https://link.springer.com/article/10.1208/s12249-018-1107-z},
   misc2 = {EMPIR 2015: Health},
   publisher = {American Association of Pharmaceutical Scientists (AAPS)},
   language = {30},
   ISSN = {1530-9932},
   DOI = {10.1208/s12249-018-1107-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yoo, J. and Sharpe, S. and Wallace, M.J. and Wildman, R.D. and Irvine, D.J. and Alexander, M.R. and Khaled, S.A. and Roberts, C.J.}
}

@Article { HaileLGK2018,
   subid = {962},
   title = {Characterizing the operating conditions of bifacial modules},
   journal = {AIP Conference Proceedings 1999, 020014 (2018)},
   year = {2018},
   month = {8},
   day = {10},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   keywords = {Si bifacial PV module},
   web_url = {https://aip.scitation.org/doi/10.1063/1.5049253},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Author(s)},
   language = {30},
   DOI = {10.1063/1.5049253},
   stag_bib_extends_levelofaccess = {NA},
   author = {Haile, B. and Lopez-Garcia, J. and Garcia Menendez, E. and Kenny, R.P.}
}

@Miscellaneous { Klein,
   subid = {1018},
   title = {Sensor data set, electromechanical cylinder at ZeMA testbed (2kHz)},
   journal = {Zenodo Community},
   year = {2018},
   month = {8},
   day = {2},
   number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future},
   keywords = {acceleration, microphone, velocity, sensor network, condition monitoring},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Zenodo},
   language = {30},
   DOI = {10.5281/zenodo.1326277},
   stag_bib_extends_levelofaccess = {NA},
   author = {Klein, S.}
}

@Article { BruchertseiferFCDPHVPLMM2018,
   title = {Measurement of absolute \(\gamma\)-ray emission probabilities in the decay of 227Ac in equilibrium with its progeny},
   journal = {Applied Radiation and Isotopes},
   year = {2018},
   month = {8},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   keywords = {\(\gamma\)-ray intensities, 227Ac, 227Th,  223Ra, decay data, \(\gamma\)-ray spectrometry},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2018.08.023},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bruchertseifer, F. and Fazio, A. and Carconi, P. and Dry{\'a}k, P. and Pierre, S. and Hult, M. and Van Ammel, R. and Pomm{\'e}, S. and Lutter, G. and Marouli, M. and Morgenstern, A.}
}

@Article { GafvertVMDF2018,
   title = {InSiCal – A tool for calculating calibration factors and activity concentrations in in situ gamma spectrometry},
   journal = {Journal of Environmental Radioactivity},
   year = {2018},
   month = {8},
   volume = {188},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {58-66},
   keywords = {In-situ gamma spectrometry, Detector calibration, Software tool, Measurement uncertainty, Environmental radioactivity},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0265-931X},
   DOI = {10.1016/j.jenvrad.2017.10.011},
   stag_bib_extends_levelofaccess = {NA},
   author = {G{\"a}fvert, T. and Vidmar, T. and Mauring, A. and Drefvelin, J. and Fazio, A.}
}

@Article { MullejansTPS2018,
   title = {Uncertainty budget assessment of temperature coefficient measurements performed via intra-laboratory comparison between various facilities for PV device calibration},
   journal = {Solar Energy},
   year = {2018},
   month = {8},
   volume = {170},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {293-300},
   keywords = {Temperature coefficients uncertainty, Temperature-dependent spectral mismatch, Photovoltaics, Intercomparison},
   web_url = {https://reader.elsevier.com/reader/sd/F3B29C1ED5EA17BAFB18D68D072A007E7E1838829B884A59F5C7E5535FACF846A0BBB5E76DB2DBC50641745278F0FF2E\#pf1},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0038-092X},
   DOI = {10.1016/j.solener.2018.04.062},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\"u}llejans, H. and Trentadue, G. and Pavanello, D. and Salis, E.}
}

@Article { SaxholmSHHSK2018,
   title = {Low-Pressure and Low-Temperature Dew/Frost-Point Generator},
   journal = {International Journal of Thermophysics},
   year = {2018},
   month = {8},
   volume = {39},
   number = {9},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   keywords = {Dew-point generator, Frost-point generator, Humidity, Low pressure, Uncertainty},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Springer Nature America, Inc},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-018-2425-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Saxholm, S. and Salminen, J. and H{\"o}gstr{\"o}m, R. and Heinonen, M. and Sairanen, H. and Kajastie, H.}
}

@Article { RidlerLWL2018,
   subid = {884},
   title = {A New SOLT Calibration Method for Leaky On-Wafer Measurements Using a 10-Term Error Model},
   journal = {IEEE Transactions on Microwave Theory and Techniques},
   year = {2018},
   month = {8},
   volume = {66},
   number = {8},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {3894-3900},
   keywords = {Calibration, Crosstalk, Standards, Probes, Semiconductor device measurement, Measurement uncertainty, Numerical models, approximation theory, calibration, measurement errors, measurement standards, millimetre wave measurement, network analysers, S-parameters},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9480, 1557-9670},
   DOI = {10.1109/TMTT.2018.2832052},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ridler, N. and Li, C. and Wu, A. and Liu, C.}
}

@Proceedings { WiekhorstSM2018,
   subid = {940},
   title = {A model for uncertainty influences on static magnetisation measurements on magnetic nanoparticles},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {072030},
   keywords = {uncertainty budget, static magnetization measurement, standardization},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IOP Publishing},
   event_place = {Belfast, UK},
   event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/7/072030},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wiekhorst, F. and Steinhoff, U. and Marks, G.}
}

@Article { DurandettoS2018,
   subid = {945},
   title = {Experimental analysis of the thermal behavior of a GM cryocooler based on linear system theory},
   journal = {International Journal of Refrigeration},
   year = {2018},
   month = {8},
   volume = {92},
   number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages},
   pages = {125-132},
   keywords = {Cryocoolers, Thermal analysis, Thermal control, Linear systems, Thermal impedance, Dynamic load},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0140-7007},
   DOI = {10.1016/j.ijrefrig.2018.04.016},
   stag_bib_extends_levelofaccess = {NA},
   author = {Durandetto, P. and Sosso, A.}
}

@Proceedings { HodoroabaKHS2018,
   subid = {954},
   title = {Analysis of Mesoporous Iridium Oxide Thin Films by the Combined Methodical Approach SEM/EDS/STRATAGem},
   journal = {Proceedings of Microscopy \& Microanalysis 2018},
   year = {2018},
   month = {8},
   volume = {24},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {762-763},
   keywords = {Electron probe microanalysis (EPMA); Iridium oxide;  Porous thin films; Spectroscopic ellipsometry},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Cambridge University Press (CUP)},
   event_place = {Baltimore, Maryland, USA},
   event_name = {Microscopy \& Microanalysis 2018},
   event_date = {05-08-2018 to 09-08-2018},
   language = {30},
   ISSN = {1431-9276, 1435-8115},
   DOI = {10.1017/S1431927618004300},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hodoroaba, V.D. and Kraehnert, R. and Hertwig, A. and Sachse, R.}
}

@Proceedings { Grum2018,
   subid = {1003},
   title = {Calibration of automatic catchweighing instruments in dynamic mode of operation},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number2 = {14RPT02: AWICal: Traceable calibration of automatic weighing instruments operating in the dynamic mode},
   pages = {042016},
   keywords = {automatic catchweighing instruments, calibration, uncertainty},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/4/042016/pdf},
   misc2 = {EMPIR 2014: Research Potential},
   publisher = {IOP Publishing},
   address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom},
   event_place = {Belfast, United Kingdom},
   event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/4/042016},
   stag_bib_extends_levelofaccess = {NA},
   author = {Grum, M.}
}

@Article { LuisoLGGDV2018,
   subid = {990},
   title = {A Set-up for Static and Dynamic Characterization of Voltage and Current Transducers used in Railway Application},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   pages = {052019},
   keywords = {Railroad transportation, Railroad, Characterization procedures, Current transducer, Dynamic characterization, Measurement system, Metrological characteristics, Power quality measurements, Railway applications, Real operating conditions},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/5/052019},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/5/052019},
   stag_bib_extends_levelofaccess = {NA},
   author = {Luiso, M. and Landi, C. and Giordano, D. and Gallo, D. and Delle Femine, A. and Visconte, R.}
}

@Article { LuisoLGGDS2018,
   subid = {989},
   title = {Synchronized Measurement System for Railway Application},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   pages = {052040},
   keywords = {Electric power system control, Electric power systems, Global positioning system, Quality control,Railroad transportation, Synchronization},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/5/052040},
   stag_bib_extends_levelofaccess = {NA},
   author = {Luiso, M. and Landi, C. and Giordano, D. and Gallo, D. and Delle Femine, A. and Signorino, D.}
}

@Article { KazakovaMYEPL2018,
   subid = {991},
   title = {Detection of Ultralow Concentration NO2 in Complex Environment Using Epitaxial Graphene Sensors},
   journal = {ACS Sensors},
   year = {2018},
   month = {8},
   volume = {3},
   number = {9},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   pages = {1666-1674},
   keywords = {air quality; environmental monitoring; epitaxial graphene; graphene sensors; Hall effect; nitrogen dioxide},
   web_url = {https://arxiv.org/abs/1808.09776},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2379-3694, 2379-3694},
   DOI = {10.1021/acssensors.8b00364},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazakova, O. and Melios, C. and Yakimova, R. and Edmonds, K. and Panchal, V. and Lartsev, A.}
}

@Article { DelleFemineGLGCLL2018,
   subid = {1035},
   title = {Calibration of Current Transformers in distorted conditions},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number = {1},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {052033},
   keywords = {Current Transformer, Calibration, Power System Measurement, Current Measurement, Distorted Conditions},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/5/052033/pdf},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IOP Publishing},
   address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/5/052033},
   stag_bib_extends_levelofaccess = {NA},
   author = {Delle Femine, A. and Giordano, D. and Landi, C. and Gallo, D. and Crotti, G. and Luiso, M. and Letizia, P.S.}
}

@Article { LandiDDGL2018,
   subid = {1034},
   title = {Implementation of a distributed Stand Alone Merging Unit},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number = {1},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {052042},
   keywords = {Stand Alone Merging Unit, Distributed Stand Alone Merging Unit, Power System Measurement, Voltage Measurement, Current Measurement, Synchronization},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/5/052042/pdf},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/5/052042},
   stag_bib_extends_levelofaccess = {NA},
   author = {Landi, C. and Delle Femine, A. and Del Prete, S. and Gallo, D. and Luiso, M.}
}

@Article { NeuvonenAALBBPMSPFWSBL2018,
   subid = {1062},
   title = {Establishing traceability for liquid density measurements in Europe: 17RPT02-rhoLiq a new EMPIR joint research project},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number = {8},
   number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements},
   pages = {082013},
   keywords = {density of liquids; hydrostatic weighing; oscillation-type density meters},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/8/082013/pdf},
   misc2 = {EMPIR 2017: Research Potential},
   publisher = {IOP Publishing},
   address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/8/082013},
   stag_bib_extends_levelofaccess = {NA},
   author = {Neuvonen, P. and Alisic, S. and Alic, A. and Lenard, E. and Bebic, J. and Bartos, P. and Popa, G. and Mares, G. and Schiebl, M. and Pereira, J. and Furtado, A. and Wolf, H. and Sariyerli, G. and Bescupschii, A. and Laky, B.}
}

@Article { OguzAytekinKMSISFSZSJoHBHPV2018,
   subid = {1086},
   title = {Improving emerging European NMIs’ capabilities in humidity measurement},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement},
   pages = {122019},
   keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/12/122019},
   stag_bib_extends_levelofaccess = {NA},
   author = {Oguz Aytekin, S. and Karaboce, N. and Mac Lochlainn, D. and Simic, S. and Iacomini, L. and Smorgon, D. and Fernicola, V. and Sestan, D. and Zvizdić, D. and Strnad, R. and Jandrić, N. and Čohodarević, S. and Hodzic, N. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.}
}

@Article { ZvizdiFSIRSSH2018,
   subid = {1087},
   title = {Development and preliminary investigation of a modular chamber for calibration of relative humidity instruments},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement},
   pages = {122017},
   keywords = {Humidity, Relative humidity, Calibration chamber},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122017},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/12/122017},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zvizdić, D. and Fernicola, V. and Šariri, K. and Iacomini, L. and Rothmund, P. and Smorgon, D. and Sestan, D. and Hodzic, N.}
}

@Article { PendrillSFMCW2018,
   subid = {1150},
   title = {Patient-centred cognition metrology},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number = {7},
   number2 = {15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases},
   pages = {072033},
   keywords = {Patient-centred cognition metrology},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/7/072033},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pendrill, L.R and Stenner, A.J and Fisher, W.P and Melin, J. and Cano, S.J and Webster, W.}
}

@Article { BehrHDBIIWBS2018,
   subid = {1153},
   title = {Towards a Metrology class ADC based on Josephson junction devices},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages},
   pages = {052044},
   keywords = {Metrology, Josephson, ADC, DC Voltage, AC Voltage},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/5/052044},
   stag_bib_extends_levelofaccess = {NA},
   author = {Behr, R. and Herick, J. and Dekker, R. and Bierzychudek, M.E. and Iuzzolino, R. and Ireland, J. and Williams, J. and Belcher, A. and Schaapman, K.}
}

@Article { SolcS2018,
   subid = {1317},
   title = {Characterization of the new free-air primary standard for medium-energy X-rays at CMI},
   journal = {Journal of Instrumentation},
   year = {2018},
   month = {8},
   volume = {13},
   number = {08},
   number2 = {14RPT04: Absorb: Absorbed dose in water and air},
   pages = {P08008-P08008},
   keywords = {Free-air ionization chamber, FAC corrections, X-rays, air kerma, MCNPX, Monte Carlo simulation, radiation transport.},
   web_url = {https://arxiv.org/abs/1912.04404},
   misc2 = {EMPIR 2014: Research Potential},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {arXiv:1912.04404},
   author = {Solc, J. and Sochor, V.}
}

@Article { McKennaGSBCHGP2018,
   subid = {608},
   title = {Exposure of mass-selected bimetallic Pt–Ti nanoalloys to oxygen explored using scanning transmission electron microscopy and density functional theory},
   journal = {RSC Advances},
   year = {2018},
   month = {7},
   day = {31},
   volume = {8},
   number = {52},
   number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles},
   pages = {27276–27282},
   keywords = {Nanoparticles, nanotechnology, nanoalloys, platinum, bimetallic, electron microscopy},
   web_url = {http://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra02449a},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Royal Society of Chemistry},
   language = {30},
   ISSN = {2046-2069},
   DOI = {10.1039/C8RA02449A},
   stag_bib_extends_levelofaccess = {NA},
   author = {McKenna, K. and Guo, Q. and Shard, A. and Blackmore, C. and Cant, D. and Hung, S. and Gholhaki, S. and Palmer, R.}
}

@Proceedings { OzturkSC2018,
   subid = {888},
   title = {Investigation of Ripple Voltage Across Capacitor in Military CS101 Test by Using FFT-Based Time Domain Solution},
   journal = {2018 IEEE Symposium on Electromagnetic Compatibility, Signal Integrity and Power Integrity (EMC, SI \& PI)},
   year = {2018},
   month = {7},
   day = {30},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {82-87},
   keywords = {Aerospace, Capacitor, CS101, DFT, EMC, FFT, Immunity, Military, Susceptibility, Time Domain},
   web_url = {http://rfmw.cmi.cz/documents/papers/Cakir_CS101.pdf},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   event_place = {Long Beach, CA, USA},
   event_name = {2018 IEEE Symposium on Electromagnetic Compatibility, Signal Integrity and Power Integrity},
   event_date = {30-07-2018 to 02-08-2018},
   language = {30},
   ISBN = {978-1-5386-6619-7},
   DOI = {10.1109/EMCSI.2018.8495307},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ozturk, M. and Şen, O. and \c{C}akır, S.}
}

@Article { ManaCMMDF2018,
   title = {Dual-laser frequency-stabilized cavity ring-down spectroscopy for water vapor density measurements},
   journal = {Metrologia},
   year = {2018},
   month = {7},
   day = {27},
   volume = {55},
   number = {5},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {662-669},
   keywords = {cavity ring-down spectroscopy (CRDS), water vapour mole fraction, water vapourdensity, high-resolution molecular spectroscopy},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aad15e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mana, G. and Castrillo, A. and Merlone, A. and Moretti, L. and Dinesan, H. and Fasci, E.}
}

@Article { BoarinoRDSPDGFMC2018,
   subid = {846},
   title = {Influence of the long-range ordering of gold-coated Si nanowires on SERS},
   journal = {Scientific Reports},
   year = {2018},
   month = {7},
   day = {27},
   volume = {8},
   number = {1},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   keywords = {surface-enhanced Raman spectroscopy; substrates for bio-analytical applications; flexible gold-coated Si nanowires},
   web_url = {https://www.nature.com/articles/s41598-018-29641-x.pdf},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-018-29641-x},
   stag_bib_extends_levelofaccess = {NA},
   author = {Boarino, L. and Rossi, A.M. and De Leo, N. and Sparnacci, K. and Portesi, C. and Dialameh, M. and Giovannozzi, A.M. and Ferrarese Lupi, F. and Mandrile, L. and Cara, E.}
}

@Article { HoflingSBBHSGLFSKRS2018_2,
   subid = {696},
   title = {Photon-Number-Resolved Measurement of an Exciton-Polariton Condensate},
   journal = {Physical Review Letters},
   year = {2018},
   month = {7},
   day = {25},
   volume = {121},
   number = {4},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {047401},
   keywords = {Exciton Polariton, Photon Statistics},
   web_url = {https://arxiv.org/abs/1805.02959},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.121.047401},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"o}fling, S. and Suchomel, H. and Brodbeck, S. and Beyer, J. and Helversen, M. v. and Schmidt, M. and Gericke, F. and Laussy, F. P. and Flayac, H. and Schlottmann, E. and Klaas, M. and Reitzenstein, S. and Schneider, C.}
}

@Article { XuerebGMLMTCC2018,
   subid = {852},
   title = {Optical frequency transfer over submarine fiber links},
   journal = {Optica},
   year = {2018},
   month = {7},
   day = {25},
   volume = {5},
   number = {8},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {893},
   keywords = {optical fiber, optical frequency transfer},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {2334-2536},
   DOI = {10.1364/OPTICA.5.000893},
   stag_bib_extends_levelofaccess = {NA},
   author = {Xuereb, A. and Galea, P. and Marra, G. and Levi, F. and Mura, A. and Tampellini, A. and Clivati, C. and Calonico, D.}
}

@Article { JelezkoDNAEBGJSMTFDGO2018,
   subid = {1010},
   title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept},
   journal = {Physical Review Applied},
   year = {2018},
   month = {7},
   day = {25},
   volume = {10},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance},
   web_url = {https://arxiv.org/abs/1706.07935},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.10.014024},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jelezko, F. and Degiovanni, I.P. and Naydenov, B. and Amato, G. and Enrico, E. and Bosia, F. and Grilj, V. and Jakšić, M. and Skukan, N. and Moreva, E. and Traina, P. and Forneris, J. and Ditalia Tchernij, S. and Genovese, M. and Olivero, P.}
}

@Article { JelezkoDNAEBGJSMTFDGO20180,
   subid = {1010},
   title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept},
   journal = {Physical Review Applied},
   year = {2018},
   month = {7},
   day = {25},
   volume = {10},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.10.014024},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1706.07935},
   author = {Jelezko, F. and Degiovanni, I.P. and Naydenov, B. and Amato, G. and Enrico, E. and Bosia, F. and Grilj, V. and Jakšić, M. and Skukan, N. and Moreva, E. and Traina, P. and Forneris, J. and Ditalia Tchernij, S. and Genovese, M. and Olivero, P.}
}

@Article { Tzelepis2018_2,
   title = {Distributed Current Sensing Technology for protection and Fault LocationApplications in HVDC networks},
   journal = {The Journal of Engineering},
   year = {2018},
   month = {7},
   day = {18},
   volume = {-},
   number = {-},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {1-6},
   keywords = {Multi terminal direct Current, Differential protection, Travelling waves, Distributed sensing},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institution of Engineering and Technology (IET)},
   language = {30},
   ISSN = {2051-3305},
   DOI = {10.1049/joe.2018.0219},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tzelepis, D.}
}

@Thesis { Yi2018,
   subid = {1194},
   title = {Progress towards GaAs multiplexed single-electron pump arrays},
   year = {2018},
   month = {7},
   day = {15},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Single electron pump, Quantum multiplexer, Pump arrays},
   web_url = {https://www.repository.cam.ac.uk/handle/1810/294606},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Apollo - University of Cambridge Repository},
   address = {Cambridge (UK)},
   school = {University of Cambridge},
   language = {30},
   DOI = {10.17863/CAM.41714},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yi, T.}
}

@Article { vanSchaikPBP2018,
   subid = {999},
   title = {Climatic chamber for dew-point temperatures up to 150 \(^{\circ}\)C},
   journal = {Metrologia},
   year = {2018},
   month = {7},
   day = {13},
   volume = {55},
   number = {4},
   number2 = {14IND11: HIT: Metrology for humidity at high temperatures and transient conditions},
   pages = {597-608},
   keywords = {calibration, high temperatures, relative humidity, sensors, speed of sound},
   web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/aacecc/meta},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aacecc},
   stag_bib_extends_levelofaccess = {NA},
   author = {van Schaik, W. and Pouw, R.J. and Bosma, R. and Peruzzi, A.}
}

@Thesis { vanHove2018,
   subid = {1342},
   title = {Towards effective emission regulations: A numerical and experimental study on flow measurement uncertainty in stacks},
   year = {2018},
   month = {7},
   day = {12},
   number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions},
   keywords = {uncertainty quantification, large-eddy simulation, OpenFOAM, pipe flow, S-type pitot tube, uncertainty propagation},
   misc2 = {EMPIR 2016: Environment},
   publisher = {TU Delft Library},
   address = {Delft},
   school = {Delft University of Technology},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.4233/uuid:f56ff5c1-8a9c-4b5c-b404-ab421b7ede59},
   author = {van Hove, A.}
}

@Article { RottgerDDBKN2018,
   title = {Novel spectrometers for environmental dose rate monitoring},
   journal = {Journal of Environmental Radioactivity},
   year = {2018},
   month = {7},
   volume = {187},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {115-121},
   keywords = {Environmental dosimetry, Spectrometers, MetroERM, Early warning networks},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0265931X17304976?via\%3Dihub},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0265-931X},
   DOI = {10.1016/j.jenvrad.2018.01.020},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"o}ttger, A. and Dombrowski, H. and Dabrowski, R. and Behnke, B. and Kessler, P. and Neumaier, S.}
}

@Article { WeisbachKHDBALKHW2018,
   subid = {515},
   title = {Development and characterization of sub-monolayer coatings as novel calibration samples for X-ray spectroscopy},
   journal = {Spectrochimica Acta Part B: Atomic Spectroscopy},
   year = {2018},
   month = {7},
   volume = {145},
   number2 = {14IND07: 3D Stack: Metrology for manufacturing 3D stacked integrated circuits},
   pages = {36-42},
   keywords = {X-ray fluorescence, calibration samples},
   web_url = {https://arxiv.org/abs/1801.04246},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0584-8547},
   DOI = {10.1016/j.sab.2018.04.001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wei{\ss}bach, D. and Kanngie{\ss}er, B. and Holz, T. and Dietsch, R. and Beckhoff, B. and Andrianov, K. and L{\"u}hl, L. and Kr{\"a}mer, M. and Honicke, P. and Wilhein, T.}
}

@Article { UngerDTSK2018,
   subid = {560},
   title = {Surface characterisation of Escherichia coli under various conditions by near-ambient pressure XPS},
   journal = {Surface and Interface Analysis},
   year = {2018},
   month = {7},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {1-5},
   keywords = {bacteria, E.coli, NAP-XPS},
   web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/sia.6480},
   misc2 = {EMPIR 2015: Health},
   publisher = {Wiley},
   language = {30},
   ISSN = {0142-2421},
   DOI = {10.1002/sia.6480},
   stag_bib_extends_levelofaccess = {NA},
   author = {Unger, W.E.S. and Dietrich, P. and Thissen, A. and Schwibbert, K. and Kjaervik, M.}
}

@Article { MonteGAUKK2018,
   title = {Characterization of blackbody inhomogeneity and its effect on the retrieval results of the GLORIA instrument},
   journal = {Atmospheric Measurement Techniques},
   year = {2018},
   month = {7},
   volume = {11},
   number = {7},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {3871-3882},
   keywords = {GLORIA,},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-11-3871-2018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Monte, C. and Gutschwager, B. and Adibekyan, A. and Ungermann, J. and Krisch, I. and Kleinert, A.}
}

@Article { CampCV2018,
   title = {Comparison of methods for H* (10) calculation from measured LaBr 3 (Ce) detector spectra},
   journal = {Applied Radiation and Isotopes},
   year = {2018},
   month = {7},
   volume = {137},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {241-249},
   keywords = {H*(10) calculation methods,  LaBr3(Ce) detector, MetroERM},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2018.03.026},
   stag_bib_extends_levelofaccess = {NA},
   author = {Camp, A. and Cornejo, N. and Vargas, A.}
}

@Article { ZinkPC2018,
   subid = {750},
   title = {Impact of new ICRU Report 90 recommendations on calculated correction factors for reference dosimetry},
   journal = {Physics in Medicine \& Biology},
   year = {2018},
   month = {7},
   volume = {63},
   number = {15},
   number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398},
   pages = {155015},
   keywords = {radiation dosimetry, reference dosimetry, ICRU 90},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aad148},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zink, K. and Poppe, B. and Czarnecki, D.}
}

@Proceedings { ArifovicDKM2018,
   subid = {855},
   title = {Performance of Reference Partial Discharge Measurement System},
   journal = {Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {7},
   volume = {1},
   number = {1},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   pages = {1-2},
   keywords = {Calibration, charge measurement, partial discharge, PD measurement, uncertainty},
   web_url = {https://zenodo.org/record/1343872\#.W9cMuNX7TIU\&\#10;https://ieeexplore.ieee.org/document/8500956/metrics\#metrics},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   event_place = {Paris, France},
   event_name = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   ISBN = {978-1-5386-0973-6},
   ISSN = {978-1-5386-0974-3},
   DOI = {10.5281/zenodo.1343872},
   stag_bib_extends_levelofaccess = {NA},
   author = {Merev, A. and Karaman, I. and Dedeoğlu, S. and Arifovi\c{c}, M.}
}

@Proceedings { DambrineTPH2018,
   subid = {891},
   title = {Quantitative Error Analysis in Near-Field Scanning Microwave Microscopy},
   journal = {2018 International Conference on Manipulation, Automation and Robotics at Small Scales (MARSS)},
   year = {2018},
   month = {7},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Near-field , microwave, microscopy},
   web_url = {https://hal.archives-ouvertes.fr/hal-01913677},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Nagoya - Japan},
   event_name = {2018 International Conference on Manipulation, Automation and Robotics at Small Scales (MARSS)},
   event_date = {04-07-2018 to 08-07-2018},
   language = {30},
   DOI = {10.1109/MARSS.2018.8481160},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dambrine, G. and Theron, D. and Polovodov, P. and Haddadi, K.}
}

@Proceedings { Garnacho2018,
   subid = {872},
   title = {Test Cells to Generate Reference Partial Discharge Series},
   journal = {CPEM},
   year = {2018},
   month = {7},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Partial discharges, insulation testing, fault diagnosis, performance evaluation, pattern analysis, pattern clustering.},
   web_url = {http://www.cpem2018.com/},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   address = {Madrid, Spain},
   event_place = {Paris},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {09-07-2018 to 13-07-2018},
   language = {30},
   DOI = {10.5281/zenodo.1476822},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garnacho, Fernando}
}

@Proceedings { GrajciarDACHP2018,
   subid = {887},
   title = {Harmonics Effects on Microwave Low-Power Measurement},
   journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {7},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {1-2},
   keywords = {Harmonic effect, microwave measurements, microwave power, power sensor, uncertainty},
   web_url = {http://rfmw.cmi.cz/documents/papers/Celep_HarmonicEffect_cpem2018.pdf},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   event_place = {Paris, France},
   event_name = {2018 Conference on Precision Electromagnetic Measurements},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   ISBN = {978-1-5386-0974-3},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2018.8500788},
   stag_bib_extends_levelofaccess = {NA},
   author = {Grajciar, Jan and Dražil, Karel and Abdo, Yaser and CELEP, Murat and Hudlicka, Martin and Pinter, Borut}
}

@Article { SigrayLCBMBBAHRGCBD2018,
   subid = {904},
   title = {Calibration standards for hydrophones and autonomous underwater noise recorders for frequencies below 1 kHz: current activities of EMPIR “UNAC-LOW” project},
   journal = {ACTA IMEKO},
   year = {2018},
   month = {7},
   volume = {7},
   number = {2},
   number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz},
   pages = {32},
   keywords = {low frequency hydrophone calibration; low frequency underwater noise recorders; underwater acoustics; calibration},
   web_url = {http://dx.doi.org/10.21014/acta_imeko.v7i2.542},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IMEKO International Measurement Confederation},
   language = {30},
   ISSN = {2221-870X},
   DOI = {10.21014/acta_imeko.v7i2.542},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sigray, P. and Linn{\'e}, M. and Curcuruto, S. and Borsani, F. and Mauro, S. and Buogo, S. and Barrera-Figueroa, S. and Ablitt, J. and Hayman, G. and Robinson, S. and Golick, A. and \c{C}orak\c{c}ı, A.C. and Biber, A. and Davidsson, P.}
}

@Proceedings { DaffeSRMMH2018,
   subid = {893},
   title = {Parameterization Models for Traceable Characterization of Planar CPW SOL Calibration Standards},
   journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {7},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Uncertainty, Calibration, Coplanar waveguides, Standards, Frequency measurement, Measurement Uncertainty, Probes},
   web_url = {https://hal.archives-ouvertes.fr/hal-02085776/document},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Paris, France},
   event_name = {CPEM},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   ISBN = {978-1-5386-0974-3},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2018.8500810},
   stag_bib_extends_levelofaccess = {NA},
   author = {Daff{\'e}, K. and Spirito, M. and Rietveld, G. and Mascolo, V. and Mubarak, F. and Haddadi, K.}
}

@Article { PonsVFC2018,
   subid = {901},
   title = {Index for the evaluation of the general photometric performance of photometers},
   journal = {Optics Express},
   year = {2018},
   month = {7},
   volume = {26},
   number = {14},
   number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products},
   pages = {18633},
   keywords = {photometer, spectral, mismatch, error, quality index},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.26.018633},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pons, A. and Vel{\'a}zquez, J.L.  and Ferrero, A. and Campos, J.}
}

@Article { SchaeffterTFSKWPW2018,
   subid = {942},
   title = {Improved sensitivity and limit-of-detection using a receive-only coil in magnetic particle imaging},
   journal = {Physics in Medicine \& Biology},
   year = {2018},
   month = {7},
   volume = {63},
   number = {13},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {13NT02},
   keywords = {magnetic nanoparticles, magnetic particle imaging, magnetic measurements},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aacb87},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schaeffter, T. and Trahms, L. and Franke, J. and Steinhoff, U. and Kosch, O. and Wells, J. and Paysen, H. and Wiekhorst, F.}
}

@Proceedings { MohnsRFP2018,
   subid = {1043},
   title = {A Sampling-Based Ratio Bridge for Calibrating Voltage Transformers},
   journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {7},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {Bridge circuits, Voltage measurement, Voltage transformers, Windings, Measurement uncertainty, Uncertainty, Magnetic cores},
   web_url = {https://doi.org/10.1109/CPEM.2018.8501245},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   event_place = {Paris},
   event_name = {2018 Conference on Precision Electromagnetic Measurements},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   DOI = {10.7795/EMPIR.17NRM01.CA.20190411},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mohns, E. and Roeissle, G. and Fricke, S. and Pauling, F.}
}

@Proceedings { ZuccaPMGCS2018,
   subid = {1082},
   title = {A Voltage Calibration Chain for Meters Used in Measurements of EV Inductive Power Charging},
   journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {7},
   volume = {Online},
   number = {Unique},
   number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles},
   pages = {1-2},
   keywords = {Voltage measurement, Calibration, Probes, Windings, Frequency measurement, Power measurement},
   web_url = {http://arxiv.org/abs/1905.08046},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   event_place = {Paris (France)},
   event_name = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   ISBN = {978-1-5386-0974-3},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2018.8500831},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zucca, M. and Pogliano, U. and Modarres, M. and Giordano, D. and Crotti, G. and Serazio, D.}
}

@Proceedings { FemiaPS2018,
   subid = {1108},
   title = {Behavioral Switching Loss Modeling of Inverter Modules},
   journal = {2018 15th International Conference on Synthesis, Modeling, Analysis and Simulation Methods and Applications to Circuit Design (SMACD)},
   year = {2018},
   month = {7},
   number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles},
   pages = {1-4},
   note = {Hidden - DOI not open access (KP updated -2/01/2020)},
   keywords = {Full-Bridge Power Module; Loss Modeling; Genetic Programming; Multi-Objective Optimization},
   web_url = {https://arxiv.org/abs/1906.04428},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   event_place = {Prague},
   event_name = {15th International Conference on Synthesis, Modeling, Analysis and Simulation Methods and Applications to Circuit Design (SMACD)},
   event_date = {02-07-2019 to 05-07-2019},
   language = {30},
   DOI = {10.1109/SMACD.2018.8434850},
   stag_bib_extends_levelofaccess = {NA},
   author = {Femia, N. and Pessinatti Ohashi, R.A. and Stoyka, K.}
}

@Article { LassmannT2018,
   subid = {1164},
   title = {Characterization of Noise and Resolution for Quantitative 177Lu SPECT/CT with xSPECT Quant},
   journal = {Journal of Nuclear Medicine},
   year = {2018},
   month = {7},
   volume = {60},
   number = {1},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   pages = {50-59},
   keywords = {image reconstruction; radiobiology/dosimetry; SPECT/CT; calibration; ordered-subset conjugate gradient minimization (OSCGM); quantitative Lu-177 SPECT},
   web_url = {http://jnm.snmjournals.org/content/60/1/50.long},
   misc2 = {EMPIR 2015: Health},
   publisher = {Society of Nuclear Medicine},
   language = {30},
   ISSN = {0161-5505, 2159-662X},
   DOI = {10.2967/jnumed.118.211094},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lassmann, M. and Tran-Gia, J.}
}

@Article { EllingsbergBAVLRWPS2018,
   subid = {1376},
   title = {Evaluation of EMI Effects on Static Electricity Meters},
   journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {7},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   keywords = {Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters.},
   web_url = {https://zenodo.org/record/3587786\#.XiGxp3u7KUn},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/CPEM.2018.8500945},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ellingsberg, K. and Braun, J.P. and Alonso, F.R.I and van den Brom, H.E. and Leferink, F. and Rietveld, G. and Wright, P.S. and Pous, M. and Svoboda, M.}
}

@Article { LudwigSKSDGTNPFJBPKRI2018,
   subid = {900},
   title = {Development of white LED illuminants for colorimetry and recommendation of white LED reference spectrum for photometry},
   journal = {Metrologia},
   year = {2018},
   month = {6},
   day = {28},
   volume = {55},
   number = {4},
   number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products},
   pages = {526-534},
   keywords = {Photometry, colorimetry, illuminant, reference spectrum, photometer, calibration, uncertainty},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aacae7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ludwig, K. and Schneider, M. and Klej, A. and Stuker, F. and Dekker, P. and Gerloff, T. and Thorseth, A. and Ngo, M. and Pulli, T. and Ferrero, A. and Jost, S. and Blattner, P. and Poikonen, T. and Kokka, A. and Reiners, T. and Ikonen, E.}
}

@Article { WubbelerRPKHUHSKZ2018,
   subid = {1114},
   title = {Compressed sensing FTIR nano-spectroscopy and nano-imaging},
   journal = {Optics Express},
   year = {2018},
   month = {6},
   day = {28},
   volume = {26},
   number = {14},
   number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications},
   pages = {18115},
   keywords = {Infrared scattering scanning near-field optical microscopy, Optical spectroscopy, Compressed sensing},
   web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-14-18115},
   misc2 = {EMPIR 2016: Energy},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.26.018115},
   stag_bib_extends_levelofaccess = {NA},
   author = {W{\"u}bbeler, Gerd and Raschke, Markus B. and Pierz, Klaus and Kruskopf, Mattias and Hoehl, Arne and Ulrich, Georg and Hornemann, Andrea and Schm{\"a}hling, Franko and K{\"a}stner, Bernd and Ziade, Francois}
}

@Proceedings { SteinhoffESM2018,
   subid = {943},
   title = {Uncertainty Analyses of Static Measurements of Induced Magnetisation},
   journal = {Publications of the Institute of Geophysics, Polish Academy of Sciences; Geophysical Data Bases, Processing and Instrumentation},
   year = {2018},
   month = {6},
   day = {27},
   volume = {423},
   number = {C-112},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {145-146},
   keywords = {DC-magnetometry, uncertainty budget, magnetic hysteresis, magnetic nanoparticles.},
   web_url = {https://pub.igf.edu.pl/files/Pdf/Pubs/26.pdf},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Institute of Geophysics Polish Academy of Sciences},
   address = {64 Ksiecia Janusza Warsaw 01-452 Poland},
   event_place = {Chęciny, Poland},
   event_name = {16th Castle Meeting   New Trends on Paleo, Rock and Environmental Magnetism},
   event_date = {10-06-2018 to 16-06-2018},
   language = {30},
   ISSN = {2299-8020},
   DOI = {10.25171/InstGeoph_PAS_Publs-2018-074},
   stag_bib_extends_levelofaccess = {NA},
   author = {Steinhoff, U. and Egli, R. and Spassov, S. and Marks, G.}
}

@Article { YuWMGDCBBTCOGM2018,
   subid = {955},
   title = {Preliminary assessment of stable nitrogen and oxygen isotopic composition of USGS51 and USGS52 nitrous oxide reference gases and perspectives on calibration needs},
   journal = {Rapid Communications in Mass Spectrometry},
   year = {2018},
   month = {6},
   day = {26},
   volume = {32},
   number = {15},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   pages = {1207-1214},
   keywords = {N2O, reference material, isotope delta value, USGS51, USGS52},
   web_url = {https://onlinelibrary.wiley.com/doi/10.1002/rcm.8257},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Wiley},
   language = {30},
   ISSN = {0951-4198},
   DOI = {10.1002/rcm.8157},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yu, L. and Well, R. and Mohn, J. and Giesemann, A. and Dyckmans, J. and Casciotti, K.L. and Brand, W.A. and B{\"o}hlke, J.K. and Toyoda, S. and Coplen, T.B. and Ostrom, N.E. and Gandhi, H. and Mohn, J.}
}

@Article { DorscherSFASL2018,
   subid = {567},
   title = {Lattice-induced photon scattering in an optical lattice clock},
   journal = {Physical Review A},
   year = {2018},
   month = {6},
   day = {25},
   volume = {97},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {063419},
   keywords = {Optical lattice clocks, light-matter interaction, electronic transitions,},
   web_url = {https://arxiv.org/abs/1803.03157},
   misc2 = {EMPIR 2015: SI Broader Scope},
   language = {30},
   DOI = {10.1103/PhysRevA.97.063419},
   stag_bib_extends_levelofaccess = {NA},
   author = {D{\"o}rscher, S{\"o}ren and Schwarz, Roman and Falke, Stephan and Al-Masoudi, Ali and Sterr, Uwe and Lisdat, Christian}
}

@Book { KielerBWMRCSBSSCDOB2018,
   subid = {719},
   title = {Good Practice Guide on the operation of AC quantum voltage standards},
   year = {2018},
   month = {6},
   day = {21},
   volume = {1},
   number2 = {14RPT01: ACQ-PRO: Towards the propagation of ac quantum voltage standards},
   note = {ISBN ok https://grp.isbn-international.org/search/piid_cineca_solr/978-80-905619\%2B\%2528ISBNPrefix\%2529?keys=978-80-905619\%2B\%2528ISBNPrefix\%2529},
   keywords = {Good Practice Guide, quantum standards, alternating voltage, Josephson effect, measurement techniques, uncertainty estimation, software tools, safe operation, cryogenic equipment},
   misc2 = {EMPIR 2014: Research Potential},
   publisher = {Czech Metrology Institute},
   address = {Brno},
   language = {30},
   ISBN = {978-80-905619-2-2},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://acqpro.cmi.cz/index.php/results/28-good-practice-guide},
   author = {Kieler, O. and Behr, R. and Williams, J.M. and Malmbekk, H. and Ribeiro, L. and Cabral, V. and Sosso, A. and Bruszewski, P. and Š{\'i}ra, M. and Sanmamed, Y.A. and Caballero, R. and Diaz de Aguilar, J. and Orhan, R. and Bonfait, G.}
}

@Article { IkonenGEVK2018,
   title = {Uncertainty analysis of total ozone derived from direct solar irradiance spectra in the presence of unknown spectral deviations},
   journal = {Atmospheric Measurement Techniques},
   year = {2018},
   month = {6},
   day = {20},
   volume = {11},
   number = {6},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {3595-3610},
   keywords = {solar UV, spectral irradiance, total ozone column, systematic spectral deviations, spectral correlations, uncertainty},
   web_url = {https://doi.org/10.5194/amt-11-3595-2018},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-11-3595-2018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ikonen, E. and Gr{\"o}bner, J. and Egli, L. and Vaskuri, A. and K{\"a}rh{\"a}, P.}
}

@Article { TettamanziKDRMHTRK2018,
   subid = {828},
   title = {Gigahertz Single-Electron Pumping Mediated by Parasitic States},
   journal = {Nano Letters},
   year = {2018},
   month = {6},
   day = {19},
   volume = {18},
   number = {7},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {4141-4147},
   keywords = {silicon electron pump},
   web_url = {https://arxiv.org/abs/1803.00791},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {1530-6984, 1530-6992},
   DOI = {10.1021/acs.nanolett.8b00874},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tettamanzi, G.C. and Kashcheyevs, V. and Dzurak, A.S. and Rogge, S. and M{\"o}tt{\"o}nen, M. and Hudson, F.E. and Timoshenko, J. and Rossi, A. and Klochan, J.}
}

@Article { HarrisHRB2018,
   subid = {905},
   title = {Signal-modelling methods applied to the free-field calibration of hydrophones and projectors in laboratory test tanks},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {6},
   day = {19},
   volume = {29},
   number = {8},
   number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz},
   pages = {085001},
   keywords = {underwater acoustics, transducer calibration, signal-modelling, non-linear least-squares},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aac752},
   stag_bib_extends_levelofaccess = {NA},
   author = {Harris, P.M. and Hayman, G. and Robinson, S.P. and Beamiss, G.A.}
}

@Article { RadivojeviTSD2018,
   subid = {756},
   title = {An in situ temperature calibration of a guarded hot plate apparatus},
   journal = {Thermal Science International Scientific Journal},
   year = {2018},
   month = {6},
   day = {17},
   volume = {On line fi},
   number2 = {14RPT05: Eura-Thermal: Developing traceable capabilities in thermal metrology},
   pages = {176-186},
   keywords = {Thermal Conductivity, Guarded Hot Plate Method, Metrology, in situ temperature calibration},
   misc2 = {EMPIR 2014: Research Potential},
   publisher = {Dr. Vukman Bakić},
   language = {30},
   ISSN = {2334-7163},
   DOI = {10.2298/TSCI180425176S},
   stag_bib_extends_levelofaccess = {NA},
   author = {Radivojević, D. and Terzic, M. and Stepanic, N. and D. Raković, D.}
}

@Article { HorvatJPP2018,
   subid = {566},
   title = {Mercury fractionation in gypsum using temperature desorption and mass spectrometric detection},
   journal = {Open Chemistry},
   year = {2018},
   month = {6},
   day = {14},
   volume = {16},
   number = {1},
   number2 = {16ENV01: MercOx: Metrology for oxidised mercury},
   pages = {544-555},
   keywords = {Mass spectrometry; Mercury; Temperature programmed, desorption; WFGD gypsum; Particle size, fractions},
   web_url = {https://doi.org/10.1515/chem-2018-0046},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Walter de Gruyter GmbH},
   language = {30},
   ISSN = {2391-5420},
   DOI = {10.1515/chem-2018-0046},
   stag_bib_extends_levelofaccess = {NA},
   author = {Horvat, M. and Jaćimović, R. and Pavlin, M. and Popovič, A.}
}

@Article { GoenagaInfanteBWSSSM2018,
   subid = {575},
   title = {Measuring the relative concentration of particle populations using differential centrifugal sedimentation},
   journal = {Analytical Methods},
   year = {2018},
   month = {6},
   day = {14},
   volume = {10},
   number = {22},
   number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles},
   pages = {2539 - 2660},
   keywords = {Relative, concentration, particle, populations, differential centrifugal sedimentation, DCS, spherical particles},
   web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ay/c8ay00491a},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Royal Society of Chemistry},
   language = {30},
   ISSN = {1759-9679},
   DOI = {10.1039/c8ay00491a},
   stag_bib_extends_levelofaccess = {NA},
   author = {Goenaga-Infante, H. and Bartczak, D. and Wright, L. and Sikora, A. and Sparnacci, K. and Shard, A. and Minelli, C.}
}

@Article { MalhiARNDBOCL2018,
   subid = {959},
   title = {Realistic Forest Stand Reconstruction from Terrestrial LiDAR for Radiative Transfer Modelling},
   journal = {Remote Sensing},
   year = {2018},
   month = {6},
   day = {13},
   volume = {10},
   number = {6},
   number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate},
   pages = {933},
   keywords = {tree reconstruction, radiative transfer, terrestrial LiDAR, forestry, 3D modelling, calibration and validation, end-to-end traceability},
   web_url = {https://www.mdpi.com/2072-4292/10/6/933},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2072-4292},
   DOI = {10.3390/rs10060933},
   stag_bib_extends_levelofaccess = {NA},
   author = {Malhi, Y. and {\AA}kerblom, M. and Raumonen, P. and Nightingale, J. and Disney, M. and Burt, A. and Origo, N. and Calders, K. and Lewis, P.}
}

@Article { elGawharyLWNSRBF2018,
   title = {Sensitivity study of the instrumental temperature corrections on Brewer total ozone column measurements},
   journal = {Atmospheric Measurement Techniques},
   year = {2018},
   month = {6},
   day = {11},
   volume = {11},
   number = {6},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {3323-3337},
   keywords = {Brewer, instrumental temperature},
   web_url = {https://www.atmos-meas-tech.net/11/3323/2018/amt-11-3323-2018.html},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-11-3323-2018},
   stag_bib_extends_levelofaccess = {NA},
   author = {El Gawhary, O. and Le{\'o}n-Luis, S.F. and Wilson, K. and Nevas, S. and Sildoja, M.M. and Redondas, A. and Berjon, A. and Fountoulakis, I.}
}

@Article { RaaymakersKvHWvW2018,
   subid = {951},
   title = {A formalism for reference dosimetry in photon beams in the presence of a magnetic field},
   journal = {Physics in Medicine \& Biology},
   year = {2018},
   month = {6},
   day = {11},
   volume = {63},
   number = {12},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {125008},
   keywords = {Dosimetry, MRgRT, Radiotherapy, magnetic fields},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aac70e/meta},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aac70e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Raaymakers, B.W and Kok, J.G.M and van Soest, T.L. and Hackett, S.L. and Woodings, S.J. and van Asselen, B. and Wolthaus, J.W.H}
}

@Article { CorrederaSPGdV2018,
   subid = {569},
   title = {Experimental Demonstration of Low-Uncertainty Calibration Methods for Bragg Grating Interrogators},
   journal = {Sensors},
   year = {2018},
   month = {6},
   day = {10},
   volume = {18},
   number = {6},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {1895},
   keywords = {fiber-optic sensors; fiber Bragg gratings interrogators; absolute calibration},
   misc2 = {EMPIR 2014: Industry},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s18061895},
   stag_bib_extends_levelofaccess = {NA},
   author = {Corredera, P. and Salgado, P. and Pulido de Torres, C. and Galindo-Santos, J. and de Miguel, J. and Velasco, A.V.}
}

@Article { VandervorstDPFHFC2018,
   subid = {564},
   title = {Inorganic material profiling using Ar n +  cluster: Can we achieve high quality profiles?},
   journal = {Applied Surface Science},
   year = {2018},
   month = {6},
   volume = {444},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {633-641},
   keywords = {SIMS, Ar clusters, Depth resolution, Mixing},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0169433218305142?via\%3Dihub\#!},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0169-4332},
   DOI = {10.1016/j.apsusc.2018.02.159},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vandervorst, W. and Delcorte, A. and Poleunis, C. and Franquet, A. and Havelund, R. and Fleischmann, C. and Conard, T.}
}

@Proceedings { FoyerWKGO2018,
   subid = {590},
   title = {Development of a torque calibration procedure under rotation for nacelle test benches},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {6},
   volume = {1037},
   number = {2018},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   pages = {052030},
   keywords = {torque calibration, nacelle test benches, NTB, torque transfer standard, rotational zero point determination, rotational speed},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/1037/5/052030/pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   event_place = {Milano, Italy},
   event_name = {TORQUE 2018},
   event_date = {20-06-2018 to 22-06-2018},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1037/5/052030},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weidinger, P and Foyer, G and Kock, S and Gnauert, J and Kumme, R.}
}

@Article { OverneyMDCKPOG2018,
   title = {An international comparison of phase angle standards between the novel impedance bridges of CMI, INRIM and METAS},
   journal = {Metrologia},
   year = {2018},
   month = {6},
   volume = {55},
   number = {4},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {499-512},
   keywords = {impedance metrology, impedance bridges, impedance standards, digital instrumens, comparisons},
   web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aabf24},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aabf24},
   stag_bib_extends_levelofaccess = {NA},
   author = {Overney, F. and Marzano, M. and D’Elia, V. and Callegaro, L. and Kucera, J. and Palafox, L. and Ortolano, M. and G{\"u}lmez, G.}
}

@Article { GarciaTorano2018_2,
   title = {The Half-life of 129I},
   journal = {Applied Radiation and Isotopes},
   year = {2018},
   month = {6},
   number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management},
   keywords = {129I, half-life, standardization, mass spektrometry, aktivity measurements},
   misc2 = {EMRP A169: Call 2010 Environment},
   language = {30},
   DOI = {10.1016/j.apradiso.2018.06.007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garc{\'i}a-Tora{\~n}o, E.}
}

@Article { EbertWBSLW2018,
   title = {High-resolution Fourier transform measurements of air-induced broadening and shift coefficients in the 00 0 2–00 0 0 main isotopologue band of nitrous oxide},
   journal = {Journal of Molecular Spectroscopy},
   year = {2018},
   month = {6},
   volume = {348},
   number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring},
   pages = {68-78},
   keywords = {Nitrous oxide, Fourier transform infrared spectroscopy, Spectral line parameters, Air-broadening, Air-shift, Gas metrology},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0022285217302059?via\%3Dihub},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0022-2852},
   DOI = {10.1016/j.jms.2017.07.002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ebert, V. and Werhahn, O. and Brunzendorf, J. and Serdyukov, A. and Li, G. and Werwein, V.}
}

@Article { deClercqZGRPCAB2018,
   title = {Toward a High-Stability Coherent Population Trapping Cs Vapor-Cell Atomic Clock Using Autobalanced Ramsey Spectroscopy},
   journal = {Physical Review Applied},
   year = {2018},
   month = {6},
   volume = {9},
   number = {6},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   keywords = {Resonance raman transition, dual-frequency laser, long-term stability, rubidium, standard; compensation, performance, shifts,},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.9.064002},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Clercq, E. and Zanon-Willette, T. and Gu{\'e}randel, S. and Rocher, C. and Petersen, M. and Coget, G. and Abdel Hafiz, M. and Boudot, R.}
}

@Article { WidmaierVRLEHKL2018,
   title = {Interferometric step gauge for CMM verification},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {6},
   volume = {29},
   number = {7},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   pages = {074012},
   keywords = {CMM, verification, metrology},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aabd2b},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   language = {30},
   DOI = {10.1088/1361-6501/aabd2b},
   stag_bib_extends_levelofaccess = {NA},
   author = {Widmaier, T. and Viitala, R. and Rantanen, A. and Laukkanen, P. and Esala, V.P. and Hemming, B. and Kuosmanen, P. and Lassila, A.}
}

@Proceedings { ProbstHDSPA2018,
   subid = {752},
   title = {Effects Degrading Accuracy of CPW mTRL Calibration at W Band},
   journal = {2018 IEEE/MTT-S International Microwave Symposium - IMS},
   year = {2018},
   month = {6},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {1296-1299},
   keywords = {Calibration, measurement accuracy, on-wafer measurement, probe},
   web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/effects-degrading-accuracy-of-cpw-mtrl-calibration-at-w-band},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   address = {445 Hoes Lane Piscataway NJ 08855-1331 United States},
   event_place = {Philadelphia},
   event_name = {2018 IEEE/MTT-S International Microwave Symposium - IMS},
   event_date = {10-06-2018 to 15-06-2018},
   language = {30},
   DOI = {10.1109/MWSYM.2018.8439837},
   stag_bib_extends_levelofaccess = {NA},
   author = {Probst, T. and Heinrich, W. and Doerner, R.  and Schmuckle, F.J. and Phung, G.N. and Arz, U.}
}

@Article { ThorwarthKDP2018,
   subid = {839},
   title = {Ionization chamber correction factors for MR-linacs},
   journal = {Physics in Medicine \& Biology},
   year = {2018},
   month = {6},
   volume = {63},
   number = {11},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {11NT03},
   keywords = {MRgRT, reference dosimetry},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aac4f2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Thorwarth, D. and Kapsch, R.P. and Dohm, O.S. and Pojtinger, S.}
}

@Proceedings { ZinalADP2018,
   subid = {753},
   title = {On the Importance of Calibration Standards Definitions for On-Wafer Measurements up to 110 GHz},
   journal = {2018 91st ARFTG Microwave Measurement Conference (ARFTG)},
   year = {2018},
   month = {6},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Calibration, Substrates, Standards, Probes, Aluminum oxide, Frequency measurement,},
   web_url = {https://doi.org/10.1109/ARFTG.2018.8423829},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Philadelphia, PA, USA},
   event_name = {2018 91st ARFTG Microwave Measurement Conference (ARFTG)},
   event_date = {15-06-2018 to 15-06-2018},
   language = {30},
   DOI = {10.7795/EMPIR.14IND02.CA.20190403C},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zinal, S. and Arz, U. and Doerner, R.  and Probst, T.}
}

@Article { MaheSHDMPLOC2018,
   subid = {896},
   title = {Investigation of new volumetric non-destructive techniques to characterise additive manufacturing parts},
   journal = {Welding in the World},
   year = {2018},
   month = {6},
   volume = {62},
   number = {5},
   number2 = {15HLT09: MetAMMI: Metrology for additively manufactured medical implants},
   pages = {1049-1057},
   keywords = {Additive manufacturing, Volumetric non-destructive techniques (NDTs), Archimedes’ method, Gas pycnometric method, Multi-frequency eddy current method, C-scan ultrasound method},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature America, Inc},
   language = {30},
   ISSN = {0043-2288, 1878-6669},
   DOI = {10.1007/s40194-018-0593-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mah{\'e}, E. and Senck, S. and Huskic, A. and Delvart, P. and Marlot, D. and Prezza, V. and Le, M.Q. and Obaton, A.F. and Cayron, C.}
}

@Article { Worton2018,
   subid = {976},
   title = {Purity Analysis of Gases Used in the Preparation of Reference Gas Standards Using a Versatile OPO-Based CRDS Spectrometer},
   journal = {Journal of Spectroscopy},
   year = {2018},
   month = {6},
   volume = {2018},
   number2 = {16ENV05: MetNO2: Metrology for nitrogen dioxide},
   pages = {1-7},
   keywords = {purity analysis, cavity ring down spectroscopy, nitric acid},
   web_url = {https://www.hindawi.com/journals/jspec/2018/9845608/},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Hindawi Limited},
   language = {30},
   ISSN = {2314-4920, 2314-4939},
   DOI = {10.1155/2018/9845608},
   stag_bib_extends_levelofaccess = {NA},
   author = {Worton, D.}
}

@Article { WebsterCPB2018,
   subid = {1149},
   title = {Patient-centred outcome metrology for healthcare decision-making},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {6},
   volume = {1044},
   number2 = {15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases},
   pages = {012057},
   keywords = {patient-centred outcome metrology},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1044/1/012057},
   stag_bib_extends_levelofaccess = {NA},
   author = {Webster, W. and Cano, S.J and Pendrill, L.R and Barbic, S.P}
}

@Article { LuoHLCSZCPPG2018,
   subid = {1169},
   title = {Chinese SPRIGT realizes high temperature stability in the range of 5–25 K},
   journal = {Science Bulletin},
   year = {2018},
   month = {6},
   volume = {63},
   number = {12},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {733-734},
   keywords = {low-temperature, cryogenic temperature, primary thermometry, refractive-index gas thermometry, microwave resonator},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2095-9273},
   DOI = {10.1016/j.scib.2018.05.023},
   stag_bib_extends_levelofaccess = {NA},
   author = {Luo, E. and Han, D. and Liu, W. and Chen, H. and Song, Y. and Zhang, H. and Chen, Y. and Pitre, L. and Pan, C. and Gao, B.}
}

@Article { DebogovicISAPdM2018,
   title = {3D printed microwave cavity for atomic clock applications: proof of concept},
   journal = {Electronics Letters},
   year = {2018},
   month = {5},
   day = {31},
   volume = {54},
   number = {11},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   pages = {691-693},
   keywords = {three-dimensional printing, rapid prototyping (industrial), atomic clocks, microwave resonators, polymers, coatings, 3D printed microwave cavity, additively manufactured microwave resonator cavity, AM microwave resonator cavity, double-resonance vapour-cell atomic clock application, DR vapour-cell atomic clock application, loop-gap resonator approach, conventionally-machined aluminium component, metal-coated polymer, clock short-term stability},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Institution of Engineering and Technology (IET)},
   language = {30},
   ISSN = {0013-5194, 1350-911X},
   DOI = {10.1049/el.2017.4176},
   stag_bib_extends_levelofaccess = {NA},
   author = {Debogovic, T. and Ivanov, A.E. and Skrivervik, A.K. and Affolderbach, C. and Pellaton, M. and de Rijk, E. and Mileti, G.}
}

@Article { HaeringLMDRK2018,
   subid = {838},
   title = {Feasibility of polymer gel-based measurements of radiation isocenter accuracy in magnetic fields},
   journal = {Physics in Medicine \& Biology},
   year = {2018},
   month = {5},
   day = {29},
   volume = {63},
   number = {11},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {11NT02},
   keywords = {3D-dosimetry, MRgRT, gel-dosimetry},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aac228/meta},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aac228},
   stag_bib_extends_levelofaccess = {NA},
   author = {Haering, P. and Lang, C. and Mann, P. and Dorsch, S. and Runz, A. and Karger, C.P.}
}

@Article { BarlowJ2018,
   subid = {823},
   title = {A hybrid 2D/3D inspection concept with smart routing optimisation for high throughput, high dynamic range and traceable critical dimension metrology},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {5},
   day = {23},
   volume = {29},
   number = {7},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {074004},
   keywords = {dimensional metrology, surface topography, hybrid measurement, high dynamic range, process control, inline measurement, calibration},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aababd/meta},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aababd},
   stag_bib_extends_levelofaccess = {NA},
   author = {Barlow, C. and Jones, C.W.}
}

@Proceedings { RobinsonMCY2018,
   subid = {850},
   title = {Traceable instruments for Encircled Angular Flux measurements},
   journal = {Proc. SPIE},
   year = {2018},
   month = {5},
   day = {17},
   volume = {10683},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {106831B},
   keywords = {Encircled Angular Flux, modal distribution, far field intensity pattern, step-index fibres},
   web_url = {https://arxiv.org/abs/1806.09839},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Strasbourg},
   event_name = {Fiber Lasers and Glass Photonics: Materials through Applications},
   event_date = {22-04-2018 to 26-04-2018},
   language = {30},
   DOI = {10.1117/12.2306430},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, E. and Morel, J. and Castagna, N. and Yang, H.}
}

@Proceedings { BymanLHBSS2018,
   subid = {870},
   title = {Online measurement of optical fibre geometry during manufacturing},
   journal = {Proc. SPIE},
   year = {2018},
   month = {5},
   day = {17},
   volume = {10683},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {1068318},
   keywords = {fibre, manufacturing, concentricity, scatterometry, modelling},
   web_url = {https://arxiv.org/abs/1806.07596},
   misc2 = {EMPIR 2014: Industry},
   publisher = {SPIE},
   event_place = {Strasbourg},
   event_name = {Fiber Lasers and Glass Photonics: Materials through Applications},
   event_date = {22-04-2018 to 26-04-2018},
   language = {30},
   DOI = {10.1117/12.2314762},
   stag_bib_extends_levelofaccess = {NA},
   author = {Byman, V. and Lassila, A. and Haapalainen, M. and Burger, S. and Shpak, M. and Saastamoinen, K.}
}

@Article { LiuHSFB2018,
   subid = {822},
   title = {Fast and cost-effective in-process defect inspection for printed electronics based on coherent optical processing},
   journal = {Optics Express},
   year = {2018},
   month = {5},
   day = {16},
   volume = {26},
   number = {11},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {13927},
   keywords = {all-optical difference engine, defects, detection, printed electronics, roll-to-roll, Fourier optics and signal processing, Spatial filtering, Imaging systems, Optical inspection, Optical sensing and sensors},
   web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-11-13927},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.26.013927},
   stag_bib_extends_levelofaccess = {NA},
   author = {Liu, J. and Happonen, T. and Su, R. and Feng, X. and Barlow, C.}
}

@Proceedings { PousASTOC2018,
   subid = {765},
   title = {FFT-based time domain solution to power frequency issue of CS101 testing for military and aerospace equipment},
   journal = {2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility (EMC/APEMC)},
   year = {2018},
   month = {5},
   day = {14},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {177-182},
   keywords = {Aerospace, CS101, EMC, Immunity, Military, Time Domain},
   web_url = {http://rfmw.cmi.cz/documents/papers/Cakir_FFT_TDS_CS101.pdf},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   event_place = {Singapore},
   event_name = {2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility},
   event_date = {14-05-2018 to 18-05-2018},
   language = {30},
   ISBN = {978-1-5090-5997-3},
   DOI = {10.1109/ISEMC.2018.8393762},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pous, M. and Acak, S. and Şen, O. and Tektas, B. and Ozturk, M. and \c{C}akır, S.}
}

@Article { vanSlagerenKFKPFKMPKBMP2018,
   subid = {898},
   title = {Room Temperature Uniaxial Magnetic Anisotropy Induced By Fe-Islands in the InSe Semiconductor Van Der Waals Crystal},
   journal = {Advanced Science},
   year = {2018},
   month = {5},
   day = {11},
   volume = {5},
   number = {7},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {1800257},
   keywords = {Magnetic Anisotropy, Nanotechnology, Nano-scale traceable magnetic field measurements},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Wiley},
   language = {30},
   ISSN = {2198-3844},
   DOI = {10.1002/advs.201800257},
   stag_bib_extends_levelofaccess = {NA},
   author = {van Slageren, J. and Kern, M. and Fielding, A.J. and Kovalyuk, Z.D. and Parmenter, C. and Fay, M.W. and Kazakova, O. and Makarovsky, O. and Puttock, R. and Kudrynskyi, Z.R. and Bhuiyan, M.A. and Moro, F. and Patan{\`e}, A.}
}

@Article { SparnacciSMU2018,
   subid = {551},
   title = {Shell thickness determination for PTFE-PS core-shell nanoparticles using scanning transmission X-ray microscopy (STXM)},
   journal = {Surface and Interface Analysis},
   year = {2018},
   month = {5},
   day = {10},
   number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles},
   keywords = {core-shell nanoparticles, polymers, PS, PTFE, SEM, STXM},
   web_url = {https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/44970},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Wiley},
   language = {30},
   ISSN = {0142-2421},
   DOI = {10.1002/sia.6464},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sparnacci, K. and Swaraj, S. and M{\"u}ller, A. and Unger, W.E.S.}
}

@Article { VandervorstvAZFMMC2018,
   subid = {482},
   title = {Toward accurate composition analysis of GaN and AlGaN using atom probe tomography},
   journal = {Journal of Vacuum Science \& Technology B, Nanotechnology and Microelectronics: Materials, Processing, Measurement, and Phenomena},
   year = {2018},
   month = {5},
   volume = {36},
   number = {3},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {03F130},
   keywords = {accuracy, composition, Atom probe, GaN},
   web_url = {https://avs.scitation.org/doi/10.1116/1.5019693},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Vacuum Society},
   language = {30},
   ISSN = {2166-2746, 2166-2754},
   DOI = {10.1116/1.5019693},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vandervorst, W. and van der Heide, P. and Arnoldi, L. and Zhao, M. and Fleischmann, C. and Melkonyan, D. and Morris, R.J.H. and Cuduvally, R.}
}

@Article { GenoveseDBTVLGAP2018,
   subid = {532},
   title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement},
   journal = {Scientific Reports},
   year = {2018},
   month = {5},
   volume = {8},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-018-25156-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Genovese, M. and Degiovanni, I.P. and Brida, G. and Tosi, A. and Villa, F. and Lussana, R. and Gramegna, M. and Avella, A. and Piacentini, F.}
}

@Article { CornejoDiaz2018,
   title = {Maximum likelihood estimation using expectation maximization applied to ambient dose equivalent measurements},
   journal = {Radiation Protection Dosimetry},
   year = {2018},
   month = {5},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   keywords = {ambient dose equivalent measurements, spectrometric detectors},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Oxford University Press (OUP)},
   language = {30},
   ISSN = {0144-8420, 1742-3406},
   DOI = {10.1093/rpd/ncy064},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cornejo D{\'i}az, N.}
}

@Article { WangXSLXG2018,
   subid = {795},
   title = {Single Layer PCB Broadband Circular Polarisation Millimetre Wave Massive MIMO Array},
   journal = {EuCAP},
   year = {2018},
   month = {5},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {circular polarisation, millimetre wave, antenna, MIMO.},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1809.07818},
   author = {Wang, M. and Xing, L. and Stanley, M. and Loh, T.H. and Xu, Q. and Gan, H.}
}

@Article { HudlickaHBL2018,
   subid = {794},
   title = {Prediction of SINR using BER and EVM for Massive MIMO Applications},
   journal = {EuCAP},
   year = {2018},
   month = {5},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {SINR,  EVM,  BER,  Interference Characterisation,  Massive MIMO},
   web_url = {http://epubs.surrey.ac.uk/846356/},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1809.07811},
   author = {Hudlicka, M. and Humphreys, D.A. and Brown, T.W.C. and Loh, T.H.}
}

@Article { BelenguerJKLA2018,
   subid = {796},
   title = {Empty Substrate Integrated Waveguide-Fed MMW Aperture-Coupled Patch Antenna for 5G Applications},
   journal = {EuCAP},
   year = {2018},
   month = {5},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {5G, antennas, millimetre-wave, Empty Substrate Integrated Waveguide.},
   web_url = {http://www.eucap.org/},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1809.07817},
   author = {Belenguer, A. and Jilani, S.F. and Khan, Z.U. and Loh, T.H. and Alomainy, A.}
}

@Article { BuismanSSN2018,
   subid = {798},
   title = {An Inter-Laboratory Comparison of NVNA Measurements},
   journal = {INMMIC},
   year = {2018},
   month = {5},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {Nonlinear microwave measurements, NVNA, measurement comparison},
   web_url = {http://arxiv.org/abs/1809.07301},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   DOI = {10.1109/INMMIC.2018.8430012},
   stag_bib_extends_levelofaccess = {NA},
   author = {Buisman, K and Stant, L and Salter, M and Nielsen, T}
}

@Article { AxnerZHS2018,
   subid = {804},
   title = {Gas modulation refractometry for high-precision assessment of pressure under non-temperature-stabilized conditions},
   journal = {Journal of Vacuum Science \& Technology A: Vacuum, Surfaces, and Films},
   year = {2018},
   month = {5},
   volume = {36},
   number = {3},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   pages = {03E105},
   keywords = {GAs modulation refractometry, Fabry Perot cavity refractometry},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Vacuum Society},
   language = {30},
   ISSN = {0734-2101, 1520-8559},
   DOI = {10.1116/1.5022244},
   stag_bib_extends_levelofaccess = {NA},
   author = {Axner, O. and Zelan, M. and Hausmaninger, T. and Silander, I.}
}

@Article { BuismanCHL2018,
   subid = {797},
   title = {An Evaluation of Distortion and Interference Sources originating Within a Millimeter-wave MIMO Testbed for 5G Communications},
   journal = {URSI},
   year = {2018},
   month = {5},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {MIMO, Testbed, Interference, Distortion},
   web_url = {http://www.ursi.org/proceedings/procAT18/papers/SA052.pdf},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1809.07825},
   author = {Buisman, K. and Cheadle, D. and Humphreys, D. and Loh, T.H.}
}

@Article { ErikssonHLCB2018,
   subid = {800},
   title = {Millimeter-Wave Over-the-Air Signal-to-Interference-plus-Noise-Ratio Measurements Using aMIMO Testbed},
   journal = {URSI},
   year = {2018},
   month = {5},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {Millimeter-waveSINRMIMO},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://research.chalmers.se/publication/505084/file/505084_Fulltext.pdf},
   author = {Eriksson, T  and Humphreys, D and Loh, T H and Cheadle, D and Buisman, K}
}

@Article { ErikssonB2018,
   subid = {801},
   title = {Designing and characterizing MATE, the Chalmers mm-wave MIMO testbed},
   journal = {EuCAP},
   year = {2018},
   month = {5},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {MATE, MIMO ,MM-wave ,Testbed},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://research.chalmers.se/publication/254625/file/254625_Fulltext.pdf},
   author = {Eriksson, T  and Buisman, K}
}

@Article { SavioLSSCM2018,
   subid = {824},
   title = {Fusion of photogrammetry and coherence scanning interferometry data for all-optical coordinate measurement},
   journal = {CIRP Annals},
   year = {2018},
   month = {5},
   volume = {67},
   number = {1},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {599-602},
   keywords = {Data fusion, Surface topography, Interferometry, Photogrammetry, Coordinate measurement},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0007850618300672?via\%3Dihub},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0007-8506},
   DOI = {10.1016/j.cirp.2018.04.043},
   stag_bib_extends_levelofaccess = {NA},
   author = {Savio, E. and Leach, R. and Sims-Waterhouse, D. and Su, R. and Carmignato, S. and Medeossi, F.}
}

@Article { GenoveseDBTVLGAP20180,
   subid = {532},
   title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement},
   journal = {Scientific Reports},
   year = {2018},
   month = {5},
   volume = {8},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-018-25156-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Genovese, M. and Degiovanni, I.P. and Brida, G. and Tosi, A. and Villa, F. and Lussana, R. and Gramegna, M. and Avella, A. and Piacentini, F.}
}

@Article { MihelicTDDR2018,
   title = {Comparison of the uncertainties of several European low-dose calibration facilities},
   journal = {Journal of Instrumentation},
   year = {2018},
   month = {4},
   day = {27},
   volume = {13},
   number = {04},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {P04023-P04023},
   keywords = {detector alignment and calibration methods, dosimetry concepts and apparatus, gamma detectors},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/13/04/P04023},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mihelic, M. and Toni, M.P. and D{\'i}az, N.A.C. and Dombrowski, H. and R{\"o}ttger, A.}
}

@Article { KimBBWLAM2018,
   subid = {843},
   title = {Improved Extraction Repeatability and Spectral Reproducibility for Liquid Extraction Surface Analysis–Mass Spectrometry Using Superhydrophobic–Superhydrophilic Patterning},
   journal = {Analytical Chemistry},
   year = {2018},
   month = {4},
   day = {27},
   volume = {90},
   number = {10},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {6001-6005},
   keywords = {liquid extraction surface analysis (LESA); Droplet Microarray (DMA); extraction solvent; mass spectrometry},
   web_url = {https://pubs.acs.org/doi/pdf/10.1021/acs.analchem.8b00973},
   misc2 = {EMPIR 2015: Health},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {0003-2700, 1520-6882},
   DOI = {10.1021/acs.analchem.8b00973},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kim, D.H. and Barrett, D.A. and Bunch, J. and Widmaier, S. and Levkin, P.A. and Alexander, M.R. and Meurs, J.}
}

@Miscellaneous { BastuckKS,
   subid = {1019},
   title = {Condition monitoring of hydraulic systems Data Set},
   journal = {Zenodo Community},
   year = {2018},
   month = {4},
   day = {26},
   number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future},
   keywords = {sensor network, condition monitoring, hydraulic},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Zenodo},
   language = {30},
   DOI = {10.5281/zenodo.1323610},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bastuck, M. and Klein, S. and Schneider, T.}
}

@Article { DickersonBRR2018,
   subid = {826},
   title = {Dealing with front-end white noise on differentiated measurements such as frequency and ROCOF in power systems},
   journal = {IEEE Transcations on Instrumentation and Measurement},
   year = {2018},
   month = {4},
   day = {25},
   volume = {67},
   number = {11},
   number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids},
   pages = {2579-2591},
   keywords = {Frequency measurement, noise measurement, power measurement, phase measurement, white noise, measurement uncertainty, phasor measurement units},
   web_url = {https://strathprints.strath.ac.uk/63576/},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   ISSN = {1557-9662},
   DOI = {10.1109/TIM.2018.2822438},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dickerson, W. and Blair, S.M. and Roscoe, A.J. and Rietveld, G.}
}

@Article { HeinrichSPHDKA2018,
   subid = {1053},
   title = {Traceable Coplanar Waveguide Calibrations on Fused Silica Substrates up to 110 GHz},
   journal = {IEEE TRANSACTIONS ON MICROWAVE THEORY AND TECHNIQUES},
   year = {2018},
   month = {4},
   day = {19},
   volume = {t.b.d.},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {1-10},
   keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget},
   web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=8693763},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/TMTT.2019.2908857},
   stag_bib_extends_levelofaccess = {NA},
   author = {Heinrich, W. and Schm{\"u}ckle, F. and Phung, G. and Hechtfischer, G. and Dziomba, T. and Kuhlmann, K. and Arz, U.}
}

@Article { SchmidtLGMD2018,
   subid = {587},
   title = {Atomic clocks for geodesy},
   journal = {Reports on Progress in Physics},
   year = {2018},
   month = {4},
   day = {18},
   volume = {81},
   number = {6},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {064401},
   keywords = {Atomic Clocks, Geodesy, Optical Frequency Standard},
   web_url = {https://arxiv.org/abs/1803.01585},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0034-4885, 1361-6633},
   DOI = {10.1088/1361-6633/aab409},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmidt, P.O. and Lisdat, C. and Grosche, G. and Mehlst{\"a}ubler, T.E. and Denker, H.}
}

@Article { SchmidtLGMD2018_2,
   subid = {587},
   title = {Atomic clocks for geodesy},
   journal = {Reports on Progress in Physics},
   year = {2018},
   month = {4},
   day = {18},
   volume = {81},
   number = {6},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {064401},
   keywords = {optical clocks, chronometric levelling, optical frequency transfer, atomic clocks,geoid mapping, gravity field modelling},
   web_url = {https://arxiv.org/abs/1803.01585},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0034-4885, 1361-6633},
   DOI = {10.1088/1361-6633/aab409},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmidt, P.O. and Lisdat, C. and Grosche, G. and Mehlst{\"a}ubler, T.E. and Denker, H.}
}

@Article { LewisAWNDOC2018,
   title = {Variability and bias in active and passive ground-based measurements of effective plant, wood and leaf area index},
   journal = {Agricultural and Forest Meteorology},
   year = {2018},
   month = {4},
   volume = {252},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {231-240},
   keywords = {Sensor comparison, Leaf area index, Terrestrial LiDAR, Hemispherical photography, LAI-2200, Validation.},
   web_url = {http://discovery.ucl.ac.uk/1542932/1/Origo_1-s2.0-S0168192317300369-main.pdf},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0168-1923},
   DOI = {10.1016/j.agrformet.2018.01.029},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lewis, P. and Armston, J. and Woodgate, W. and Nightingale, J. and Disney, M. and Origo, N. and Calders, K.}
}

@Article { AarhaugHAGCMB2018,
   subid = {502},
   title = {Probability of occurrence of ISO 14687-2 contaminants in hydrogen: Principles and examples from steam methane reforming and electrolysis (water and chlor-alkali) production processes model},
   journal = {International Journal of Hydrogen Energy},
   year = {2018},
   month = {4},
   number2 = {15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications},
   keywords = {ISO14687-2, Hydrogen quality, Fuel cell electrical vehicle, Probability of occurrence, Hydrogen production process, ISO 19880-8},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0360319918308450},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0360-3199},
   DOI = {10.1016/j.ijhydene.2018.03.084},
   stag_bib_extends_levelofaccess = {NA},
   author = {Aarhaug, T.A. and Haloua, F and Aupr{\^e}tre, F and Gozlan, B and Carr{\'e}, M and Murugan, A and Bacquart, T}
}

@Article { RedondasSSEMNKS2018,
   title = {Optical characterisation of three reference Dobsons in the ATMOZ Project – verification of G. M. B. Dobson's original specifications},
   journal = {Atmospheric Measurement Techniques},
   year = {2018},
   month = {4},
   volume = {11},
   number = {4},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {1989-1999},
   keywords = {Total Ozone Column, spectrophotometers, Dobson, slit function, effective absorption coefficents},
   web_url = {https://www.atmos-meas-tech.net/11/1989/2018/},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-11-1989-2018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Redondas, A. and Stanek, M. and Smid, M. and Evans, R. and McConville, G. and Nevas, S. and K{\"o}hler, U. and Sch{\"o}nenborn, F.}
}

@Article { MarquesBMHIPSGS2018_2,
   subid = {520},
   title = {Theoretical and experimental determination of K- and L-shell x-ray relaxation parameters in Ni},
   journal = {Physical Review A},
   year = {2018},
   month = {4},
   volume = {97},
   number = {4},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {042501},
   keywords = {Electronic Structure, X-ray Fluorescence, Fundamental Parameters, Fluorescence Yields, Condensed matter},
   web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.97.042501},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Physical Society (APS)},
   address = {1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.97.042501},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marques, J. P. and Beckhoff, B. and Muller, M. and Honicke, P. and Indelicato, P. and Parente, F. and Sampaio, J. M. and Guerra, M. and Santos, J. P.}
}

@Article { LassilaNS2018,
   subid = {549},
   title = {Metrological characterization methods for confocal chromatic line sensors and optical topography sensors},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {4},
   volume = {29},
   number = {054008},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {054008},
   keywords = {optical sensors, calibration, metrology, optical scanners},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   address = {Bristol?},
   language = {30},
   ISSN = {0957-0233},
   DOI = {10.1088/1361-6501/aaad2b},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lassila, A. and Niemel{\"a}, K. and Sepp{\"a}, J.}
}

@Article { MolinaFernandezHOVWGHV2018,
   subid = {570},
   title = {Ultra-Broadband Mode Converter and Multiplexer Based on Sub-Wavelength Structures},
   journal = {IEEE Photonics Journal},
   year = {2018},
   month = {4},
   volume = {10},
   number = {2},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {1-10},
   keywords = {Mode-division multiplexing, mode-converter, broadband, sub-wavelength grating waveguides, silicon-on-insulator},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {1943-0655},
   DOI = {10.1109/JPHOT.2018.2819364},
   stag_bib_extends_levelofaccess = {NA},
   author = {Molina-Fernandez, I. and Herrero-Bermello, A. and Ortega-Monux, A. and Velasco, A. and Wanguemert-Perez, J.G. and Gonzalez-Andrade, D. and Halir, R. and Velasco, A.V.}
}

@Article { KovaS2018,
   title = {Subtraction of natural radiation contribution from gamma-ray spectra measured by HPGe detector},
   journal = {Applied Radiation and Isotopes},
   year = {2018},
   month = {4},
   volume = {134},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {167-171},
   keywords = {HPGe detectors, Monte Carlo simulations, Airborne radioactivity measurement, Early warning networks,, Natural radionuclides subtraction},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.07.024},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kov{\'a}ř, P. and Solc, J.}
}

@Article { BoothTDFNMD2018_2,
   title = {Advanced fault location in MTDC networks utilising optically-multiplexed current measurements and machine learning approach},
   journal = {International Journal of Electrical Power \& Energy Systems},
   year = {2018},
   month = {4},
   volume = {97},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {319-333},
   keywords = {Fault location, Multi-terminal direct current, Travelling waves, Optical sensors, Machine learning, Pattern recognition},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0142-0615},
   DOI = {10.1016/j.ijepes.2017.10.040},
   stag_bib_extends_levelofaccess = {NA},
   author = {Booth, C. and Tzelepis, D. and Dysko, A. and Fusiek, G. and Niewczas, P. and Mirsaeidi, S. and Dong, X.}
}

@Article { VenceljPDCBGP2018,
   title = {Evaluation of the radon interference on the performance of the portable monitoring air pump for radioactive aerosols (MARE)},
   journal = {Applied Radiation and Isotopes},
   year = {2018},
   month = {4},
   volume = {134},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {439-445},
   keywords = {Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements, Radon and thoron background, Radon progeny, Walk-in radon chamber},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.07.039},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vencelj, M. and Ponikvar, D. and De Felice, P. and Cardellini, F. and Brodnik, D. and Glavič-Cindro, D. and Petrovič, T.}
}

@Article { deClercqGMB2018,
   title = {Pulsed coherent population trapping spectroscopy in microfabricated Cs–Ne vapor cells},
   journal = {Journal of the Optical Society of America B},
   year = {2018},
   month = {4},
   volume = {35},
   number = {5},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   pages = {1004},
   keywords = {Atomic-frequency references, clock, resonances,  frequency stability},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {0740-3224, 1520-8540},
   DOI = {10.1364/JOSAB.35.001004},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Clercq, E. and Gorecki, C. and Maurice, V. and Boudot, R.}
}

@Article { KajastieOPSSPH2018,
   title = {Effects of Sample Handling and Transportation on the Moisture Content of Biomass Samples},
   journal = {International Journal of Thermophysics},
   year = {2018},
   month = {4},
   volume = {39},
   number = {5},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   keywords = {Biomass, Moisture content, Sample handling, Transportation},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-018-2382-3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kajastie, H. and Ojanen-Saloranta, M. and Patel, S. and Sairanen, H. and Salminen, J. and Palkova, Z. and Heinonen, M.}
}

@Article { BuismanN2018,
   subid = {789},
   title = {Measurement Technique to Emulate Signal Coupling Between Power Amplifiers},
   journal = {IEEE},
   year = {2018},
   month = {4},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {Active load–pull, antenna array, coupling effect, distortion, emulation, measurement technique, power amplifier (PA)},
   web_url = {https://research.chalmers.se/publication/502172/file/502172_Fulltext.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/TMTT.2017.2786274},
   stag_bib_extends_levelofaccess = {NA},
   author = {Buisman, K. and Nopchinda, D.}
}

@Article { PlimmerOHB2018,
   subid = {807},
   title = {Development and characterisation of a low pressure transfer standard in the range 1 Pa to 10 kPa},
   journal = {ACTA IMEKO},
   year = {2018},
   month = {4},
   volume = {7},
   number = {1},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   pages = {80},
   keywords = {pressure, vacuum, transfer standard, resonant silicon gauge, mcapacitance diaphragm gauge},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IMEKO International Measurement Confederation},
   language = {30},
   ISSN = {2221-870X},
   DOI = {10.21014/acta_imeko.v7i1.496},
   stag_bib_extends_levelofaccess = {NA},
   author = {Plimmer, M. and Otal, P. and Huret, S. and Boineau, F.}
}

@Article { LopezASLXP2018,
   subid = {1099},
   title = {Studying the fundamental limit of optical fiber links to the 10−21 level},
   journal = {Optics Express},
   year = {2018},
   month = {4},
   volume = {26},
   number = {8},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {9515},
   keywords = {Fiber optics links and subsystems; Metrological instrumentation; Metrology; Phase measurement},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.26.009515},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lopez, O. and Amy-Klein, A. and Stefani, F. and Lee, W.K. and Xu, D. and Pottie, P.E.}
}

@Article { NouiraAMZA2018,
   subid = {862},
   title = {Investigation of minimum zone assessment methods for aspheric shapes},
   journal = {Precision Engineering},
   year = {2018},
   month = {4},
   volume = {52},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {300-307},
   keywords = {Aspheric shape, Chebyshev fitting, Exponential Penalty Function, Primal-Dual Interior Point Method, Form errors},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0141-6359},
   DOI = {10.1016/j.precisioneng.2018.01.008},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nouira, H. and Anwer, N. and Mehdi-Souzani, C. and Zhang, X. and Arezki, Y.}
}

@Article { MichlerWMDEC2018,
   subid = {858},
   title = {Longitudinal twinning in a TiAl alloy at high temperature by in situ microcompression},
   journal = {Acta Materialia},
   year = {2018},
   month = {4},
   volume = {148},
   number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials},
   pages = {202-215},
   keywords = {Titanium aluminides Micromechanics Electron backscattering diffraction (EBSD)Digital image correlation Deformation twinning},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1359-6454},
   DOI = {10.1016/j.actamat.2018.01.007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Michler, J. and Wehrs, J. and Mohanty, G. and Di Gioacchino, F. and Edwards, T.E.J. and Clegg, W.J.}
}

@Article { WellerJEB2018,
   title = {Online immunocapture ICP-MS for the determination of the metalloprotein ceruloplasmin in human serum},
   journal = {BMC Research Notes},
   year = {2018},
   month = {4},
   volume = {11},
   number = {1},
   number2 = {15HLT02: ReMiND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease},
   pages = {213-217},
   keywords = {Ceruloplasmin, Immunocapture, ICP‑MS, ELISA, Human serum},
   web_url = {https://bmcresnotes.biomedcentral.com/articles/10.1186/s13104-018-3324-7},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1756-0500},
   DOI = {10.1186/s13104-018-3324-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weller, M.G. and Jakubowski, N. and El-Khatib, A.H. and Bernevic, B.}
}

@Article { ZinziIR2018,
   subid = {982},
   title = {Lighting Implications of Urban Mitigation Strategies through Cool Pavements: Energy Savings and Visual Comfort},
   journal = {Climate},
   year = {2018},
   month = {4},
   volume = {6},
   number = {2},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   pages = {26},
   keywords = {cool pavements; road lighting; urban heat island; road surface; material characterization; luminance coefficient; energy savings; Euramet; EMPIR 16NRM02},
   web_url = {https://www.mdpi.com/2225-1154/6/2/26},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Paola Iacomussi},
   language = {30},
   ISSN = {2225-1154},
   DOI = {10.3390/cli6020026},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zinzi, M. and Iacomussi, P. and Rossi, G.}
}

@Proceedings { BlissBKG2018,
   subid = {1096},
   title = {Accessing the Performance of Individual Cells of Fully Encapsulated PV Modules Using a Commercial Digital Light Processing Projector},
   journal = {PVSAT proceedings},
   year = {2018},
   month = {4},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   keywords = {Photovoltaic},
   web_url = {Published},
   misc2 = {EMPIR 2016: Energy},
   event_place = {London},
   event_name = {PVSAT-14},
   event_date = {18-04-2018 to 20-04-2018},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {ISBN: 0904963845},
   author = {Bliss, Martin and Betts, Thomas Richard  and Koutsourakis, George  and Gottschalg, Ralph}
}

@Proceedings { EbenhagWH2018,
   subid = {1120},
   title = {Analysis and compensation of polarization in an optical frequency transfer through a fiber communication network},
   journal = {2018 European Frequency and Time Forum (EFTF)},
   year = {2018},
   month = {4},
   volume = {1},
   number = {1},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {pp. 253-257},
   keywords = {fiber, frequency transfer, heterodyne detection, coherent, polarization,},
   web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2018.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Torino, IT},
   event_name = {2018 European Frequency and Time Forum (EFTF)},
   event_date = {10-04-2018 to 12-04-2018},
   language = {30},
   ISBN = {978-1-5386-4077-7},
   DOI = {10.1109/EFTF.2018.8409044},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ebenhag, S.C. and Weddig, L. and Hedekvist, P.O.}
}

@Article { LopezASLXP20180,
   subid = {837},
   title = {Studying the fundamental limit of optical fiber links to the 10−21 level},
   journal = {Optics Express},
   year = {2018},
   month = {4},
   volume = {26},
   number = {8},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {9515},
   keywords = {Fiber optics links and subsystems; Metrological instrumentation; Metrology; Phase measurement},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.26.009515},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lopez, O. and Amy-Klein, A. and Stefani, F. and Lee, W.K. and Xu, D. and Pottie, P.E.}
}

@Article { ShardKGSGSM2018,
   subid = {568},
   title = {Measuring the size and density of nanoparticles by centrifugal sedimentation and flotation},
   journal = {Analytical Methods},
   year = {2018},
   month = {3},
   day = {29},
   volume = {2018},
   number = {10},
   number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles},
   pages = {1725-1732},
   keywords = {nanoparticles, centrifugal, sedimentation, flotation, SAXS, measurement, characterisation},
   web_url = {http://pubs.rsc.org/en/content/articlelanding/2018/ay/c8ay00237a\#!divAbstract},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Royal Society of Chemistry},
   language = {30},
   ISSN = {ISSN 1759-9679},
   DOI = {10.1039/c8ay00237a},
   stag_bib_extends_levelofaccess = {NA},
   author = {Shard, A. and Krumrey, M. and Gollwitzer, C. and Sparnacci, K. and Garcia-Diez, R. and Sikora, A. and Minelli, C.}
}

@Article { GrobnerEJ2018,
   title = {A new photometric ozone reference in the Huggins bands: the absolute ozone absorption cross section at the 325 nm HeCd laser wavelength},
   journal = {Atmospheric Measurement Techniques},
   year = {2018},
   month = {3},
   day = {27},
   volume = {11},
   number = {3},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {1707-1723},
   keywords = {total ozone, atmosphere, cross sections},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-11-1707-2018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gr{\"o}bner, J. and Elandaloussi, H. and Janssen, C.}
}

@Article { ChudnovskyPGWKGWHZBNZZZZ2018,
   subid = {582},
   title = {Direct writing of room temperature and zero field skyrmion lattices by a scanning local magnetic field},
   journal = {Applied Physics Letters},
   year = {2018},
   month = {3},
   day = {26},
   volume = {112},
   number = {13},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {132405},
   keywords = {magnetic skyrmion, magnetic force  microscopy, stray field,  perpendicular magnetic anisotropy},
   web_url = {https://aip.scitation.org/doi/full/10.1063/1.5021172},
   web_url2 = {http://hdl.handle.net/10754/627497},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/1.5021172},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chudnovsky, E.M. and Peng, Y. and Garanin, D.A. and Wang, W. and Kazakova, O. and Gong, C. and Wen, Y. and Hou, Z. and Zhao, Y. and Barton, C. and Neu, V. and Zhang, Q. and Zhang, J. and Zhang, S. and Zhang, X,}
}

@Article { PoutanenNLKK2018,
   title = {Validating and comparing GNSS antenna calibrations},
   journal = {Journal of Geodesy},
   year = {2018},
   month = {3},
   day = {22},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {1-18},
   keywords = {GNSS, Antenna calibration tables, Test field, Validation, Comparison, Residual offset},
   web_url = {https://link.springer.com/article/10.1007\%2Fs00190-018-1134-2},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0949-7714, 1432-1394},
   DOI = {10.1007/s00190-018-1134-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Poutanen, M. and Nikkonen, V. and Lahtinen, S. and Koivula, H. and Kallio, U.}
}

@Article { TabandehBSRCM2018,
   title = {Development of a low frost-point generator operating at sub-atmospheric pressure},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {3},
   day = {16},
   volume = {29},
   number = {5},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {054002},
   keywords = {hygrometry, humidity generator, frost point, upper-air sensors},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aaa785},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tabandeh, S. and Beltramino, G. and Smorgon, D. and Rosso, L. and Cuccaro, R. and Mana, G.}
}

@Article { RawsonHAS2018,
   subid = {841},
   title = {Electrochemically stimulating developments in bioelectronic medicine},
   journal = {Bioelectronic Medicine},
   year = {2018},
   month = {3},
   day = {15},
   volume = {4},
   number = {1},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   keywords = {Bioelectronic interfaces, Bioelectrochemistry, Nanobioelectronics, Cellular signalling},
   web_url = {https://link.springer.com/content/pdf/10.1186\%2Fs42234-018-0001-z.pdf},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2332-8886},
   DOI = {10.1186/s42234-018-0001-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rawson, F.J. and Hague, R.J.M. and Alexander, M.R. and Sanjuan-Alberte, P.}
}

@Article { deRijkSPDIMAM2018,
   title = {Study of additive manufactured microwave cavities for pulsed optically pumped atomic clock applications},
   journal = {Applied Physics Letters},
   year = {2018},
   month = {3},
   day = {12},
   volume = {112},
   number = {11},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   pages = {113502},
   keywords = {gap resonator, frequency stability, frequency standard},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/1.5019444},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Rijk, E. and Skrivervik, A.K. and Pellaton, M. and Debogovic, T. and Ivanov, A.E. and Moreno, W. and Affolderbach, C. and Mileti, G.}
}

@Article { CarrollMB2018,
   title = {Novel Calibration Technique for a Coulometric Evolved Vapor Analyzer for Measuring Water Content of Materials},
   journal = {International Journal of Thermophysics},
   year = {2018},
   month = {3},
   day = {10},
   volume = {39},
   number = {4},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {50},
   keywords = {Calibration, Evolved vapor analyze,r Measurement traceability, Water content},
   web_url = {https://link.springer.com/article/10.1007\%2Fs10765-018-2368-1},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-018-2368-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Carroll, P. A. and Miao, P. and Bell, S. A.}
}

@Article { CalonicoPTVR2018,
   subid = {589},
   title = {Phase noise cancellation in polarisation-maintaining fibre links},
   journal = {Review of Scientific Instruments},
   year = {2018},
   month = {3},
   volume = {89},
   number = {3},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {033103},
   keywords = {frequency metrology, optical fibre links},
   web_url = {http://arxiv.org/abs/1807.10818},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.5016514},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calonico, D. and Pizzocaro, M. and Thoumany, P. and V{\'e}lez L{\'o}pez, M. C. and Rauf, B.}
}

@Article { PaleckiOMLLJIHHGDTPdTVM2018_2,
   title = {Towards a global land surface climate fiducial reference measurements network},
   journal = {International Journal of Climatology},
   year = {2018},
   month = {3},
   volume = {38},
   number = {6},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {2760-2774},
   keywords = {climate, metrology, essential climate variables, climate change},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Wiley},
   language = {30},
   ISSN = {0899-8418},
   DOI = {10.1002/joc.5458},
   stag_bib_extends_levelofaccess = {NA},
   author = {Palecki, M. and Oakley, T. and Merlone, A. and Lawrimore, J. H. and Lister, D. H. and Jones, P. D. and Ingleby, N. B. and Hausfather, Z. and Harrigan, S. and Goodison, B. and Diamond, H. J. and Thorne, P. W. and Peterson, T. C. and de Podesta, M. and Tassone, C. and Venema, V. and Mana, G.}
}

@Article { FagerGLHE2018,
   subid = {788},
   title = {Digital Predistortion for Multi-Antenna Transmitters Affected by Antenna Crosstalk},
   journal = {IEEE},
   year = {2018},
   month = {3},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {Antenna crosstalk, digital predistortion (DPD), multiple-input multiple-output (MIMO) transmitter, power amplifier (PA) linearization},
   web_url = {https://research.chalmers.se/publication/252918/file/252918_Fulltext.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/TMTT.2017.2748948},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fager, C. and Gustavsson, U. and Landin, P.N. and Hausmair, K. and Eriksson, T .}
}

@Article { BarlowK2018,
   subid = {829},
   title = {Cross-correlation limit of a SQUID-based noise thermometer of the pMFFT type},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {3},
   volume = {969},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {012083},
   keywords = {primary magnetic field fluctuation thermometer, SQUID-based, noise thermometer, low temperature},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/969/1/012083},
   stag_bib_extends_levelofaccess = {NA},
   author = {Barlow, C. and Kirste, A.}
}

@Article { ManaBd2018,
   title = {Air temperature sensors: dependence of radiative errors on sensor diameter in precision metrology and meteorology},
   journal = {Metrologia},
   year = {2018},
   month = {2},
   day = {28},
   volume = {55},
   number = {2},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {229-244},
   keywords = {air temperature, meteorology, errors, sensors, metrology},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaaa52},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mana, G. and Bell, S. and de Podesta, M.}
}

@Article { Borkowski2018,
   subid = {473},
   title = {Optical Lattice Clocks with Weakly Bound Molecules},
   journal = {Physical Review Letters},
   year = {2018},
   month = {2},
   day = {22},
   volume = {120},
   number = {8},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {083202},
   keywords = {optical atomic clocks, ultracold molecules},
   web_url = {https://arxiv.org/abs/1802.08291},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.120.083202},
   stag_bib_extends_levelofaccess = {NA},
   author = {Borkowski, M.}
}

@Article { GilmoreTSH2018,
   subid = {559},
   title = {SIMS of Organic Materials—Interface Location in Argon Gas Cluster Depth Profiles Using Negative Secondary Ions},
   journal = {Journal of The American Society for Mass Spectrometry},
   year = {2018},
   month = {2},
   day = {21},
   volume = {29},
   number = {4},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {774-785},
   keywords = {SIMS},
   web_url = {https://link.springer.com/article/10.1007\%2Fs13361-018-1905-2},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer US},
   language = {30},
   ISSN = {1044-0305, 1879-1123},
   DOI = {10.1007/s13361-018-1905-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gilmore, I. S. and Tiddia, M. and Seah, M. P. and Havelund, R.}
}

@Article { WittkamperPJdd2018_2,
   subid = {705},
   title = {Comparison of k Q factors measured with a water calorimeter in flattening filter free (FFF) and conventional flattening filter (cFF) photon beams},
   journal = {Physics in Medicine \& Biology},
   year = {2018},
   month = {2},
   day = {20},
   volume = {63},
   number = {4},
   number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398},
   pages = {045023},
   keywords = {dosimetry, primary standard, flattening filter free, absorbed dose to water, kQ, code of practice, ion chamber},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aaaa93},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wittk{\"a}mper, F. and Perik, T. and Jansen, B. and de Pooter, J. and de Prez, L.}
}

@Proceedings { TunnermannESLW2018,
   subid = {906},
   title = {Measurement and removal of cladding light in high power fiber systems},
   journal = {Proceeding of the SPIE},
   year = {2018},
   month = {2},
   day = {20},
   volume = {10513},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {105130U},
   keywords = {Fiber laser, high power laser, cladding light, fiber characterization, fiber system measurement, fiber laser measurement, double clad fiber},
   web_url = {https://www.spiedigitallibrary.org/conference-proceedings-of-spie/10513/2288266/Measurement-and-removal-of-cladding-light-in-high-power-fiber/10.1117/12.2288266.full?SSO=1},
   misc2 = {EMPIR 2014: Industry},
   publisher = {SPIE},
   event_place = {San Francisco},
   event_name = {Components and Packaging for Laser Systems IV},
   event_date = {30-01-2018 to 01-02-2018},
   language = {30},
   DOI = {10.1117/12.2288266},
   stag_bib_extends_levelofaccess = {NA},
   author = {T{\"u}nnermann, A. and Eberhardt, R. and Schreiber, T. and Liem, A. and Walbaum, T.}
}

@Article { SylvainCHF2018,
   title = {Exploitation of a novel thermo-invariant multi-feature bar for high-precision CMMs and machine tool testing},
   journal = {The International Journal of Advanced Manufacturing Technology},
   year = {2018},
   month = {2},
   day = {18},
   volume = {96},
   number = {1-4},
   number2 = {IND62: TIM: Traceable in-process dimensional measurement},
   pages = {947–961},
   keywords = {Material standard; Calibration; Geometric errors; Intercomparison; Traceability},
   web_url = {https://link.springer.com/article/10.1007/s00170-017-1572-7\#enumeration},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Springer London},
   language = {30},
   ISSN = {1433-3015},
   DOI = {10.1007/s00170-017-1572-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sylvain, L. and Christophe, T. and Hichem, N. and Fabien, V.}
}

@Article { EhlersSPPODBS2018,
   subid = {808},
   title = {Calibration methods for negative gauge pressure down to  −100 kPa},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {2},
   day = {17},
   volume = {29},
   number = {3},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   pages = {035007},
   keywords = {negative gauge pressure, piston pressure gauge, differential pressure, pressure, calibration, barometer, manometer calibration},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa92ea},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ehlers, S. and Sabuga, W. and Praž{\'a}k, D. and Plimmer, M. and Otal, P. and Durgut, Y. and Bentouati, D. and Sınır, E.}
}

@Article { RaumonenLCBBDW2018,
   title = {Weighing trees with lasers: advances, challenges and opportunities},
   journal = {Interface Focus},
   year = {2018},
   month = {2},
   day = {16},
   volume = {8},
   number = {2},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {20170048},
   keywords = {above-ground biomass, terrestrial laser, scanning, lidar, canopy, structure, buttress},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {The Royal Society},
   language = {30},
   ISSN = {2042-8898, 2042-8901},
   DOI = {10.1098/rsfs.2017.0048},
   stag_bib_extends_levelofaccess = {NA},
   author = {Raumonen, P. and Lewis, S. L. and Calders, K. and Burt, A. and Boni Vicari, M. and Disney, M. I. and Wilkes, P.}
}

@Article { CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018,
   subid = {812},
   title = {Geodesy and metrology with a transportable optical clock},
   journal = {Nature Physics},
   year = {2018},
   month = {2},
   day = {12},
   volume = {14},
   number = {5},
   number2 = {SIB55: ITOC: International timescales with optical clocks},
   pages = {437-441},
   keywords = {optical fiber, optical frequency transfer},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1745-2473, 1745-2481},
   DOI = {10.1038/s41567-017-0042-3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Costanzo, G.A. and Zucco, M. and Barbieri, P. and Tampellini, A. and Bregolin, F. and Rauf, B. and Pizzocaro, M. and Thoumany, P. and Margolis, H.S. and Zampaolo, M. and Rolland, A. and Baynes, F.N. and Timmen, L. and Denker, H. and Voigt, C. and Lisdat, C. and H{\"a}fner, S. and Sterr, U. and Vogt, S. and Koller, S. and Grotti, J. and Clivati, C. and Levi, F. and Calonico, D.}
}

@Article { HenaultCLDRBFMBH2018,
   subid = {374},
   title = {A metrological comparison of Raman-distributed temperature sensors},
   journal = {Measurement},
   year = {2018},
   month = {2},
   volume = {116},
   number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities},
   pages = {18-24},
   keywords = {Distributed temperature sensors; Raman; Metrology; Structural health monitoring; Optical fibres},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0263224117306656},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2017.10.041},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\'e}nault, J.M. and Courthial, B. and Landolt, M. and Delepine-Lesoille, S. and Razouk, R. and Beaumont, O. and Failleau, G. and Martinot, F. and Bertrand, J. and Hay, B.}
}

@Article { StevenSRPGGGHPTB2018,
   title = {A calibration procedure for a traceable contamination analysis on medical devices by combined X-ray spectrometry and ambient spectroscopic techniques},
   journal = {Journal of Pharmaceutical and Biomedical Analysis},
   year = {2018},
   month = {2},
   volume = {150},
   number = {1},
   number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry},
   pages = {308-317},
   keywords = {XRF; Reference-free; N,N’-ethylene-bis (stearamide); Vibrational spectroscopy; Medical device},
   web_url = {https://www.sciencedirect.com/science/article/abs/pii/S0731708517310609},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0731-7085},
   DOI = {10.1016/j.jpba.2017.12.007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Steven, R. and Seim, C. and Rossi, A. and Portesi, C. and Gunning, P. and Green, F. and Giovannozzi, A.M. and Hornemann, A. and Pollakowski-Herrmann, B. and Tyler, B. and Beckhoff, B.}
}

@Article { OhlckersAMKB2018,
   subid = {455},
   title = {Reliability study of fiber-coupled photodiode module for operation at 4  K},
   journal = {Microelectronics Reliability},
   year = {2018},
   month = {2},
   volume = {81},
   number = {February 2},
   number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages},
   pages = {362-367},
   keywords = {Optoelectronic packaging, Cryogenics, Voltage standards},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0026-2714},
   DOI = {10.1016/j.microrel.2017.10.034},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ohlckers, P. and Akram, M.N. and Malmbekk, H. and Karlsen, B. and Bardalen, E.}
}

@Article { HollandtMGRDv2018,
   title = {Traceability of the Network for Detection of the Mesospheric Change (NDMC) to radiometric standards via a Near Infrared Filter Radiometer},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {2},
   volume = {972},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {012006},
   keywords = {Traceability, radiometric standards},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/972/1/012006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hollandt, J. and Monte, C. and Gutschwager, B. and Reiniger, M. and Dekker, P. and van den Berg, S.}
}

@Article { ScungioDAC2018,
   subid = {561},
   title = {Two-phase explicit CBS procedure for compressible viscous flow transport in porous materials},
   journal = {International Journal of Numerical Methods for Heat \& Fluid Flow},
   year = {2018},
   month = {2},
   volume = {28},
   number = {2},
   number2 = {14IND11: HIT: Metrology for humidity at high temperatures and transient conditions},
   pages = {336-360},
   keywords = {Finite elements, Heat transfer, Local thermal non-equilibrium, Multiphase mixture model, Porous media},
   web_url = {https://www.emeraldinsight.com/doi/abs/10.1108/HFF-02-2017-0080},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Emerald},
   language = {30},
   ISSN = {0961-5539},
   DOI = {10.1108/HFF-02-2017-0080},
   stag_bib_extends_levelofaccess = {NA},
   author = {Scungio, M. and Di Fraia, S. and Arpino, F. and Cortellessa, G.}
}

@Article { HoferLRK2018,
   subid = {588},
   title = {The absolutely characterized nitrogen vacancy center-based single-photon source – measurement uncertainty of photon flux and angular emission properties},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {2},
   volume = {972},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {012008},
   keywords = {single-photon source, Photon f,lux, measurement uncertainty, emission characterisitics},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/972/1/012008/pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/972/1/012008},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hofer, H and L{\'o}pez, M and Rodiek, B and K{\"u}ck, S}
}

@Article { HudlickaPOPAS2018,
   subid = {597},
   title = {Waveform Approach for Assessing Conformity of CISPR 16-1-1 Measuring Receivers},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2018},
   month = {2},
   volume = {67},
   number = {5},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {1187-1198},
   keywords = {Receivers, Electromagnetic interference, Calibration, Current measurement, Standards, Real-time systems, Frequency measurement},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2018.2794941},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://upcommons.upc.edu/handle/2117/116447},
   author = {Hudlicka, M. and Pinter, B. and Oliva, J.A. and Pous, M. and Azpurua, M.A. and Silva, F.}
}

@Article { PeyresERHVPLMGDMC2018,
   title = {Measurement of absolute \(\gamma\)-ray emission probabilities in the decay of  235 U},
   journal = {Applied Radiation and Isotopes},
   year = {2018},
   month = {2},
   volume = {132},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {72-78},
   keywords = {\(\gamma\)-ray spectrometry, 235U, 231Th, Decay data, \(\gamma\)-ray emission probabilities, NORM},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.10.049},
   stag_bib_extends_levelofaccess = {NA},
   author = {Peyres, V. and Eykens, R. and Richter, S. and Hult, M. and Van Ammel, R. and Pomm{\'e}, S. and Lutter, G. and Marouli, M. and Garc{\'i}a-Tora{\~n}o, E. and Dry{\'a}k, P. and Maz{\'a}nov{\'a}, M. and Carconi, P.}
}

@Proceedings { SaverioPavoneCCGV2018,
   subid = {849},
   title = {Optimization of Highly Inclined Optical Sheet Illumination for Super-Resolution Microscopy},
   journal = {Biophysical Journal},
   year = {2018},
   month = {2},
   volume = {114},
   number = {3},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {14a},
   keywords = {Highly Inclined and Laminated Optical sheet (HILO) microscopy, dSTORM},
   web_url = {https://www.biophysics.org/Portals/0/EasyDNNnews/Uploads/2131/2018\%20Program-WEB.pdf},
   misc2 = {EMPIR 2015: Health},
   publisher = {Elsevier BV},
   event_place = {Moscone Center},
   event_name = {Biophysical Society 62nd Annual Meeting},
   event_date = {17-02-2018 to 21-02-2018},
   language = {30},
   ISSN = {0006-3495},
   DOI = {10.1016/j.bpj.2017.11.121},
   stag_bib_extends_levelofaccess = {NA},
   author = {Saverio Pavone, F. and Capitanio, M. and Curcio, V. and Gardini, L. and Vignolini, T.}
}

@Article { HauerSQK2018,
   subid = {1016},
   title = {Polarization properties and microfacet-based modelling of white, grey and coloured matte diffuse reflection standards},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {2},
   volume = {972},
   number2 = {16NRM08: BiRD: Bidirectional reflectance definitions},
   pages = {012024},
   keywords = {Polarization, BRDF, Microfacet model, diffuse reflection Standards, BiRD-Project},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IOP Publishing},
   address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/972/1/012024},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hauer, K.O. and Schirmacher, A. and Quast, T. and Koo, A.}
}

@Article { BarlowKGAWIOS2018,
   subid = {830},
   title = {Development of large-area high-temperature fixed-point blackbodies for photometry and radiometry},
   journal = {Metrologia},
   year = {2018},
   month = {2},
   volume = {55},
   number = {2},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {S43-S51},
   keywords = {large-area high-temperature fixed point, blackbody, rhenium–carbon,tungsten carbide–carbon, photometry},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://link.springer.com/article/10.1007\%2Fs10765-017-2273-z},
   author = {Barlow, C. and Khlevnoy, B. and Grigoryeva, I. and Anhalt, K. and Waehmer, M.  and Ivashin, E.  and Otryaskin, D.  and Solodilov, M.}
}

@Article { GonzalezMadrugaDD2018,
   title = {Characterization of holding brake friction pad surface after pin-on-plate wear test},
   journal = {Surface Topography: Metrology and Properties},
   year = {2018},
   month = {1},
   day = {31},
   volume = {1},
   number = {March 2018},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   keywords = {holding brake friction material pin, pin-on-plate (POP) wear test, brake performance, ISO 27158-2, plateau dimension, surface topography},
   web_url = {http://iopscience.iop.org/article/10.1088/2051-672X/aaabd3},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2051-672X},
   DOI = {10.1088/2051-672X/aaabd3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gonzalez Madruga, D. and De Chiffre, L. and Drago, N.}
}

@Article { PeikTLHS2018,
   subid = {558},
   title = {Autobalanced Ramsey Spectroscopy},
   journal = {Physical Review Letters},
   year = {2018},
   month = {1},
   day = {30},
   volume = {120},
   number = {5},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {053602},
   keywords = {atomic clock, atomic spectroscopy, light shift},
   web_url = {https://www.ptb.de/cms/en/ptb/fachabteilungen/abt4/fb-44/44-literatur.html\#c8360},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.120.053602},
   stag_bib_extends_levelofaccess = {NA},
   author = {Peik, E. and Tamm, C. and Lange, R. and Huntemann, N. and Sanner, C.}
}

@Article { NovotnyDSKV2018,
   subid = {987},
   title = {Characterization of the Si(Li) detector for Monte Carlo calculations of beta spectra},
   journal = {Journal of Instrumentation},
   year = {2018},
   month = {1},
   day = {24},
   volume = {13},
   number = {01},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {P01021-P01021},
   keywords = {Si(Li) detector, beta spectrometry, beta spectra, Monte Carlo simulations},
   web_url = {https://arxiv.org/abs/1904.01294},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/13/01/P01021},
   stag_bib_extends_levelofaccess = {NA},
   author = {Novotny, P. and Dry{\'a}k, P. and Solc, J. and Kov{\'a}ř, P. and Vykydal, Z.}
}

@Thesis { Bilicki2018,
   subid = {1083},
   title = {Strontium optical lattice clocks : clock comparisons for timescales and fundamental physics applications},
   year = {2018},
   month = {1},
   day = {24},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   keywords = {Optical lattice clocks, spectroscopy, cold atoms, clock comparisons, timescales, amplified spontaneous emission},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Universit{\'e} Pierre et Marie Curie - Paris VI},
   address = {Paris},
   school = {Universit{\'e} Pierre et Marie Curie - Paris VI},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://tel.archives-ouvertes.fr/tel-01691598},
   author = {Bilicki, S.}
}

@Article { ReitzensteinHRSKSFS2018_2,
   subid = {695},
   title = {A stand-alone fiber-coupled single-photon source},
   journal = {Scientific Reports},
   year = {2018},
   month = {1},
   day = {22},
   volume = {8},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {1340},
   keywords = {quantum-light source, semiconductor quantum dots},
   web_url = {https://www.nature.com/articles/s41598-017-19049-4},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-19049-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Reitzenstein, S. and Heindel, T. and Rodt, S. and Strittmatter, A. and Kaganskiy, A. and Schmidt, R. and Fischbach, S. and Schlehahn, A.}
}

@Article { QuWQ2018,
   title = {Thermal Boundary Layer Effects on Line-of-Sight Tunable Diode Laser Absorption Spectroscopy (TDLAS) Gas Concentration Measurements},
   journal = {Applied Spectroscopy},
   year = {2018},
   month = {1},
   day = {19},
   volume = {72},
   number = {6},
   number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions},
   pages = {853-862},
   keywords = {Tunable diode laser absorption spectroscopy, TDLAS, thermal boundary layer, spatial temperature gradient, gas concentration, line-of-sight},
   web_url = {http://journals.sagepub.com/doi/10.1177/0003702817752112},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {SAGE Publications},
   language = {30},
   ISSN = {0003-7028, 1943-3530},
   DOI = {10.1177/0003702817752112},
   stag_bib_extends_levelofaccess = {NA},
   author = {Qu, Z. and Werhahn, O. and Qu, Z.}
}

@Article { ArzLDOP2018,
   subid = {525},
   title = {110 GHz on-wafer measurement comparison on alumina substrate},
   journal = {ARFTG Microwave Measurement Symposium (ARFTG), 2017 Nov 28th - Dec 1st},
   year = {2018},
   month = {1},
   day = {15},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Calibration, Ceramics, Probes, Metals, Substrates, Frequency measurement, Geometry, alumina, measurement standards, microwave measurement, network analysers, S-parameters devices under tests, measurement configurations, alumina calibration substrate, calibrations, probe geometry, measurement system, highly accurate multiline TRL calibration, vector network analyzer measurement, frequency 110.0 GHz, Al2O3, on-wafer, substrate},
   web_url = {https://doi.org/10.1109/ARFTG.2017.8255867},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.7795/EMPIR.14IND02.CA.20190403A},
   stag_bib_extends_levelofaccess = {NA},
   author = {Arz, U. and Lazar, R.  and Doerner, R.  and Ohlrogge, M.  and Probst, T.}
}

@Article { BarlowLR2018,
   subid = {820},
   title = {Thermography based online characterization of conductive thin films in large-scale electronics fabrication},
   journal = {Optics Express},
   year = {2018},
   month = {1},
   day = {11},
   volume = {26},
   number = {2},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {1219},
   keywords = {Flexible electronics, thin film based technology, quality assessment, thin film electronics, synchronized thermography, roll-to-roll},
   web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-2-1219},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.26.001219},
   stag_bib_extends_levelofaccess = {NA},
   author = {Barlow, C. and Lepp{\"a}nen, K. and Remes, K.}
}

@Article { GiuscaPKM2018,
   subid = {993},
   title = {Water on graphene: review of recent progress},
   journal = {2D Materials},
   year = {2018},
   month = {1},
   day = {11},
   volume = {5},
   number = {2},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   pages = {022001},
   keywords = {graphene, water, interaction},
   web_url = {https://arxiv.org/abs/1804.09518},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2053-1583},
   DOI = {10.1088/2053-1583/aa9ea9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Giusca, C.E. and Panchal, V. and Kazakova, O. and Melios, C.}
}

@Article { SaitoTTHSYHLSL2018,
   subid = {596},
   title = {Random telegraph noise from resonant tunnelling at low temperatures},
   journal = {Scientific Reports},
   year = {2018},
   month = {1},
   day = {10},
   volume = {8},
   number = {1},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Random telegraph noise, Quantum dot, transistor},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-18579-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Saito, S. and Tsuchiya, Y. and Tomita, I. and Hisamoto, D. and Sasago, Y. and Yoshimoto, H. and Husain, M.K. and Liu, F. and Sotto, M. and Li, Z.}
}

@Article { VermesseSLDBROGDDPDSGCP2018,
   title = {Feasibility of using a dose-area product ratio as beam quality specifier for photon beams with small field sizes},
   journal = {Physica Medica},
   year = {2018},
   month = {1},
   volume = {45},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {106-116},
   keywords = {Dose-area product, Beam quality, DAP ratio, Small photon beams},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1120-1797},
   DOI = {10.1016/j.ejmp.2017.12.012},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vermesse, D. and Sommier, L. and Le Roy, M. and Daures, J. and Bordy, J.M. and Rapp, B. and Ostrowsky, A. and Gouriou, J. and Dufreneix, S. and Delaunay, F. and Petrucci, A. and De Coste, V. and Silvi, L. and Guerra, A.S. and Caporali, C. and Pimpinella, M.}
}

@Article { ScholzePEKHSB2018,
   subid = {478},
   title = {Element sensitive reconstruction of nanostructured surfaces with finite elements and grazing incidence soft X-ray fluorescence},
   journal = {Nanoscale},
   year = {2018},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   keywords = {GIXRF, nanostructure characterization, FEM},
   web_url = {https://arxiv.org/abs/1801.04157},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2040-3364, 2040-3372},
   DOI = {10.1039/C8NR00328A},
   stag_bib_extends_levelofaccess = {NA},
   author = {Scholze, F. and Probst, J. and Eilbracht, J. and Kayser, Y. and Honicke, P. and Soltwisch, V. and Beckhoff, B.}
}

@Article { SliwczynskiKT2018,
   subid = {527},
   title = {Long haul time and frequency distribution in different DWDM systems},
   journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control},
   year = {2018},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {1-1},
   keywords = {time and frequency transfer, DWDM network, optical fiber, alien wavelength},
   web_url = {https://ieeexplore.ieee.org/document/8340172/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0885-3010},
   DOI = {10.1109/TUFFC.2018.2827178},
   stag_bib_extends_levelofaccess = {NA},
   author = {Śliwczyński, L. and Krehlik, P. and Turza, K.}
}

@Article { BeckhoffMWJCHU2018,
   subid = {534},
   title = {Accurate experimental determination of Gallium K- and L3-shell XRF fundamental parameters},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2018},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   keywords = {X-ray fluorescence, atomic fundamental parameters},
   web_url = {https://arxiv.org/abs/1805.02951},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Royal Society of Chemistry (RSC)},
   address = {Thomas Graham House Science Park, Milton Rd Science Park, Milton Rd Cambridge CB4 0WF United Kingdom},
   language = {30},
   ISSN = {0267-9477, 1364-5544},
   DOI = {10.1039/C8JA00046H},
   stag_bib_extends_levelofaccess = {NA},
   author = {Beckhoff, B. and Muller, M. and Wansleben, M. and Jeynes, C. and Colaux, J.L. and Honicke, P. and Unterumsberger, R.}
}

@Thesis { Rauf2018,
   subid = {580},
   title = {Absolute frequency measurement of an 171Yb lattice clock and optical clock comparisons},
   year = {2018},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   keywords = {Optical lattice clocks},
   web_url = {http://hdl.handle.net/11583/2708557},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Politecnico di Torino},
   school = {Politecnico di Torino},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rauf, B.}
}

@Thesis { Milani2018,
   subid = {579},
   title = {Realization of advanced 171Yb optical lattice frequency standard},
   year = {2018},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   keywords = {Optical Lattice Clocks},
   web_url = {http://hdl.handle.net/11583/2706635},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Politecnico di Torino},
   school = {Politecnico di Torino},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/11583/2706635},
   author = {Milani, G.}
}

@Proceedings { GowerBMHLKB2018,
   title = {Quantitative comparison of different non-destructive techniques for the detection of artificial defects in GFRP},
   journal = {Proceedings of 12th European Conference on NDT},
   year = {2018},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   keywords = {composites, non-destructive testing, defects},
   web_url = {http://www.ndt.net/?id=22834},
   misc2 = {EMRP A169: Call 2013 Energy II},
   event_place = {Gothenburg},
   event_name = {12th European Conference on Non Destructive Testing},
   event_date = {11-06-2018 to 15-06-2018},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ecndt2018/papers/ecndt-0297-2018.pdf},
   author = {Gower, M. and Brackrock, D. and Maierhofer, C. and Heckel, T. and Lodeiro, M. and Krankenhagen, R. and Baker, G.}
}

@Proceedings { GermakMPP2018,
   title = {Multicomponent force transducer calibration procedure using tilted plates},
   journal = {Proceedings of IMEKO XXII World Congress 2018},
   year = {2018},
   number2 = {SIB63: Force: Force traceability within the meganewton range},
   keywords = {multicomponent force transducer, MFT, meganewton, transversal forces, Force, Calibration},
   web_url = {http://www.imeko2018.org/abstracts/IMEKO18-253.PDF\&\#10;https://iris.inrim.it/handle/11696/58572?mode=full.301\#.W5-FjVUzZpg},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IMEKO},
   event_place = {Belfast},
   event_name = {IMEKO XXII World Congress 2018},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.imeko2018.org/abstracts/IMEKO18-253.PDF},
   author = {Germak, A. and Mazzoleni, F. and Prato, A. and Palumbo, S.}
}

@Article { ZhouWLCZ2018,
   subid = {799},
   title = {A rigorous link performance and measurement uncertainty assessment for MIMO OTA characterisation},
   journal = {Loughborough Antennas \& Propagation Conference 2018},
   year = {2018},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {wireless communication, MIMO OTA test, link performance, SINR, uncertainty.},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1809.07826},
   author = {Zhou, Y. and Wang, M. and Loh, T.H. and Cheadle, D. and Zhao, Y.}
}

@Article { PortesiGISR2018,
   subid = {847},
   title = {Development of a candidate reference sample for the characterization of tip-enhanced Raman spectroscopy spatial resolution},
   journal = {RSC Advances},
   year = {2018},
   volume = {8},
   number = {49},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {27863-27869},
   keywords = {Tip-Enhanced Raman Spectroscopy (TERS); Scanning Probe Microscopy (SPM); Localized Surface Plasmon Resonance (LSPR); Electron Beam Lithography (EBL); STM-TERS imaging},
   web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra03762k},
   misc2 = {EMPIR 2015: Health},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2046-2069},
   DOI = {10.1039/c8ra03762k},
   stag_bib_extends_levelofaccess = {NA},
   author = {Portesi, C. and Giovannozzi, A.M. and Imbraguglio, D. and Sacco, A. and Rossi, A.M.}
}

@Article { AlexanderWWNRPHH2018,
   subid = {844},
   title = {Effect of surfactant on Pseudomonas aeruginosa colonization of polymer microparticles and flat films},
   journal = {RSC Advances},
   year = {2018},
   volume = {8},
   number = {28},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {15352-15357},
   keywords = {nanoparticles, polymer microparticles, polymerizable monomer},
   web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra01491d},
   misc2 = {EMPIR 2015: Health},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2046-2069},
   DOI = {10.1039/C8RA01491D},
   stag_bib_extends_levelofaccess = {NA},
   author = {Alexander, M.R. and Wildman, R.D. and Williams, P. and Nisisako, T. and Romero, M. and Parry, L. and Haas, S. and H{\"u}sler, A.}
}

@Article { AnwerMAN2018,
   subid = {860},
   title = {Reference data simulation for L\(\infty\) fitting of aspheres},
   journal = {Procedia CIRP},
   year = {2018},
   volume = {75},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {331-336},
   keywords = {computational metrology fitting reference data},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2212-8271},
   DOI = {10.1016/j.procir.2018.04.051},
   stag_bib_extends_levelofaccess = {NA},
   author = {Anwer, N. and Mehdi-Souzani, C. and Arezki, Y. and Nouira, H.}
}

@Article { ZhaoFLLC2018,
   subid = {867},
   title = {Hierarchical-information-based characterization of multiscale structured surfaces},
   journal = {CIRP Annals},
   year = {2018},
   volume = {67},
   number = {1},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {539-542},
   keywords = {Information, Surface, Characterization},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0007-8506},
   DOI = {10.1016/j.cirp.2018.04.002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhao, C. and Feng, X. and Leach, R. and Liu, M. and Cheung, C.F.}
}

@Article { RockstuhlRLZGAAP2018,
   subid = {869},
   title = {Rigorous wave-optical treatment of photon recycling in thermodynamics of photovoltaics: Perovskite thin-film solar cells},
   journal = {Phys. Rev. B},
   year = {2018},
   volume = {98},
   number = {7},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {075141},
   keywords = {Geometrical \& wave optics, Interference \& diffraction of light, Light propagation, transmission \& absorption, Light-matter interaction, Luminescence, Nanophotonics, ,Optoelectronics, Spontaneous emission},
   web_url = {https://arxiv.org/abs/1804.02230},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Physical Society},
   language = {30},
   DOI = {10.1103/PhysRevB.98.075141},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rockstuhl, C. and Richards, B.S.  and Lemmer, U. and Zschiedrich, L. and Gomard, G.  and Abass, A. and Abebe, M.G. and Paetzold, U.W. }
}

@Proceedings { KahmannF2018,
   subid = {877},
   title = {A finite element analysis of effects on force lever systems under nacelle test bench conditions},
   journal = {Conference Proceedings 22. IMEKO World Congress},
   year = {2018},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   keywords = {international torque standard, force lever system, traceability force and length measurement, nacelle test benches, rotation, mechanical loads},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Belfast, Northern Ireland},
   event_name = {22. IMEKO World Congress},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   DOI = {10.1088/1742-6596/1065/4/042006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kahmann, H. and Foyer, G.}
}

@Proceedings { SebastianPerezSML2018,
   subid = {881},
   title = {Study of influences in CEM’s new transfer standard for torque measurements in the MN·m range},
   journal = {Conference Proceedings 22. IMEKO World Congress},
   year = {2018},
   number = {2018},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   keywords = {transfer standard, torque measurements, influence quantities, force-lever system, nacelle test benches},
   web_url = {http://www.imeko2018.org/abstracts/IMEKO18-454.PDF},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Belfast, Northern Ireland},
   event_name = {22. IMEKO World Congress},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.imeko2018.org/abstracts/IMEKO18-454.PDF},
   author = {Sebasti{\'a}n-P{\'e}rez, M.A. and S{\'a}enz-Nu{\~n}o, M.A. and Medina, N. and Lorente-Pedreille, R.M.}
}

@Proceedings { BosseKJG2018,
   subid = {879},
   title = {Measurement uncertainty estimation of a novel torque transducer for wind turbine test benches},
   journal = {Conference Proceedings 22. IMEKO World Congress},
   year = {2018},
   number = {2018},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   keywords = {torque transducer, force lever, wind turbine, test benches, multiaxial loads, rotational speed},
   web_url = {http://www.imeko2018.org/abstracts/IMEKO18-575.PDF},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Belfast, Northern Ireland},
   event_name = {22. IMEKO World Congress},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.imeko2018.org/abstracts/IMEKO18-575.PDF},
   author = {Bosse, D. and Kock, S. and Jacobs, G. and Gnauert, J.}
}

@Proceedings { StrangfeldBJK2018,
   subid = {880},
   title = {Simulation method for the characterisation of the torque transducers in MN·m range},
   journal = {Conference Proceedings 22. IMEKO World Congress},
   year = {2018},
   number = {2018},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   keywords = {wind turbine test benches, torque measurement, multi-axial operation, rotational speed},
   web_url = {http://www.imeko2018.org/abstracts/IMEKO18-241.PDF},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Belfast, Northern Ireland},
   event_name = {22. IMEKO World Congress},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.imeko2018.org/abstracts/IMEKO18-241.PDF},
   author = {Strangfeld, F. and Bosse, D. and Jacobs, G. and Koch, S.}
}

@Proceedings { KummeSAFW2018,
   subid = {882},
   title = {Investigations towards extrapolation approaches for torque transducer characteristics},
   journal = {Conference Proceedings 22. IMEKO World Congress},
   year = {2018},
   number = {2018},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   keywords = {torque transducers, traceable measurement, extrapolation, partial full range measurement, 20kN},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Belfast, Northern Ireland},
   event_name = {22. IMEKO World Congress},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   DOI = {10.1088/1742-6596/1065/4/042057},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kumme, R. and Schlegel, C. and Ala-Hiiro, J. and Foyer, G. and Weidinger, P.}
}

@Article { LohSZZZQ2018,
   subid = {892},
   title = {Understanding the Temporal Fading in Wireless Industrial Networks: Measurements and Analyses},
   journal = {Electrical Engineering and Systems Science - Signal Processing},
   year = {2018},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {Multipath fading, wireless industrial network, channel measurement ,impulse response ,Rician distribution},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1809.10871},
   author = {Loh, T.H. and Shen, F. and Zhang, W. and Zhang, Q . and Zhang, Q. and Qin, F.}
}

@Article { 88cda2272b2018,
   subid = {949},
   title = {Fast switching dual Fabry-Perot-cavity-based optical refractometry for assessment of gas refractivity and density – estimates of its precision, accuracy, and temperature dependence},
   journal = {arXiv},
   year = {2018},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   keywords = {dual Fabry-Perot cavity, optical refractometry, gas refractivity and density},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1704.01185}
}

@Article { f4c424e9b62018,
   subid = {948},
   title = {Drift-Free Fabry-Perot-Cavity-based Optical Refractometry - Accurate Expressions for Assessments of Gas Refractivity and Density},
   journal = {arXiv},
   year = {2018},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   keywords = {Drift-Free Fabry-Perot-Cavity, Optical Refractometry},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1704.01187}
}

@Thesis { Galindo2018,
   subid = {947},
   title = {Metrolog{\'i}a {\'o}ptica de frecuencias: S{\'i}ntesis, an{\'a}lisis y aplicaci{\'o}n de referencias {\'o}pticas},
   year = {2018},
   number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres,waveguides and applications},
   keywords = {metrology, optical frequency comb, optical references},
   web_url = {https://repositorio.uam.es/handle/10486/682698},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Universidad Aut{\'o}noma de Madrid},
   school = {Universidad Aut{\'o}noma de Madrid},
   language = {112},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/10486/682698},
   author = {Galindo, J.}
}

@Proceedings { b0013816172018,
   subid = {967},
   title = {Design Study of a Double-Side Illumination Solar Simulator for Bifacial Silicon PV Modules Characterisation Based on Low-Cost LED Bias Light},
   journal = {Proceedings of EUPVSEC 2018},
   year = {2018},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   keywords = {Bifacial, LED, Characterisation, Characterization, PV Module, Standard},
   web_url = {https://www.eupvsec-proceedings.com/proceedings?fulltext=Design+study+of+a+double-side+illumination+solar+simulator+for+bifacial+silicon+PV+modules+characterisation+based+on+low-cost+LED+bias+light\&paper=46494},
   misc2 = {EMPIR 2016: Energy},
   event_place = {Brussels, BE},
   event_name = {35th European Photovoltaic Solar Energy Conference and Exhibition},
   event_date = {24-09-2018 to 27-09-2018},
   language = {30},
   ISBN = {3-936338-50-7},
   DOI = {10.4229/35thEUPVSEC20182018-5BO.9.2},
   stag_bib_extends_levelofaccess = {NA}
}

@Proceedings { GottschalgBBK2018,
   subid = {965},
   title = {Utilising Digital Light Processing and Compressed Sensing for Photocurrent Mapping of Encapsulated Photovoltaic Modules},
   journal = {Proceedings of EUPVSEC},
   year = {2018},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   keywords = {Non-Destructive Testing, PV Modules, Compressed Sensing, Current Mapping},
   web_url = {https://www.eupvsec-proceedings.com/proceedings?paper=44865},
   misc2 = {EMPIR 2016: Energy},
   event_place = {Brussels},
   event_name = {35th European Photovoltaic Solar Energy Conference and Exhibition},
   event_date = {24-09-2018 to 27-09-2018},
   language = {30},
   ISBN = {3-936338-50-7},
   DOI = {10.4229/35thEUPVSEC20182018-5BO.11.6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gottschalg, R. and Betts, T. and Bliss, M.  and Koutsourakis, G. }
}

@Article { Bossew2018,
   subid = {985},
   title = {Radon priority areas - definition, estimation and uncertainty},
   journal = {Nuclear Technology and Radiation Protection},
   year = {2018},
   volume = {33},
   number = {3},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {286-292},
   keywords = {Radon priority area, classification, EURATOM Basic Safety Standards},
   misc2 = {EMPIR 2016: Environment},
   publisher = {National Library of Serbia},
   language = {30},
   ISSN = {1451-3994, 1452-8185},
   DOI = {10.2298/NTRP180515011B},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bossew, P.}
}

@Article { StoicaTS2018,
   subid = {1103},
   title = {Biphasic pKa Values},
   journal = {Croatica Chemica Acta},
   year = {2018},
   volume = {91},
   number = {4},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   pages = {599-602},
   keywords = {acid strength, base strength, nonaqueous solvents, membranes, two-phase equilibria.},
   web_url = {https://hrcak.srce.hr/215675},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Croatian Chemical Society},
   language = {30},
   ISSN = {0011-1643, 1334-417X},
   DOI = {doi.org/10.5562/cca3405},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stoica, D. and Tshepelevitsh, S. and Selberg, S.}
}

@Article { KoblarFSJPH2018,
   subid = {1156},
   title = {Distribution and Accumulation of Major and Trace Elements in Gypsum Samples from Lignite Combustion Power Plant},
   journal = {American Journal of Analytical Chemistry},
   year = {2018},
   volume = {09},
   number = {12},
   number2 = {16ENV01: MercOx: Metrology for oxidised mercury},
   pages = {602-621},
   keywords = {Trace and Major Elements, Wet Flue Gas Desulphurization Gypsum, Particle Size Fractions, Mercury and Selenium, Sample Preparation},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Scientific Research Publishing, Inc,},
   language = {30},
   ISSN = {2156-8251, 2156-8278},
   DOI = {10.4236/ajac.2018.912044},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koblar, M. and Frkal, P. and Stergaršek, A. and Jaćimović, R. and Pavlin, M. and Horvat, M.}
}

@Article { OhlckersAMKB2018_2,
   subid = {1183},
   title = {Evaluation of InGaAs/InP photodiode for high-speed operation at 4 K},
   journal = {International Journal of Metrology and Quality Engineering},
   year = {2018},
   volume = {9},
   number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages},
   pages = {13},
   keywords = {optoelectronics / cryogenics / voltage standards},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {EDP Sciences},
   language = {30},
   ISSN = {2107-6847},
   DOI = {10.1051/ijmqe/2018015},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ohlckers, P. and Akram, M.N. and Malmbekk, H. and Karlsen, B. and Bardalen, E.}
}

@Thesis { Bardalen2018,
   subid = {1188},
   title = {Reliable Packaging and Development of Photodiode Module for Operation at 4 K},
   year = {2018},
   number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages},
   keywords = {Packaging, Photodiodes, Low Temperatures},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Eivind Bardalen},
   school = {University of South-Eastern Norway},
   language = {30},
   ISBN = {ISBN: 978-82-7860-317-8 (onlin},
   ISSN = {ISSN: 2535-5252(online)},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/11250/2500465},
   author = {Bardalen, E.}
}

@Article { BurnsRMNBFLADYHR2017,
   subid = {499},
   title = {Antimicrobial peptide capsids of de novo design},
   journal = {Nature Communications},
   year = {2017},
   month = {12},
   day = {22},
   volume = {8},
   number = {1},
   number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance},
   pages = {2263},
   keywords = {Antimicrobials, Protein design, Self-assembly, Biometrology},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-017-02475-3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Burns, J.R. and Ray, S. and Micale, N. and Noble, J.E. and Bella, A. and Faruqui, N. and Lamarre, B. and Alkassem, H. and De Santis, E. and Yon, A.R. and Hoogenboom, B.W. and Ryadnov, M.G.}
}

@Article { CouplandLTS2017,
   subid = {420},
   title = {Effects of defocus on the transfer function of coherence scanning interferometry},
   journal = {Optics Letters},
   year = {2017},
   month = {12},
   day = {21},
   volume = {43},
   number = {1},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {82},
   keywords = {Imaging systems , Interferometry, Metrology , Calibration , Microscopy, Aberrations},
   web_url = {https://www.osapublishing.org/ol/fulltext.cfm?uri=ol-43-1-82},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {0146-9592, 1539-4794},
   DOI = {10.1364/OL.43.000082},
   stag_bib_extends_levelofaccess = {NA},
   author = {Coupland, J. and Leach, R. and Thomas, M. and Su, R.}
}

@Article { HauptE2017,
   subid = {529},
   title = {Thermoelemente auf Graphitbasis – M{\"o}glichkeiten und Grenzen},
   journal = {tm - Technisches Messen},
   year = {2017},
   month = {12},
   day = {20},
   volume = {84},
   number = {12},
   number2 = {14IND04: EMPRESS: Enhancing process efficiency through improved temperature measurement},
   pages = {779-786},
   keywords = {Graphite, high temperatures, Seebeck coefficient, thermocouple},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Walter de Gruyter GmbH},
   language = {43},
   ISSN = {0171-8096, 2196-7113},
   DOI = {10.1515/teme-2017-0073},
   stag_bib_extends_levelofaccess = {NA},
   author = {Haupt, S. and Edler, F.}
}

@Article { MeschkeFMSPB2017,
   subid = {506},
   title = {On-and-off chip cooling of a Coulomb blockade thermometer down to 2.8 mK},
   journal = {Applied Physics Letters},
   year = {2017},
   month = {12},
   day = {18},
   volume = {111},
   number = {25},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {253105},
   keywords = {nanoelectronic devices, thermometry},
   web_url = {https://aip.scitation.org/doi/10.1063/1.5002565},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1708.09491},
   author = {Meschke, M. and Feshchenko, A.V. and Maradan, D. and Scheller, C.P. and Palma, M. and Barlow, C.}
}

@Article { NeumaierDCBDS2017,
   title = {Recommendations to harmonize European early warning dosimetry network systems},
   journal = {Journal of Instrumentation},
   year = {2017},
   month = {12},
   day = {18},
   volume = {12},
   number = {12},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {P12024-P12024},
   keywords = {data acquisition concepts, dosimetry concepts and apparatus, overall mechanics, design (support structures and materials, vibration analysis etc), radiation monitoring},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/12/12/P12024},
   stag_bib_extends_levelofaccess = {NA},
   author = {Neumaier, S. and Dabrowski, R. and Cort, M.D. and Bleher, M. and Dombrowski, H. and St{\"o}hlker, U.}
}

@Article { RuizCMPB2017,
   subid = {819},
   title = {Characterization of the reference wave in a compact digital holographic camera},
   journal = {Applied Optics},
   year = {2017},
   month = {12},
   day = {18},
   volume = {57},
   number = {1},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {A235-A241},
   keywords = {holographic, reference wave, optical holography,},
   web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-57-1-A235},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1559-128X, 2155-3165},
   DOI = {10.1364/AO.57.00A235},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ruiz, P.D. and Coggrave, C.R. and Middleton, R.J.C. and Park, I.S. and Barlow, C.}
}

@Article { BorkowskiKMuC2017,
   subid = {594},
   title = {Optical Feshbach resonances and ground-state-molecule production in the RbHg system},
   journal = {Physical Review A},
   year = {2017},
   month = {12},
   day = {15},
   volume = {96},
   number = {6},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {063411},
   keywords = {Optical Feshbach resonances, ultra-cold molecules},
   web_url = {https://arxiv.org/abs/1708.05403},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.96.063411},
   stag_bib_extends_levelofaccess = {NA},
   author = {Borkowski, M. and Kosicki, M.B. and Mu{\~n}oz Rodriguez, R. and Żuchowski, P.S. and Ciuryło, R.}
}

@Article { SterrRZSOBHLYMR2017,
   subid = {720},
   title = {Ultrastable Silicon Cavity in a Continuously Operating Closed-Cycle Cryostat at 4 K},
   journal = {Physical Review Letters},
   year = {2017},
   month = {12},
   day = {15},
   volume = {119},
   number = {24},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   keywords = {ultrastable laser, silicon cavity, 4K cryocooler, time and frequency standards},
   web_url = {https://arxiv.org/abs/1708.05161},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.119.243601},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sterr, U. and Robinson, J. M. and Zhang, W. and Sonderhouse, L. and Oelker, E. and Benko, C. and Hall, J. L. and Legero, T. and Ye, J. and Matei, D. G. and Riehle, F.}
}

@Article { vandenBergCVL2017,
   title = {High-accuracy long distance measurements with a mode-filtered frequency comb},
   journal = {Optics Express},
   year = {2017},
   month = {12},
   day = {14},
   volume = {25},
   number = {26},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {32570},
   keywords = {Fabry-Perot, Interferometry, Metrology, Mode-locked lasers, Optical resonators, Laser range finder, Ultra fast lasers},
   web_url = {https://www.osapublishing.org/DirectPDFAccess/294E3804-A5DD-C864-BA58B8635F309FB1_379535/oe-25-26-32570.pdf?da=1\&id=379535\&seq=0\&mobile=no},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.25.032570},
   stag_bib_extends_levelofaccess = {NA},
   author = {van den Berg, S. and Č{\'i}p, O. and Voigt, D. and Lešund{\'a}k, A.}
}

@Article { SliwczynskiSK2017,
   subid = {417},
   title = {A Hybrid Solution for Simultaneous Transfer of Ultrastable Optical Frequency, RF Frequency, and UTC Time-Tags Over Optical Fiber},
   journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control},
   year = {2017},
   month = {12},
   volume = {64},
   number = {12},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {1884-1890},
   keywords = {Optical fibers, Optical variables control, Atom optics, Optical filters,  Optical fiber communication, Time-frequency analysis},
   web_url = {http://ieeexplore.ieee.org/document/8066317/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0885-3010},
   DOI = {10.1109/TUFFC.2017.2759001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Śliwczyński, L. and Schnatz, H. and Krehlik, P.}
}

@Article { PivacPSDVFWKBHFDDB2017,
   subid = {544},
   title = {Development and Synchrotron-Based Characterization of Al and Cr Nanostructures as Potential Calibration Samples for 3D Analytical Techniques},
   journal = {physica status solidi (a)},
   year = {2017},
   month = {12},
   volume = {215},
   number = {6},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {1700866},
   keywords = {SIMS, APT, GISAXS, 3D nanostructures, di-block copolymers},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Wiley},
   language = {30},
   ISSN = {1862-6300},
   DOI = {10.1002/pssa.201700866},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pivac, B. and Perego, M. and Seguini, G. and Dubček, P. and Vandervorst, W. and Fleischmann, C. and Weimann, T. and Kayser, Y. and Beckhoff, B. and Honicke, P. and Ferrarese Lupi, F. and Dialameh, M. and De Leo, N. and Boarino, L.}
}

@Article { NielsenAKKIIHGFCCBHOOSS2017,
   title = {New Primary Standards for Establishing SI Traceability for Moisture Measurements in Solid Materials},
   journal = {International Journal of Thermophysics},
   year = {2017},
   month = {12},
   volume = {39},
   number = {1},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   keywords = {Karl Fischer, Loss-on-drying, Moisture, Oven drying, Traceability},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-017-2340-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nielsen, J. and Aro, R. and Krasheninina, M. and Keawprasert, T. and Ismail, N. and Ionescu, G.V. and Hudoklin, D. and Georgin, E. and Fernicola, V. and Cortellessa, G. and Choi, B.I. and Bell, S. and Heinonen, M. and Oguz Aytekin, S. and {\"O}sterberg, P. and Skabar, J. and Strnad, R.}
}

@Article { TakasuBBCJYKTT2017,
   subid = {775},
   title = {Beyond-Born-Oppenheimer effects in sub-kHz-precision photoassociation spectroscopy of ytterbium atoms},
   journal = {Physical Review A},
   year = {2017},
   month = {12},
   volume = {96},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {063405},
   keywords = {photoassociation, spectroscopy, ytterbium,},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.96.063405},
   stag_bib_extends_levelofaccess = {NA},
   author = {Takasu, Y. and Borkowski, M. and Buchachenko, A.A. and Ciuryło, R. and Julienne, P.S. and Yamada, H. and Kikuchi, Y. and Takahashi, K. and Takahashi, Y.}
}

@Proceedings { RidlerCL2017_2,
   subid = {519},
   title = {An intra-laboratory investigation of on-wafer measurement reproducibility at millimeter-wave frequencies},
   journal = {2017 90th ARFTG Microwave Measurement Symposium (ARFTG)},
   year = {2017},
   month = {11},
   day = {30},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Measurement repeatability, Measurement reproducibility, On-wafer measurements, Millimeter-wave measurements, Measurement uncertainty},
   web_url = {http://eprints.whiterose.ac.uk/125336/},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   address = {445 Hoes Lane Piscataway NJ 08855-1331 United States},
   event_place = {Boulder, Colorado},
   event_name = {ARFTG 90th Microwave Measurement Conference},
   event_date = {28-11-2017 to 01-12-2017},
   language = {30},
   ISBN = {978-1-5386-4356-3},
   DOI = {10.1109/arftg.2017.8255866},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ridler, N M and Clarke, R G and Li, C}
}

@Proceedings { SchmuckleHPAZH2017,
   subid = {521},
   title = {Establishing traceability for on-wafer S-parameter measurements of membrane technology devices up to 110 GHz},
   journal = {2017 90th ARFTG Microwave Measurement Symposium (ARFTG)},
   year = {2017},
   month = {11},
   day = {30},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {on-wafer, calibration, S-parameters, traceability,uncertainty budget},
   web_url = {https://doi.org/10.1109/ARFTG.2017.8255874},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Boulder, Colorado},
   event_name = {ARFTG Microwave Measurement Symposium},
   event_date = {28-11-2017 to 01-12-2017},
   language = {30},
   ISBN = {978-1-5386-4356-3},
   DOI = {10.7795/EMPIR.14IND02.CA.20190403},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmuckle, Franz-Josef and Heinrich, Wolfgang and Probst, Thorsten and Arz, Uwe and Zinal, Sherko and Hechtfischer, Gerd}
}

@Article { SassiLGWTMPLBPDCESK2017,
   title = {Preparation and analysis of zero gases for the measurement of trace VOCs in air monitoring},
   journal = {Atmospheric Measurement Techniques Discussions},
   year = {2017},
   month = {11},
   day = {28},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   pages = {1-17},
   keywords = {zero gas, VOC measurements},
   web_url = {https://www.atmos-meas-tech-discuss.net/amt-2017-412/},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8610},
   DOI = {10.5194/amt-2017-412},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sassi, G. and Lecuna, M. and Ghorafi, Y. and Wortmann, R. and Tensing, E. and Michl, K. and Plass-Duelmer, C. and Li, J. and Baldan, A. and Persijn, S. and Demichelis, A. and Claude, A. and Englert, J. and Sassi, M.P. and Kubistin, D.}
}

@Article { WittFKPW2017,
   title = {Angular-dependent spectral responsivity-Traceable measurements on optical losses in PV devices},
   journal = {Progress in Photovoltaics: Research and Applications},
   year = {2017},
   month = {11},
   day = {27},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   keywords = {angle of incidence, calibration, diffuse light, energy rating, optical losses, spectral responsivity},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Wiley},
   language = {30},
   ISSN = {1062-7995},
   DOI = {10.1002/pip.2957},
   stag_bib_extends_levelofaccess = {NA},
   author = {Witt, F. and Fey, T. and Kr{\"o}ger, I. and Plag, F. and Winter, S.}
}

@Article { NordlundKRR2017,
   title = {Atomistic simulation of the measurement of mechanical properties of gold nanorods by AFM},
   journal = {Scientific Reports},
   year = {2017},
   month = {11},
   day = {24},
   volume = {7},
   number = {1},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   keywords = {AFM, gold nanorods, nanowires},
   web_url = {https://www.nature.com/articles/s41598-017-16460-9},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-16460-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nordlund, K. and Kuronen, A. and Rohl, A.L. and Reischl, B}
}

@Article { FountoulakisFGKKKHFDBBLRF2017,
   title = {Temperature dependence of the Brewer global UV measurements},
   journal = {Atmospheric Measurement Techniques},
   year = {2017},
   month = {11},
   day = {22},
   volume = {10},
   number = {11},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {4491-4505},
   keywords = {Brewer spectrophotometer, temperature characterization, UV radiation},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-10-4491-2017},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fountoulakis, I. and Fragkos, K. and Garane, K. and Koskela, T. and Karhu, J.M. and Karppinen, T. and Heikkila, A. and Feister, U. and Doppler, L. and Bais, A.F. and Berjon, A. and Lakkala, K. and Redondas, A. and Fountoulakis, I.}
}

@Article { BaeHCGHAK2017,
   subid = {414},
   title = {Upper frequency limit depending on potential shape in a QD-based single electron pump},
   journal = {Journal of Applied Physics},
   year = {2017},
   month = {11},
   day = {21},
   volume = {122},
   number = {19},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {194502},
   keywords = {single electron pump, quantum dot, single electron tunneling},
   web_url = {http://aip.scitation.org/doi/abs/10.1063/1.5000319},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0021-8979, 1089-7550},
   DOI = {10.1063/1.5000319},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bae, M.H. and Hong, Y.P. and Chung, Y. and Ghee, Y.S. and Hong, C. and Ahn, Y.H. and Kim, N.}
}

@Article { NielsenO2017,
   title = {SI-Traceable Water Content Measurements in Solids, Bulks, and Powders},
   journal = {International Journal of Thermophysics},
   year = {2017},
   month = {11},
   day = {20},
   volume = {39},
   number = {1},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   keywords = {Dew point, Moisture content, SI primary standard, Water content, Water mass fraction},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-017-2325-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nielsen, J. and {\O}stergaard, P.}
}

@Article { EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017,
   subid = {602},
   title = {First patients treated with a 1.5 T MRI-Linac: clinical proof of concept of a high-precision, high-field MRI guided radiotherapy treatment},
   journal = {Physics in Medicine \& Biology},
   year = {2017},
   month = {11},
   day = {14},
   volume = {62},
   number = {23},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {L41-L50},
   keywords = {MRgRT, Radiotherapy, MRI},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aa9517},
   stag_bib_extends_levelofaccess = {NA},
   author = {Eppinga, W S C and Doornaert, P A H and Sikkes, G G and Nomden, C N and Meijers, L T C and Kiekebosch, I and de Groot-van Breugel, E N and Kok, J G M and Tijssen, R and Philippens, M E P and van Zijp, H M and Wolthaus, J W H and Woodings, S J and Moerland, M A and Hackett, S L and Bluemink, J J and de Boer, J C J and van Asselen, B and Kotte, A N T J and Glitzner, M and Bol, G H and J{\"u}rgenliemk-Schulz, I M and Raaymakers, B W and Kasperts, N and Kerkmeijer, L G W and Tersteeg, J H A and Brown, K J and Pais, B and Woodhead, P and Lagendijk, J J W}
}

@Article { SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017,
   title = {The MeteoMet2 project – Highlights and results},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {11},
   day = {13},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   keywords = {Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa99fc},
   stag_bib_extends_levelofaccess = {NA},
   author = {Šindel{\'a}rov{\'a}, L. and Sestan, D. and Salminen, J. and Sairanen, H. and Rosso, L. and del Rio, J. and Rasmussen, M.K. and Oguz Aytekin, S. and de Podesta, M. and Pavlasek, P. and Nogueras Cervera, M. and Nielsen, J. and Musacchio, C. and Miao, P. and Lanza, L.G. and Kowal, A. and Kalemci, M. and Hudoklin, D. and H{\"o}gstr{\"o}m, R. and Hernandez de la Villa, S. and Heinonen, M. and Groselj, D. and Gonzalez Calvo, A. and Georgin, E. and Gardiner, T. and Garc{\'i}a Izquierdo, C. and Garcia-Benad{\'i}, A. and Fernicola, V and Ebert, V. and Drnovsek, J. and Dobre, M. and Cuccaro, R. and Coppa, G. and Colli, M. and Chiodo, N. and Castrillo, A. and del Campo, D. and Brunet, M. and Bojkovski, J. and Beltramino, G. and Bell, S.A. and Beges, G. and Sanna, F. and Merlone, A. and Smorgon, D. and Sparasci, F. and Strnad, R. and Vold{\'a}n, M. and Underwood, R.J. and Mana, G.}
}

@Proceedings { SalterCR2017,
   subid = {528},
   title = {'Mind the Gap'... Establishing Measurement Capability in the Terahertz Gap Region - from 0.1 THz to 1.1 THz},
   journal = {ARMMS RF \& Microwave Society Conference, 13-14 Nov, 2017, Wyboston, Bedfordshire},
   year = {2017},
   month = {11},
   day = {13},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {measurement, state-of-the-art of measurements, 0.1 THz to 1.1 THz frequency range, rectangular metallic waveguides, on-wafer planar circuits, bult material  characterisations, Terahertz Gap},
   web_url = {http://eprints.whiterose.ac.uk/125335/},
   misc2 = {EMPIR 2014: Industry},
   publisher = {ARMMS},
   event_place = {Wyboston, Bedfordshire, UK},
   event_name = {ARMMS RF \& Microwave Society Conference},
   event_date = {13-11-2017 to 14-11-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://eprints.whiterose.ac.uk/125335/},
   author = {Salter, M J  and Clarke, R G and Ridler, N M}
}

@Article { CapogniDS2017_2,
   title = {A new approach in evaluating the surface beta contamination using the direct method of measurement},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {11},
   volume = {129},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   pages = {135-141},
   keywords = {Surface contamination, Method of measurement, Uncertainty of measurement},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0969804317303913?via\%3Dihub},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.08.018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Capogni, M. and De Felice, P. and Stanga, D.}
}

@Proceedings { FieldSS2017,
   title = {Feasibility Study for PV Measurements at Varying Irradiances on a Large-Area Steady- State Solar Simulator},
   journal = {EU PVSEC},
   year = {2017},
   month = {11},
   volume = {33rd},
   number = {33rd},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {1548-1553},
   keywords = {Characterisation, Energy Rating, Irradiance Non-uniformity, Performance, Solar Simulator},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {WIP},
   address = {Munich},
   event_place = {Amsterdam},
   event_name = {EU PVSEC},
   event_date = {25-09-2017 to 29-09-2017},
   language = {30},
   ISBN = {3-936338-47-7},
   DOI = {10.4229/EUPVSEC20172017-5BV.4.6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Field, M and Sharlandzhiev, I and Salis, E}
}

@Proceedings { PavanelloZKMSG2017,
   title = {Comparison of Traceable Calibrations for Filtered Reference Cells},
   journal = {EUPVSEC},
   year = {2017},
   month = {11},
   volume = {33rd},
   number = {33rd},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {1354-1358},
   keywords = {Calibration, Reference Cell, Traceability, World Photovoltaic Scale (WPVS)},
   web_url = {https://www.eupvsec-proceedings.com/proceedings?fulltext=Comparison+of+Traceable+Calibrations+for+Filtered+Reference+Cells\&paper=40434},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {WIP},
   event_place = {Amsterdam},
   event_name = {EU PVSEC},
   event_date = {25-09-2017 to 29-09-2017},
   language = {30},
   ISBN = {3-936338-47-7},
   DOI = {10.4229/EUPVSEC20172017-5BO.6.1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pavanello, D. and Zaaiman, W. and Kr{\"o}ger, I. and M{\"u}llejans, H. and Salis, E. and Galleano, R.}
}

@Article { PollingerMMM2017,
   title = {SI-traceable absolute distance measurement over more than 800 meters with sub-nanometer interferometry by two-color inline refractivity compensation},
   journal = {Applied Physics Letters},
   year = {2017},
   month = {11},
   volume = {111},
   number = {19},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {191104},
   keywords = {Interferometry, Interferometers, Optical properties, Lasers, Optical, Long distance, refractivity-compensation, two-color, multi-wavelength interferometry},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/1.5000569},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pollinger, F. and Mildner, J. and Meyer, T. and Meiners-Hagen, K.}
}

@Article { vanderVeenGUTBG2017,
   title = {Validation and sensitivity evaluation of the ID-GC-TOF-MS method for determination of PAHs in biogas},
   journal = {Journal of Chemical Metrology},
   year = {2017},
   month = {11},
   volume = {11},
   number = {2},
   number2 = {ENG54: Biogas: Metrology for biogas},
   pages = {78-85},
   keywords = {PAH; biogas; biomethane; thermal desorption; isotope dilution; GC-TOF-MS},
   web_url = {http://www.acgpubs.org/JCM/2017/Volume\%2011/Issue\%201/11-JCM_2017-11-01.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {ACG Publications},
   language = {30},
   ISSN = {1307-6183},
   DOI = {10.25135/jcm.11.17.11.01},
   stag_bib_extends_levelofaccess = {NA},
   author = {van der Veen, A. and Goren, A.C. and Un, I. and Tarhan, T. and Bilsel, G. and Gokcen, T.}
}

@Article { UngerKRBTDHK2017,
   subid = {556},
   title = {Detection of suspended nanoparticles with near-ambient pressure x-ray photoelectron spectroscopy},
   journal = {Journal of Physics: Condensed Matter},
   year = {2017},
   month = {11},
   volume = {29},
   number = {47},
   number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles},
   pages = {474002},
   keywords = {Core-shell nanoparticles, NAP-XPS, Nanoparticles, Suspensions},
   web_url = {https://opus4.kobv.de/opus4-bam/home},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0953-8984, 1361-648X},
   DOI = {10.1088/1361-648X/aa8b9d},
   stag_bib_extends_levelofaccess = {NA},
   author = {Unger, W.E.S. and Kemnitz, E. and Ritter, B. and Bahr, S. and Thissen, A. and Dietrich, P. and Hermanns, A. and Kj{\ae}rvik, M.}
}

@Article { GustavssonLSGHEF2017,
   subid = {319},
   title = {Prediction of Nonlinear Distortion in Wideband Active Antenna Arrays},
   journal = {IEEE},
   year = {2017},
   month = {11},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {Active antenna array, antenna crosstalk, mismatch, multiple-input multiple-output (MIMO) transmitter (TX), power-amplifier (PA) modeling},
   web_url = {https://research.chalmers.se/publication/252917/file/252917_Fulltext.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/TMTT.2017.2699962},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gustavsson, U. and Landin, P.N. and Sanchez-Perez, C. and Gustafsson, S. and Hausmair, K. and Eriksson, T. and Fager, C.}
}

@Article { ZhaoRGFHMKF2017,
   subid = {405},
   title = {Thermal-Error Regime in High-Accuracy Gigahertz Single-Electron Pumping},
   journal = {Physical Review Applied},
   year = {2017},
   month = {10},
   day = {30},
   volume = {8},
   number = {4},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Single electron pumps},
   web_url = {https://arxiv.org/abs/1703.04795},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.8.044021},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhao, R. and Rossi, A. and Giblin, S. P. and Fletcher, J. D. and Hudson, F. E. and M{\"o}tt{\"o}nen, M. and Kataoka, M. and Fletcher, J.}
}

@Article { UlmKECCSHFB2017,
   subid = {450},
   title = {A pilot study on fingerprinting Leishmania species from the Old World using Fourier transform infrared spectroscopy},
   journal = {Analytical \& Bioanalytical Chemistry},
   year = {2017},
   month = {10},
   day = {28},
   volume = {409},
   number = {29},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {6907-6923},
   keywords = {Fourier transforminfrared spectroscopy, Hierarchical cluster analysis (HCA), Principal componentsanalysis (PCA), Leishmania, DNA, Multivariate differentiation},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer},
   language = {30},
   ISSN = {1618-2642},
   DOI = {10.1007/s00216-017-0655-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ulm, G. and Kuhls, K. and Emmer, P. and Campino, L. and Cortes, S. and Sinning, D. and Hornemann, A. and Frohme, M. and Beckhoff, B.}
}

@Article { GilmoreHS2017,
   subid = {64},
   title = {SIMS of Delta Layers in Organic Materials: Amount of Substance, Secondary Ion Species, Matrix Effects, and Anomalous Structures in Argon Gas Cluster Depth Profiles},
   journal = {The Journal of Physical Chemistry C},
   year = {2017},
   month = {10},
   day = {26},
   volume = {120},
   number = {46},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {26328–26335},
   keywords = {mass-spectrometry, sputtering yields, response function, impurity layers, semiconductors, suppression, interfaces, emission, beams},
   web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcc.6b08646},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Chemical Society},
   address = {Washington},
   language = {30},
   ISSN = {1932-7455},
   DOI = {10.1021/acs.jpcc.6b08646},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gilmore, I.S. and Havelund, R. and Seah, M.P.}
}

@Article { QuinceyVTSPMMHWBWWSN2017,
   subid = {956},
   title = {Mobility particle size spectrometers: Calibration procedures and measurement uncertainties},
   journal = {Aerosol Science and Technology},
   year = {2017},
   month = {10},
   day = {26},
   volume = {52},
   number = {2},
   number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality},
   pages = {146-164},
   keywords = {aerosol metrology , mobility particle size spectrometers , calibration, measurement uncertainties},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {0278-6826, 1521-7388},
   DOI = {10.1080/02786826.2017.1387229},
   stag_bib_extends_levelofaccess = {NA},
   author = {Quincey, P. and Velarde, F. and Tuch, T. and Schmidt, A. and Pfeifer, S. and M{\"u}ller, T. and Merkel, M. and Hermann, M. and Weinhold, K. and Birmili, W. and Wiesner, A. and Wiedensohler, A. and Seeger, S. and Nowak, A.}
}

@Article { JennettH2017,
   subid = {935},
   title = {A method to separate and quantify the effects of indentation size, residual stress and plastic damage when mapping properties using instrumented indentation},
   journal = {Journal of Physics D: Applied Physics},
   year = {2017},
   month = {10},
   day = {20},
   volume = {50},
   number = {45},
   number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials},
   pages = {455304},
   keywords = {.},
   web_url = {https://pure.coventry.ac.uk/ws/portalfiles/portal/12629973/Hou_and_Jennett_Accpeted_version.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0022-3727, 1361-6463},
   DOI = {10.1088/1361-6463/aa8a22},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jennett, N M and Hou, X D}
}

@Article { TunnermannESHLWSSPB2017,
   subid = {388},
   title = {Measuring thermal load in fiber amplifiers in the presence of transversal mode instabilities},
   journal = {Optics Letters},
   year = {2017},
   month = {10},
   day = {18},
   volume = {42},
   number = {21},
   number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {4311-4314},
   keywords = {Fiber optics amplifiers and oscillators, Thermal effects, Fiber properties, High power lasers},
   web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-42-21-4311},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Optical Society of America},
   language = {30},
   ISSN = {0146-9592, 1539-4794},
   DOI = {10.1364/OL.42.004311},
   stag_bib_extends_levelofaccess = {NA},
   author = {T{\"u}nnermann, A. and Eberhardt, R. and Schreiber, T. and Haarlammert, N. and Liem, A. and Walbaum, T. and Stutzki, F. and Sattler, B. and Pl{\"o}tner, M. and Beier, F.}
}

@Article { HallstromL2017,
   title = {Optimizing Temperature Coefficient and Frequency Response of Rogowski Coils},
   journal = {IEEE Sensors Journal},
   year = {2017},
   month = {10},
   day = {15},
   volume = {17},
   number = {20},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {6646-6652},
   keywords = {Current measurement,  inductive transducers,  power systems,  RLC circuits, smart grids, Temperature dependence},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {1530-437X, 1558-1748, 2379-915},
   DOI = {10.1109/JSEN.2017.2743259},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"a}llstr{\"o}m, J. and Lehtonen, T.A.}
}

@Article { KesslerDDRN2017,
   title = {Detection of rain events in radiological early warning networks with spectro-dosimetric systems},
   journal = {Journal of Instrumentation},
   year = {2017},
   month = {10},
   day = {12},
   volume = {12},
   number = {10},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {P10005-P10005},
   keywords = {gamma detectors (scintillators, CZT, HPG, HgI etc), models and simulations, radiation monitoring},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/12/10/P10005},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kessler, P. and Dombrowski, H. and Dabrowski, R. and R{\"o}ttger, A. and Neumaier, S.}
}

@Article { LestremauLKvBMBCBRYAB2017,
   title = {Suitability of vessels and adsorbents for the short-term storage of biogas/biomethane for the determination of impurities – Siloxanes, sulfur compounds, halogenated hydrocarbons, BTEX},
   journal = {Biomass and Bioenergy},
   year = {2017},
   month = {10},
   volume = {105},
   number2 = {ENG54: Biogas: Metrology for biogas},
   pages = {127-135},
   keywords = {BiogasCompositionImpuritiesVesselsSampling},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0961953417302118},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   DOI = {10.1016/j.biombioe.2017.06.025},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lestremau, F. and Li, J. and Krom, I. and van der Veen, A.M.H. and Brewer, B. and Murugan, A. and Bartlett, S. and Culleton, L. and B{\"u}ker, O. and Rosell, L. and Yaghooby, H. and Arrhenius, K. and Beranek, J.}
}

@Article { WehmannLSTVASFNLZSHW2017,
   title = {Study of 3D-growth conditions for selective area MOVPE of high aspect ratio GaN fins with non-polar vertical sidewalls},
   journal = {Journal of Crystal Growth},
   year = {2017},
   month = {10},
   volume = {476},
   number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting},
   pages = {90-98},
   keywords = {Crystal morphology, Metalorganic vapor phase epitaxy, Gallium compounds, Nitrides, Light emitting diodes},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0022024817305146},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0022-0248},
   DOI = {10.1016/j.jcrysgro.2017.08.021},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wehmann, H-H and Lugauer, H-J and Stra{\ss}burg, M. and Trampert, A. and Varghese, T. and Avramescu, A. and Schimpke, T. and F{\"u}ndling, S. and Nicolai, L. and Ledig, J. and Zhou, H. and Steib, F. and Hartmann, J. and Waag, A}
}

@Inbook { GillBRBBNKJGBM2017,
   subid = {379},
   title = {Absolute frequency measurement of the  optical clock transition in 171Yb+ with an uncertainty of 4E-16 using a frequency link to international atomic time},
   year = {2017},
   month = {10},
   volume = {65},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {221-227},
   keywords = {Frequency metrology, optical frequency standards, international atomic time},
   web_url = {http://empir.npl.co.uk/oc18/wp-content/uploads/sites/13/2016/04/Yb_J_Mod_Op.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Informa UK Limited},
   booktitle = {Journal of Modern Optics},
   language = {30},
   ISBN = {0950-0340, 1362-3044},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1707.00646v2},
   author = {Gill, P. and Bongs, K. and Rolland, A. and Baird, P.E.G. and Baynes, F. and Nisbet-Jones, P.B.R. and King, S.A. and Jones, J.M. and Godun, R.M. and Baynham, C.F.A. and Margolis, H.S.}
}

@Proceedings { HoogenboomAHR2017,
   subid = {391},
   title = {Meeting ecodesign efficiency requirements: ensuring accuracy in power transformer loss tests via TLM system calibrations},
   journal = {CIRED - Open Access Proceedings Journal},
   year = {2017},
   month = {10},
   volume = {2017},
   number = {1},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   pages = {329-332},
   keywords = {power transformer testing power factor; error sources; Ecodesign Directive; sustainable energy policies; high-quality TLM systems; efficiency requirements; power transformer loss test; TLM system calibration; transformer loss measurement systems; EU; calibration accuracies; advanced digital signal processing technique; ecodesign efficiency requirement},
   web_url = {http://digital-library.theiet.org/content/journals/10.1049/oap-cired.2017.0475},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institution of Engineering and Technology (IET)},
   event_place = {Scottish Event Campus (SEC), Glasgow, Scotland},
   event_name = {CIRED 2017},
   event_date = {12-06-2017 to 15-06-2017},
   language = {30},
   ISSN = {2515-0855},
   DOI = {10.1049/oap-cired.2017.0475},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hoogenboom, D. and Acanski, M. and Houtzager, E. and Rietveld, G.}
}

@Article { CalonicoMLCT2017_2,
   subid = {367},
   title = {Effect of a timebase mismatch in two-way optical frequency transfer},
   journal = {Metrologia},
   year = {2017},
   month = {10},
   volume = {54},
   number = {6},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {805-809},
   keywords = {optical fiber, optical frequency transfer},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa8a41},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calonico, D. and Mura, A. and Levi, F. and Clivati, C. and Tampellini, A.}
}

@Proceedings { GrandidierEBXFMDAHD2017,
   subid = {421},
   title = {Nano-probing station incorporating MEMS probes for 1D device RF on-wafer characterization},
   journal = {2017 47th European Microwave Conference (EuMC)},
   year = {2017},
   month = {10},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {MEMS GSG Probe, nano-prober, Nanowire, on-wafer, microwave},
   web_url = {https://hal.archives-ouvertes.fr/hal-01726555},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Nuremberg},
   event_name = {EuMC},
   event_date = {08-10-2017 to 12-10-2017},
   language = {30},
   DOI = {10.23919/EuMC.2017.8230973},
   stag_bib_extends_levelofaccess = {NA},
   author = {Grandidier, B. and Eliet, S. and Boyaval, C. and Xu, T. and Fellahi, A. El and Marzouk, J. and Daff{\'e}, K. and Arscott, S. and Haddadi, K. and Dambrine, G.}
}

@Proceedings { FritzschDSPH2017,
   subid = {530},
   title = {Impact of parasitic coupling on multiline TRL calibration},
   journal = {2017 47th European Microwave Conference (EuMC)},
   year = {2017},
   month = {10},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {835-838},
   keywords = {Measurements,  probes,  coupling,  parasitic  modes, em simulation},
   web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/impact-of-parasitic-coupling-on-multiline-trl-calibration-1},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Nuremberg},
   event_name = {2017 47th European Microwave Conference},
   event_date = {10-10-2017 to 12-10-2017},
   language = {30},
   DOI = {10.23919/EuMC.2017.8230974},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fritzsch, T. and Doerner, R.  and Schmuckle, F. J. and Phung, G. N. and Heinrich, W.}
}

@Proceedings { NelsonNHFSH2017,
   title = {Optical voltage sensor for MV networks},
   journal = {2017 IEEE SENSORS},
   year = {2017},
   month = {10},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {1-3},
   keywords = {Fiber  Bragg  grating,  optical  voltage  sensor,  power system instrumentation, electronic voltage transformer},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   event_place = {Glasgow, UK},
   event_name = {IEEE Sensors 2017},
   event_date = {30-10-2017 to 01-11-2017},
   language = {30},
   DOI = {10.1109/ICSENS.2017.8234104},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nelson, J. and Niewczas, P. and Havunen, J. and Fusiek, G. and Suomalainen, E-P. and H{\"a}llstr{\"o}m, J.}
}

@Proceedings { RietveldJPS2017,
   subid = {827},
   title = {PMU-based power system analysis of a medium-voltage distribution grid},
   journal = {CIRED - Open Access Proceedings Journal},
   year = {2017},
   month = {10},
   volume = {2017},
   number = {1},
   number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids},
   pages = {1927-1930},
   keywords = {phasor measurement, distribution networks, power grids, load flow, data acquisition},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Institution of Engineering and Technology (IET)},
   event_place = {Glasgow},
   event_name = {CIRED},
   event_date = {12-06-2017 to 15-06-2017},
   language = {30},
   ISSN = {2515-0855},
   DOI = {10.1049/oap-cired.2017.1035},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, G. and Jongepier, A. and Popov, M. and Save, N.}
}

@Thesis { Ged2017,
   subid = {1004},
   title = {Gloss Metrology : development and psychophysical characterization of gloss scales},
   year = {2017},
   month = {9},
   day = {26},
   number2 = {16NRM08: BiRD: Bidirectional reflectance definitions},
   keywords = {ConDOR, Goniospectrophotometry, Sol-Gel, BRDF, Psychometric scales, Gloss},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Conservatoire national des arts et m{\'e}tiers},
   address = {Paris},
   school = {Conservatoire national des arts et m{\'e}tiers},
   language = {37},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://tel.archives-ouvertes.fr/tel-01683126},
   author = {Ged, G.}
}

@Article { ShawWFZK2017,
   title = {Improving applied roughness measurement of involute helical gears},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {9},
   day = {20},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   keywords = {roughness measurement, gear surface texture, contact fatigue testing, involute gears, micro pitting},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa8dd6},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa8dd6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Shaw, B.A. and Wilson, S.J. and Frazer, R. and Zhang, J. and Koulin, G.}
}

@Article { KabrtSBMRW2017,
   title = {Production and characterization of a traceable NORM material and its use in proficiency testing of gamma-ray spectrometry laboratories},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {9},
   day = {18},
   volume = {134},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {45-50},
   keywords = {Environmental radioactivity; Gamma-ray spectrometry; NORM; Reference material; Intercomparison; Interlaboratory comparison; Proficiency testing; Quartz sand; Drinking water treatment; Natural radionuclides},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0969804317305158},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier},
   language = {30},
   DOI = {10.1016/j.apradiso.2017.09.025},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kabrt, F. and Stietka, M. and Baumgartner, A. and Maringer, F.J. and Riedl, J. and Wiedner, H.}
}

@Article { DeboliMCS2017,
   title = {Vineyard diseases detection: a case study on the influence of weather instruments' calibration and positioning},
   journal = {Meteorological Applications},
   year = {2017},
   month = {9},
   day = {15},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   keywords = {weather station; positioning; agriculture; calibration; uncertainty; Metrology for Meteorology},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/met.1685/epdf},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {1350-4827},
   DOI = {10.1002/met.1685},
   stag_bib_extends_levelofaccess = {NA},
   author = {Deboli, R. and Merlone, A. and Calvo, A. and Sanna, F.}
}

@Article { RiechelmannHEKGS2017,
   title = {The high-resolution extraterrestrial solar spectrum (QASUMEFTS) determined from ground-based solar irradiance measurements},
   journal = {Atmospheric Measurement Techniques},
   year = {2017},
   month = {9},
   day = {15},
   volume = {10},
   number = {9},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {3375-3383},
   keywords = {extraterrestrail spectrum, QASUMEFTS, QASUME},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-10-3375-2017},
   stag_bib_extends_levelofaccess = {NA},
   author = {Riechelmann, S. and H{\"u}lsen, G. and Egli, L. and Kr{\"o}ger, I. and Gr{\"o}bner, J. and Sperfeld, P.}
}

@Article { RobinsonIHG2017,
   title = {Field Validation of Remote Sensing Methane Emission Measurements},
   journal = {Remote Sensing},
   year = {2017},
   month = {9},
   day = {14},
   volume = {9},
   number = {9},
   number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions},
   pages = {956},
   keywords = {validation; emission measurements; DIAL; remote measurements; methane},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2072-4292},
   DOI = {10.3390/rs9090956},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, R. and Innocenti, F. and Helmore, J. and Gardiner, T.}
}

@Article { BosmaOP2017,
   title = {Effect of Pressure on Deep-Ocean Thermometers},
   journal = {International Journal of Thermophysics},
   year = {2017},
   month = {9},
   day = {13},
   volume = {38},
   number = {11},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   keywords = {Deep-ocean thermometers · Pressure effect · Thermistors},
   web_url = {https://link.springer.com/article/10.1007/s10765-017-2297-4},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-017-2297-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bosma, R. and Ober, S. and Peruzzi, A.}
}

@Article { SeguiniMLZIFDPRDB2017,
   subid = {480},
   title = {Influence of block copolymer feature size on reactive ion etching pattern transfer into silicon},
   journal = {Nanotechnology},
   year = {2017},
   month = {9},
   day = {12},
   volume = {28},
   number = {40},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {404001},
   keywords = {block copolymers, reactive ion etching, self-assembly, cryogenic RIE, holey silicon},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6528/aa8144},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-4484, 1361-6528},
   DOI = {10.1088/1361-6528/aa8144},
   stag_bib_extends_levelofaccess = {NA},
   author = {Seguini, G. and Martella, D. and Lamperti, A. and Zanenga, F. and Imbraguglio, D. and Ferrarese Lupi, F. and Dialameh, M. and Perego, M. and Rossi, A.M. and De Leo, N. and Boarino, L.}
}

@Article { RotellaCMMVIDLNRSN2017,
   title = {Elemental depth profiling in transparent conducting oxide thin film by X-ray reflectivity and grazing incidence X-ray fluorescence combined analysis},
   journal = {Spectrochimica Acta Part B: Atomic Spectroscopy},
   year = {2017},
   month = {9},
   volume = {135},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {22-28},
   keywords = {Combined >XRR-GIXRF, Depth profiling, thin films, TCO},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0584-8547},
   DOI = {10.1016/j.sab.2017.06.011},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rotella, H. and Caby, B. and M{\'e}nesguen, Y. and Mazel, Y. and Valla, A. and Ingerle, D. and Detlefs, B. and L{\'e}py, M.-C. and Novikova, A. and Rodriguez, G. and Streli, C. and Nolot, E.}
}

@Article { MoldersBHMRR2017,
   title = {Reproducibly emitting reference material on thermoplastic polyurethane basis for quality assurance/quality control of emission test chamber measurements},
   journal = {Building and Environment},
   year = {2017},
   month = {9},
   volume = {122},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   pages = {230-236},
   keywords = {Reference material, Emissions testing, Volatile Organic Compounds, Polymeric material, CO2 assisted impregnation},
   web_url = {https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/40646},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   address = {230 Park Avenue Suite 800 Shantae McGee 360 Park Avenue South New York NY 10169-0935 United States},
   language = {30},
   ISSN = {0360-1323},
   DOI = {10.1016/j.buildenv.2017.06.005},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\"o}lders, Nils and Br{\"o}dner, Doris and Horn, Wolfgang and Mull, Birte and Richter, Matthias and Renner, Manfred}
}

@Article { BrodnerHSSMR2017,
   title = {Reproducibly emitting reference materials for volatile and semi-volatile organic compounds—using finite element modeling for emission predictions},
   journal = {Air Quality, Atmosphere \& Health},
   year = {2017},
   month = {9},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   keywords = {Emitting reference material, Emission test chamber, Micro-chamber, FEM model},
   web_url = {https://link.springer.com/article/10.1007/s11869-017-0508-6},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1873-9318, 1873-9326},
   DOI = {10.1007/s11869-017-0508-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Br{\"o}dner, Doris and Horn, Wolfgang and Schultealbert, Caroline and Sauerwald, Tilman and Mull, Birte and Richter, Matthias}
}

@Article { BaduraRM2017,
   subid = {332},
   title = {An AC Power Standard for Loss Measurement Systems for Testing Power Transformers},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {9},
   volume = {66},
   number = {9},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   pages = {2225-2232},
   keywords = {Standards,  Current measurement,  Calibration,  Current transformers,  Voltage measurement,  Power transformers,  Loss measurement},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2698678},
   stag_bib_extends_levelofaccess = {NA},
   author = {Badura, H. and Rather, P. and Mohns, E.}
}

@Article { FailleauHHPSRBZARGVSSKSPLG2017,
   title = {Metrology for decommissioning nuclear facilities: Partial outcomes of joint research project within the European Metrology Research Program},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {9},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   keywords = {Decommissioning, Sample preparation, Metrology},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.08.032},
   stag_bib_extends_levelofaccess = {NA},
   author = {Failleau, G. and Hay, B. and Holm, P. and Per{\"a}j{\"a}rvi, K. and Sand, J. and Rogiers, B. and Boden, S. and Zapata-Garc{\'i}a, D. and Arnold, D. and Russell, B. and Garcia Miranda, M. and Van Ammel, R. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Plumeri, S. and Laurent Beck, Y. and Grisa, T.}
}

@Article { BogucarskaPdJASSSKSTv2017,
   title = {New high-throughput measurement systems for radioactive wastes segregation and free release},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {9},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   keywords = {nuclear decommissioning, radioactive waste, free release, clearance level},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.09.043},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bogucarska, T. and Pedersen, B. and De Felice, P. and Jerome, S. and Arnold, D. and Skala, L. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Tzika, F. and Van Ammel, R.}
}

@Article { AntonanzasTorresGPLRTHKGU2017,
   title = {Extensive validation of CM SAF surface radiation products over Europe},
   journal = {Remote Sensing of Environment},
   year = {2017},
   month = {9},
   volume = {199},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {171-186},
   keywords = {Satellite-based models, Global horizontal irradiance, CM SAF, Solar radiation data, Pyranometer},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0034-4257},
   DOI = {10.1016/j.rse.2017.07.013},
   stag_bib_extends_levelofaccess = {NA},
   author = {Antonanzas-Torres, F. and Gottschalg, R. and Palmer, D. and Lindfors, A. and Riihel{\"a}, A. and Trentmann, J. and Huld, T. and Koubli, E. and Gracia-Amillo, A.M. and Urraca, R.}
}

@Article { MullejansWPKG2017,
   title = {Traceable spectral irradiance measurements in photovoltaics: Results of the PTB and JRC spectroradiometer comparison using different light sources},
   journal = {Measurement},
   year = {2017},
   month = {9},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   keywords = {Spectroradiometer, Spectral irradiance, Intercomparison, Calibration traceability, Solar simulator, Spectral responsivity},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2017.09.007},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\"u}llejans, H. and Winter, S. and Plag, F. and Kr{\"o}ger, I. and Galleano, R.}
}

@Proceedings { ClarksonCHRS2017,
   title = {Validation of Algorithms to Estimate Distribution Network Characteristics Using Power-Hardware-in-the-Loop Configuration},
   journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2017},
   month = {9},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   keywords = {Network topology, Topology, Substations, Estimation, Current measurement, voltage measurement, Load flow},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   event_place = {Liverpool, United Kingdom},
   event_name = {Applied Measurements for Power Systems},
   event_date = {20-09-2017 to 22-09-2017},
   language = {30},
   ISBN = {978-1-5386-0343-7},
   ISSN = {2475-2304},
   DOI = {10.1109/AMPS.2017.8078349},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clarkson, P. and Chretien, S. and Hong, Q. and Rohouma, I. and Segovia, M.}
}

@Proceedings { PousOAS2017,
   subid = {434},
   title = {Robust extreme value estimation for full time-domain EMI measurements},
   journal = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2017},
   month = {9},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {1-6},
   keywords = {Statistical signal processing, Extreme value estimation, Electromagnetic interference, Electromagneticmeasurements, Time-domain analysis},
   web_url = {https://upcommons.upc.edu/handle/2117/116880},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   address = {445 Hoes Lane Piscataway NJ 08855-1331 United States},
   event_place = {Angers, France},
   event_name = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   event_date = {04-09-2017 to 07-09-2017},
   language = {30},
   ISBN = {978-1-5386-0689-6},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2017.8094729},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pous, Marc and Oliva, Jose A. and Azp{\'u}rua, Marco A. and Silva, Ferran}
}

@Proceedings { PousAS2017,
   subid = {433},
   title = {APD oudoors time-domain measurements for impulsive noise characterization},
   journal = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2017},
   month = {9},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {1-6},
   keywords = {Amplitude Probability Distribution, Impulsive noise, In-situ measurements, Electromagnetic interference, Electromagnetic measurements, Time-domain analysis},
   web_url = {https://upcommons.upc.edu/handle/2117/116885},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   event_place = {Angers, France},
   event_name = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   event_date = {04-09-2017 to 07-09-2017},
   language = {30},
   ISBN = {978-1-5386-0689-6},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2017.8094786},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pous, M. and Azpurua, M.A. and Silva, F.}
}

@Article { AgustoniFHCMMA2017,
   title = {Calibration of Commercial Test Sets for Non-Conventional Instrument Transformers},
   journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2017},
   month = {9},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {19-24},
   keywords = {Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measurement standards},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/AMPS.2017.8078324},
   stag_bib_extends_levelofaccess = {NA},
   author = {Agustoni, M. and Fricke, S. and Houtzager, E. and \c{C}aycı, H. and Mortara, A. and Mohns, E. and Ayhan, B.}
}

@Proceedings { CakirS2017,
   subid = {598},
   title = {Loop antenna calibrations with inclusion of vector network analyser and comparison between calibration methods},
   journal = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2017},
   month = {9},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {1-5},
   keywords = {Calibration, Comparison, Loop Antenna, Network Analyser, Three Antenna},
   web_url = {http://rfmw.cmi.cz/documents/papers/Sen_EMCEurope2017_OA.pdf},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   event_place = {Angers, France},
   event_name = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   event_date = {04-09-2017 to 07-09-2017},
   language = {30},
   ISBN = {978-1-5386-0689-6},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2017.8094694},
   stag_bib_extends_levelofaccess = {NA},
   author = {\c{C}akır, S. and Şen, O.}
}

@Proceedings { KirkhamLMDRM2017,
   subid = {859},
   title = {The Case for Redefinition of Frequency and ROCOF to Account for AC Power System Phase Steps},
   journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2017},
   month = {9},
   number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids},
   keywords = {Phasor measurement units, frequency control, circuit faults, relays, time-frequency analysis, time measurement},
   web_url = {https://strathprints.strath.ac.uk/61522/},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {IEEE},
   event_place = {Liverpool, United Kingdom},
   event_name = {Applied Measurements for Power Systems},
   event_date = {20-09-2017 to 22-09-2017},
   language = {30},
   ISBN = {978-1-5386-0343-7},
   ISSN = {2475-2304},
   DOI = {10.1109/AMPS.2017.8078330},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kirkham, H. and Lee, M. and Marshall, B. and Dysko, A. and Roscoe, A.J. and Morton, A.}
}

@Proceedings { SauerwaldPKGS2017,
   title = {Performance Evaluation of Low-Cost BTEX Sensors and Devices within the EURAMET Key-VOCs Project},
   journal = {Proceedings},
   year = {2017},
   month = {8},
   day = {29},
   volume = {1},
   number = {4},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   pages = {425},
   keywords = {PID based sensors, semiconductor and amperometric sensor, mini GC, portable on-line measuring devices, benzene, volatile organic compounds},
   web_url = {http://www.mdpi.com/2504-3900/1/4/425},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {MDPI AG},
   event_place = {Paris},
   event_name = {Eurosensors2017},
   event_date = {03-09-2017 to 06-09-2017},
   language = {30},
   ISSN = {2504-3900},
   DOI = {10.3390/proceedings1040425},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sauerwald, T. and Persijn, S. and Kok, G. and Gerboles, M. and Spinelle, L.}
}

@Article { ChoiGIBFBGRPH2017,
   title = {Effect of Handling, Packing and Transportation on the Moisture of Timber Wood},
   journal = {International Journal of Thermophysics},
   year = {2017},
   month = {8},
   day = {29},
   volume = {38},
   number = {10},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   keywords = {Effect of ambient humidity, Moisture content, Timber wood,Transportation, Wood handling},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-017-2292-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Choi, B.I. and Gelil, D.A.E. and Ismail, N. and Beltramino, G. and Fernicola, V. and Ben Ayoub, M.W. and Georgin, E. and Rudolfov{\'a}, M. and Palkova, Z. and Heinonen, M.}
}

@Proceedings { HoutzagerR2017,
   subid = {466},
   title = {High-accuracy reference setup for system calibration of transformer loss measurement systems},
   journal = {e-cigre.org},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {Transformer loss, reference measuring system,},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International symposium on high-voltage engineering 2017},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_610-high-accuracy-reference-setup-for-system-calibration-of-transformer-loss-measurement-systems},
   author = {Houtzager, E. and Rietveld, G.}
}

@Proceedings { ZhouLLHBEK2017,
   subid = {463},
   title = {Measurement of the Internal Inductance of Impulse Voltage Generators and the Limits of LI Front Times.},
   journal = {e-cigre.org},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {lightning impulse, time parameters, front time, impulse generator},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International conference on high-voltage engineering 2017},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_569-measurement-of-the-internal-inductance-of-impulse-voltage-generators-and-the-limits-of-li-front-times},
   author = {Zhou, L. and Li, Y. and Larzelere, W. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Elg, A.P. and Kl{\"u}ss, J.}
}

@Proceedings { HallstromBNEMP2017,
   subid = {460},
   title = {Characterization of a fast step generator},
   journal = {e-cigre.org},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {Step response, impulse measurment, lightning impulse},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International symposium on high-voltage engineering},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_484-characterization-of-a-fast-step-generator},
   author = {H{\"a}llstr{\"o}m, J. and Bergman, A. and  Nordlund, M. and Elg, A.P. and Meisner, J. and Passon, S.}
}

@Proceedings { HilbertSKMP2017,
   subid = {464},
   title = {PTB’s new standard impulse voltage divider for traceable calibrations up to 1 MV},
   journal = {e-cigre.org},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {reference measuring system, lightning impulse,},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International symposium on high-voltage engineering 2017},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_415-ptbs-new-standard-impulse-voltage-divider-for-traceable-calibrations-up-to-1-mv},
   author = {Hilbert, M. and Schierding, C. and Kurrat, M. and Meisner, J. and Passon, S.}
}

@Proceedings { BergmanN2017,
   subid = {467},
   title = {Characterisation at low voltage of two reference lightning impulse generators},
   journal = {e-cigre.org},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {lightning impulse, reference measuring system, calibration},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International symposium on high-voltage engineering 2017},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_485-characterisation-at-low-voltage-of-two-reference-lightning-impulse-dividers},
   author = {Bergman, A. and Nordlund, M.}
}

@Proceedings { BergmanNEHMH2017,
   subid = {461},
   title = {Influence of coaxial cable on response of high voltage resistive dividers},
   journal = {e-cigre.org},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {Lightning impulse, pulse response, front time},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International symposium on high-voltage engineering 2017},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_487-influence-of-coaxial-cable-on-response-of-high-voltage-resistive-dividers},
   author = {Bergman, A. and Nordlund, M. and Elg, A.P. and  Havunen, J. and Meisner, J. and H{\"a}llstr{\"o}m, J.}
}

@Proceedings { HallstromHPK2017,
   subid = {459},
   title = {Design and performance of a fast divider for puncture testing},
   journal = {e-cigre.org},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {Puncture testing, very fast transient},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International symposium on high voltage engineering 2017},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_470-design-and-performance-of-a-fast-divider-for-puncture-testing},
   author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Pyk{\"a}l{\"a}, M.L. and Kazmi, S.}
}

@Proceedings { ElgHB2017,
   subid = {462},
   title = {Evaluation of step response of transient recorders for lightning impulse},
   journal = {e-cigre.org},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {Step response, lightning impulse, transient recorder},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International symposium on high-voltage engineering 2017},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_488-evaluation-of-step-response-of-transient-recorders-for-lightning-impulse},
   author = {Elg, A.P. and H{\"a}llstr{\"o}m, J. and Bergman, A.}
}

@Proceedings { HavunenHBB2017,
   subid = {458},
   title = {Using Deconvolution for Correction of Non-Ideal Step Response of Lightning Impulse Digitizers and Measurement Systems},
   journal = {e-cigre},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {Lightning impulse, Deconvolution},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International symposium on high voltage engineering 2017},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_381-using-deconvolution-for-correction-of-non-ideal-step-response-of-lightning-impulse-digitizers-and-measurement-systems},
   author = { Havunen, J. and H{\"a}llstr{\"o}m, J. and Bergman, A.E. and Bergman, A.}
}

@Article { FengPF2017,
   title = {A microscopy approach for in situ inspection of micro-coordinate measurement machine styli for contamination},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {8},
   day = {21},
   volume = {28},
   number = {9},
   number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products},
   pages = {095010},
   keywords = {µCMM, stylus inspection, contamination, microscopy, focus stacking},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa7c93},
   stag_bib_extends_levelofaccess = {NA},
   author = {Feng, X. and Pascal, J. and Feng, X.}
}

@Article { NiederhauserLAGP2017,
   title = {Two generators to produce SI-traceable reference gas mixtures for reactive compounds at atmospheric levels},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {8},
   day = {18},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   keywords = {reference gas mixture, permeation, dynamic dilution, matrix gas, metrological traceability, uncertainty},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa870c},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa870c},
   stag_bib_extends_levelofaccess = {NA},
   author = {Niederhauser, B.C. and Leuenberger, D. and Ackermann, A. and Guillevic, M. and Pascale, C.}
}

@Article { GrigoryevaGUTTKHAWKS2017,
   subid = {1175},
   title = {Thermodynamic Temperature of High-Temperature Fixed Points Traceable to Blackbody Radiation and Synchrotron Radiation},
   journal = {International Journal of Thermophysics},
   year = {2017},
   month = {8},
   day = {16},
   volume = {38},
   number = {10},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   keywords = {Absolute radiometry, Blackbody radiation, Cryogenic substitution radiometer, Filter radiometer, High-temperature fixed points, Irradiance mode, Primary radiation standards, Ratio radiometry, Synchrotron radiation, Thermodynamic temperature},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-017-2273-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Grigoryeva, I. and Gavrilov, V. and Ulm, G. and Thornagel, R. and Taubert, R. D. and Klein, R. and Hollandt, J. and Anhalt, K. and W{\"a}hmer, M. and Khlevnoy, B. and Sapritsky, V.}
}

@Article { ZhaovH2017,
   subid = {1189},
   title = {Mitigating voltage lead errors of an AC Josephson voltage standard by impedance matching},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {8},
   day = {16},
   volume = {28},
   number = {9},
   number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages},
   pages = {095004},
   keywords = {AC Josephson voltage standard, impedance matching, simulation, error sources,uncertainty},
   web_url = {https://zenodo.org/record/3265687\#.XWZRsuhKgdW},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa7aba},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhao, D. and van den Brom, H.E. and Houtzager, E.}
}

@Article { DegiovanniAPRLVTGBCVG2017,
   subid = {334},
   title = {Determining the quantum expectation value by measuring a single photon},
   journal = {Nature Physics},
   year = {2017},
   month = {8},
   day = {14},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {4},
   keywords = {Protective Measurements, Weak Measurements},
   web_url = {https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf;},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1745-2473, 1745-2481},
   DOI = {10.1038/nphys4223},
   stag_bib_extends_levelofaccess = {NA},
   author = {Degiovanni, I.P. and Avella, A. and Piacentini, F. and Rebufello, E. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Genovese, M.}
}

@Article { SuterSSPOMKHGFBAKLWS2017,
   title = {The CLARA/NORSAT-1 solar absolute radiometer: instrument design, characterization and calibration},
   journal = {Metrologia},
   year = {2017},
   month = {8},
   day = {10},
   volume = {54},
   number = {5},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {674-682},
   keywords = {solar irradiance, satellite measurements, electrical substitution radiometer, cavity detector, sun},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa7a63},
   stag_bib_extends_levelofaccess = {NA},
   author = {Suter, M. and Spescha, M. and Soder, R. and Pfiffner, D, and Oliva, A.R. and Mingard, N. and Koller, S. and Heuerman, K. and Gyo, M. and Finsterle, W. and Beck, I. and Andersen, B. and Kopp, G. and Levesque, P.L. and Walter, B. and Schmutz, W.}
}

@Article { KiriakopoulosLCMXGP2017,
   title = {Response Of The Greek Early Warning System Reuter-Stokes Ionization Chambers To Terrestrial And Cosmic Radiation Evaluated In Comparison With Spectroscopic Data And Time Series Analysis},
   journal = {Radiation Protection Dosimetry},
   year = {2017},
   month = {8},
   day = {10},
   volume = {178},
   number = {3},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {276-287},
   keywords = {detector response, cosmic radiation, spectroscopy, time series},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Oxford University Press (OUP)},
   language = {30},
   ISSN = {0144-8420, 1742-3406},
   DOI = {10.1093/rpd/ncx107},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kiriakopoulos, E and LEONTARIS, F and CLOUVAS, A and Maltezos, A and XANTHOS, S and Guilhot, J and Potiriadis, C}
}

@Article { GuardamagnaLINCRCS2017,
   title = {Accurate particle speed prediction by improved particle speed measurement and 3-dimensional particle size and shape characterization technique},
   journal = {Powder Technology},
   year = {2017},
   month = {8},
   volume = {318},
   number = {2017},
   number2 = {IND61: Metrosion: Metrology to enable high temperature erosion testing},
   pages = {95-109},
   keywords = {Computed tomography, Particle shape, Particle size, Particle velocity, Shadow imaging, Sphericity},
   web_url = {http://findit.dtu.dk/en/catalog/2363396961\&\#10;http://www.sciencedirect.com/science/article/pii/S0032591017304412},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0032-5910},
   DOI = {10.1016/j.powtec.2017.05.042},
   stag_bib_extends_levelofaccess = {NA},
   author = {Guardamagna, C. and Lorenzoni, L. and Illemann, J. and Neuschaefer-Rube, U. and Clausen, S. and Rothleitner, C. and Cernuschi, F. and Skinner, E.}
}

@Article { KazakovaVGPW2017,
   subid = {253},
   title = {Switchable bi-stable multilayer magnetic probes for imaging of soft magnetic structures},
   journal = {Ultramicroscopy},
   year = {2017},
   month = {8},
   volume = {179},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {41-46},
   keywords = {MFM, Scanning probe microscopy, Magnetic probes},
   web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/switchable-bistable-multilayer-magnetic-probes-for-imaging-of-soft-magnetic-structures(bede017b-82d6-43e7-9d40-e7ef7817e0fb).html},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0304-3991},
   DOI = {10.1016/j.ultramic.2017.03.032},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazakova, O. and Vdovichev, S. and Gribkov, B. and Puttock, R. and Wren, T.}
}

@Article { LodewyckTBEBV2017,
   subid = {400},
   title = {A noise-immune cavity-assisted non-destructive detection for an optical lattice clock in the quantum regime},
   journal = {New Journal of Physics},
   year = {2017},
   month = {8},
   volume = {19},
   number = {8},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {083002},
   keywords = {optical clock, frequency stability, optical lattice clock, non-destructive detection, spin squeezing},
   web_url = {http://iopscience.iop.org/1367-2630/19/8/083002},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/aa7c84},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lodewyck, J. and Targat, R.L. and Bilicki, S. and Eismann, U. and Bookjans, E. and Vallet, G.}
}

@Article { WershofenZ2017,
   title = {Development of radiochemical analysis strategies for decommissioning activities},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {8},
   volume = {126},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   pages = {204-207},
   keywords = {Decommissioning, Extraction chromatography, Radiochemical analysis, Concrete, Steel, Graphite},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0969804316307424},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.02.038},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wershofen, H. and Zapata-Garc{\'i}a, D.}
}

@Article { GrisaSKS2017,
   title = {Monte Carlo optimization of shielding for novel industrial free release measurement facility},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {8},
   volume = {126},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   pages = {73-75},
   keywords = {Decommissioning, Free release measurement, Monte Carlo simulations, Low level activity measurement},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0969804316305322?via\%3Dihub},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2016.12.032},
   stag_bib_extends_levelofaccess = {NA},
   author = {Grisa, T. and Šur{\'a}ň, J. and Kov{\'a}ř, P. and Solc, J.}
}

@Article { CapogniDS2017,
   title = {Efficiency transfer method applied to surface beta contamination measurements},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {8},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   keywords = {Efficiency transfer method, Calibration, Surface contamination measurement},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.08.009},
   stag_bib_extends_levelofaccess = {NA},
   author = {Capogni, M. and De Felice, P. and Stanga, D.}
}

@Article { StangaSBG2017,
   title = {Determination of the neutron activation profile of core drill samples by gamma-ray spectrometry},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {8},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   keywords = {Gamma spectrometry, Activity profile, Core sample, Concrete activation},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.08.004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stanga, D. and Sima, O. and Boden, S. and Gurau, D.}
}

@Article { NeuVSMSRGCPK2017,
   subid = {581},
   title = {Calibration of multi-layered probes with low/high magnetic moments},
   journal = {Scientific Reports},
   year = {2017},
   month = {8},
   volume = {7},
   number = {1},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {7224},
   keywords = {Magnetic straz field, Magnetic force microscopy, multi-layered probe, Hall sensor.},
   web_url = {https://www.nature.com/articles/s41598-017-07327-0},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-07327-0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Neu, V. and Vock, S. and Simonetto, E. and Manzin, A. and Snoeck, E. and Rodriguez, L.A. and Gribkov, B. and Corte-Le{\'o}n, H. and Panchal, V. and Kazakova, O.}
}

@Article { GreilichKBKBSSP2017,
   subid = {601},
   title = {Radiation dosimetry in magnetic fields with Farmer-type ionization chambers: determination of magnetic field correction factors for different magnetic field strengths and field orientations},
   journal = {Physics in Medicine \& Biology},
   year = {2017},
   month = {8},
   volume = {62},
   number = {16},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {6708-6728},
   keywords = {Dosimetry, MRgRT, Radiotherapy, Magnetic fields},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aa7ae4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Greilich, S and Karger, C P and Burigo, L and Kawrakow, I and Bakenecker, A and Schrenk, O and Spindeldreier, C K and Pfaffenberger, A}
}

@Article { MarouliVPL2017,
   title = {Photon emission intensities in the decay of U-235},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {8},
   volume = {126},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {150-153},
   keywords = {U-235, Th-231, Photon emission intensities, NORM},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2016.12.045},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marouli, M. and Van Ammel, R. and Pierre, S. and L{\'e}py, M.C.}
}

@Article { KeightleyBPVPBGW2017,
   title = {Compact radioactive aerosol monitoring device for early warning networks},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {8},
   volume = {126},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {219-224},
   keywords = {Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2016.12.036},
   stag_bib_extends_levelofaccess = {NA},
   author = {Keightley, L. and Bell, S.J. and Ponikvar, D. and Vencelj, M. and Petrovič, T. and Brodnik, D. and Glavič-Cindro, D. and Woods, S.}
}

@Article { StrohMHSSCSLT2017,
   title = {A low-energy set-up for gamma-ray spectrometry of NORM tailored to the needs of a secondary smelting facility},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {8},
   volume = {126},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {296-299},
   keywords = {210Pb, 210Po, Metallurgy, Industry, Gamma-ray spectrometry, Naturally occurring radionuclides},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2016.12.048},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stroh, H. and Marissens, G. and Hult, M. and Schreurs, S. and Schroeyers, W. and Croymans, T. and Schreurs, I.V. and Lutter, G. and Tzika, F.}
}

@Article { VandervorstMAFDKBV2017,
   subid = {565},
   title = {Atom probe tomography analysis of SiGe fins embedded in SiO 2 : Facts and artefacts},
   journal = {Ultramicroscopy},
   year = {2017},
   month = {8},
   volume = {179},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {100-107},
   keywords = {Atom probe tomography, Tip shape, FinFET, Local magnification, Trajectory overlaps},
   web_url = {https://lirias2repo.kuleuven.be/rest/bitstreams/515063/retrieve},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0304-3991},
   DOI = {10.1016/j.ultramic.2017.04.006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vandervorst, W. and Melkonyan, D. and Arnoldi, L. and Fleischmann, C. and Demeulemeester, J. and Kumar, A. and Bogdanowicz, J. and Vurpillot, F.}
}

@Article { LecuelleMLDMFOFB2017,
   subid = {897},
   title = {In vivo XCT bone characterization of lattice structured implants fabricated by additive manufacturing},
   journal = {Heliyon},
   year = {2017},
   month = {8},
   volume = {3},
   number = {8},
   number2 = {15HLT09: MetAMMI: Metrology for additively manufactured medical implants},
   pages = {e00374},
   keywords = {Bioengineering; Biomedical engineering; Dentistry; Materials science; Medical imaging},
   web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5669606/},
   misc2 = {EMPIR 2015: Health},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2405-8440},
   DOI = {10.1016/j.heliyon.2017.e00374},
   stag_bib_extends_levelofaccess = {NA},
   author = {L{\'e}cuelle, B. and Mah{\'e}, E. and L{\'e}onard, F. and Djema{\"i}, M. and Meinel, D. and Fain, J. and Obaton, A.F. and Fouchet, J.J. and Bruno, G.}
}

@Article { DuaneFSBGSBR2017,
   subid = {429},
   title = {Reply to Comment on ‘Development of a primary standard for absorbed dose from unsealed radionuclide solutions’},
   journal = {Metrologia},
   year = {2017},
   month = {7},
   day = {27},
   volume = {54},
   number = {4},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   pages = {615-616},
   keywords = {dosimetry, radionuclide solution, extrapolation chamber, primary standard,validation of dose calculation},
   web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa78ff/meta},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa78ff},
   stag_bib_extends_levelofaccess = {NA},
   author = {Duane, S and Fenwick, A and Sander, T and Bass, G and Galer, S and Shipley, D and Billas, I and Robinson, A.}
}

@Article { SuEL2017,
   subid = {418},
   title = {High-precision lateral distortion measurement and correction in coherence scanning interferometry using an arbitrary surface},
   journal = {Optics Express},
   year = {2017},
   month = {7},
   day = {25},
   volume = {25},
   number = {16},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {18703},
   keywords = {Image processing, Pattern recognition, Imaging systems, Metrology, Calibration, Microscopy},
   web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-25-16-18703},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {The Optical Society of America},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.25.018703},
   stag_bib_extends_levelofaccess = {NA},
   author = {Su, R. and Ekberg, P. and Leach, R.}
}

@Article { BoudotdYTCBA2017,
   title = {High-contrast sub-Doppler absorption spikes in a hot atomic vapor cell exposed to a dual-frequency laser field},
   journal = {New Journal of Physics},
   year = {2017},
   month = {7},
   day = {25},
   volume = {19},
   number = {7},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   pages = {073028},
   keywords = {Counterpropagating light waves, saturation spectroscopy,  dark resonances, diode-lasers; d-1 line, d1 line, d2 line},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/aa7258},
   stag_bib_extends_levelofaccess = {NA},
   author = {Boudot, R. and de Clercq, E. and Yudin, V. and Taichenachev, A. and Coget, G. and Brazhnikov, D. and Abdel Hafiz, M.}
}

@Article { HenriksenCST2017,
   subid = {404},
   title = {Dynamics of bad-cavity-enhanced interaction with cold Sr atoms for laser stabilization},
   journal = {Physical Review A},
   year = {2017},
   month = {7},
   day = {24},
   volume = {96},
   number = {1},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {013847},
   keywords = {laser stabilisation, atom-cavity dynamics},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   address = {1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.96.013847},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/pdf/1704.08245.pdf},
   author = {Henriksen, M. R. and Christensen, B. T. R. and Sch{\"a}ffer, S. A. and Thomsen, J. W.}
}

@Article { IkonenAPPK2017,
   subid = {416},
   title = {Fisheye camera method for spatial non-uniformity corrections in luminous flux measurements with integrating spheres},
   journal = {Metrologia},
   year = {2017},
   month = {7},
   day = {24},
   volume = {54},
   number = {4},
   number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products},
   pages = {577-583},
   keywords = {fisheye camera, integrating sphere, luminous flux, spatial correction, angular intensity distribution, photometry, measurement uncertainty},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa7cb7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ikonen, E. and Askola, J. and Poikonen, T. and Pulli, T. and Kokka, A.}
}

@Article { AntonovSMKCK2017,
   subid = {583},
   title = {Hybrid normal metal/ferromagnetic nanojunctions for domain wall tracking},
   journal = {Scientific Reports},
   year = {2017},
   month = {7},
   day = {24},
   volume = {7},
   number = {1},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {6295},
   keywords = {domain wall, magnetoresistance, permalloy},
   web_url = {https://www.nature.com/articles/s41598-017-06292-y.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-06292-y},
   stag_bib_extends_levelofaccess = {NA},
   author = {Antonov, V. and Schumacher, H.W. and Manzin, A. and Krzysteczko, P. and Corte-Le{\'o}n, H. and Kazakova, O.}
}

@Thesis { LecunaTovar2017,
   title = {Scale down of a dynamic generator of VOC reference gas mixtures},
   year = {2017},
   month = {7},
   day = {22},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   keywords = {VOC, Dynamic generation, gas mixtures, metrology, reference material, portable device},
   web_url = {http://porto.polito.it/2676926/},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Politecnico di Torino},
   school = {Politecnico di Torino},
   language = {30},
   DOI = {10.6092/polito/porto/2676926},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lecuna Tovar, M}
}

@Article { RajteriTF2017,
   title = {LEDs: Sources and Intrinsically Bandwidth-Limited Detectors},
   journal = {Sensors},
   year = {2017},
   month = {7},
   day = {20},
   volume = {17},
   number = {7},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {1673},
   keywords = {LED; light emitting diode; photodetector; radiometer; LED detector},
   web_url = {http://www.mdpi.com/1424-8220/17/7/1673},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s17071673},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rajteri, M. and Taralli, E. and Filippo, R.}
}

@Article { JohanssonHCTMGNM2017,
   subid = {885},
   title = {In-line characterization of nanostructured mass-produced polymer components using scatterometry},
   journal = {Journal of Micromechanics and Microengineering},
   year = {2017},
   month = {7},
   day = {20},
   volume = {27},
   number = {8},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {085004},
   keywords = {Scatterometry, nanostructures, atomic force, scanning electron microscopy, metrology,},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0960-1317, 1361-6439},
   DOI = {10.1088/1361-6439/aa7a3a},
   stag_bib_extends_levelofaccess = {NA},
   author = {Johansson, A. and Hansen, P.E. and Czolkos, I. and Thamdrup, L.H. and Madsen, J.S. and Garnaes, J. and Nyg{\aa}rd, J. and Madsen, M.H.}
}

@Article { MantynenVKMI2017,
   title = {Method for estimating effects of unknown correlations in spectral irradiance data on uncertainties of spectrally integrated colorimetric quantities},
   journal = {Metrologia},
   year = {2017},
   month = {7},
   day = {18},
   volume = {54},
   number = {4},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {524-534},
   keywords = {uncertainty, color temperature, color coordinates, Monte Carlo, spectral irradiance},
   web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa7b39/meta},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa7b39},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\"a}ntynen, H. and Vaskuri, A and K{\"a}rh{\"a}, P. and Mikkonen, N. and Ikonen, E.}
}

@Article { LindstromdPSSGP2005_2,
   title = {Multiplexing Superconducting Qubit Circuit for Single Microwave Photon Generation},
   journal = {Journal of Low Temperature Physics},
   year = {2017},
   month = {7},
   day = {17},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   pages = {1-16},
   keywords = {superconducting qubit, transmon, superconducting resonator, single photon generation},
   web_url = {http://link.springer.com/article/10.1007/s10909-017-1787-x},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Springer Verlag GmbH},
   language = {30},
   DOI = {10.1007/s10909-017-1787-x},
   stag_bib_extends_levelofaccess = {NA},
   author = {George, R. E. and Senior, J. and Saira, O.-P. and Pekola, J. P. and de Graaf, S. E. and Lindstrom, T. and Pashkin, Y. A.}
}

@Proceedings { AcakCS2017,
   subid = {201},
   title = {More insight into conducted immunity tests and investigation of support influences},
   journal = {2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)},
   year = {2017},
   month = {7},
   day = {13},
   volume = {2017},
   number = {2017},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {124-126},
   keywords = {CDN, Conducted Immunity, EMC, Loop Impedance, Support},
   web_url = {http://rfmw.cmi.cz/documents/papers/Sen_APEMC2017_OA.pdf},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   event_place = {Seoul},
   event_name = {2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)},
   event_date = {20-06-2017 to 23-06-2017},
   language = {30},
   DOI = {10.1109/APEMC.2017.7975442},
   stag_bib_extends_levelofaccess = {NA},
   author = {Acak, S. and \c{C}akır, S. and Şen, O.}
}

@Article { OzturkUH2017,
   title = {Development of Measurement and Extraction Technique of Complex Permittivity Using Transmission Parameter S21 for Millimeter Wave Frequencies},
   journal = {Journal of Infrared, Millimeter, and Terahertz Waves},
   year = {2017},
   month = {7},
   day = {13},
   volume = {38},
   number = {12},
   number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security},
   pages = {1510-1520},
   keywords = {Complex permittivity, Material characterization, Newton-Raphson technique, Quasi-optical free space measurement},
   web_url = {https://doi.org/10.1007/s10762-017-0421-y},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1866-6892, 1866-6906},
   DOI = {10.1007/s10762-017-0421-y},
   stag_bib_extends_levelofaccess = {NA},
   author = {{\"O}zt{\"u}rk, T. and Uluer, I. and Hudlicka, M.}
}

@Article { FrazerESJCS2017,
   title = {Effects of profile errors on lubrication performance of helical gears},
   journal = {Tribology International},
   year = {2017},
   month = {7},
   volume = {111},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   pages = {184-191},
   keywords = {gears, lubrication, profile errors, EHL},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0301679X17300944?via\%3Dihub},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0301-679X},
   DOI = {10.1016/j.triboint.2017.02.034},
   stag_bib_extends_levelofaccess = {NA},
   author = {Frazer, R. and Evans, H.P. and Sharif, K.J. and Jamali, H.U. and Clarke, A. and Shaw, B.}
}

@Article { MasowskiLCCBAPMNNlLKBKMZCPBT2017,
   subid = {402},
   title = {Fibre-optic delivery of time and frequency to VLBI station},
   journal = {Astronomy \& Astrophysics},
   year = {2017},
   month = {7},
   volume = {603},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {A48},
   keywords = {high angular resolution instrumentation, interferometers},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {EDP Sciences},
   language = {30},
   ISSN = {0004-6361, 1432-0746},
   DOI = {10.1051/0004-6361/201730615},
   stag_bib_extends_levelofaccess = {NA},
   author = {Masłowski, P. and Lisak, D. and Cygan, A. and Ciuryło, R. and Bober, M. and Ablewski, P. and Pazderski, E. and Marecki, A. and Nogaś, P. and Nawrocki, J. and Śliwczyński, Ł. and Lipiński, M. and Kołodziej, J. and Buczek, L. and Krehlik, P. and Morzyński, P. and Zawada, M. and Campbell, R. M. and Pieczerak, J. and Binczewski, A. and Turza, K.}
}

@Article { ClarksonGDC2017,
   title = {On the pinning controllability of complex networks using perturbation theory of extreme singular values. Application to  synchronisation in power grids},
   journal = {Numerical Algebra, Control and Optimization},
   year = {2017},
   month = {7},
   volume = {7},
   number = {3},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   pages = {289-299},
   keywords = {Networks, Power grids},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {American Institute of Mathematical Sciences (AIMS)},
   language = {30},
   ISSN = {2155-3289},
   DOI = {10.3934/naco.2017019},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clarkson, P. and Guyeux , C. and Darses, S. and Chretien, S.}
}

@Proceedings { CamisardPLACWQCS2017,
   subid = {445},
   title = {Progress on the REFIMEVE+ project for optical frequency standard dissemination},
   journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)},
   year = {2017},
   month = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {optical fiber, optical frequency transfer},
   web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf},
   web_url2 = {https://www.eftf.org/previous-meetings/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Besan\c{c}on, France},
   event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium},
   event_date = {10-07-2017 to 13-07-2017},
   language = {30},
   DOI = {10.1109/FCS.2017.8088897},
   stag_bib_extends_levelofaccess = {NA},
   author = {Camisard, E. and Pottie, P.E. and Lopez, O. and Amy-Klein, A. and Chardonnet, C. and Wiotte, F. and Quintin, N. and Cantin, E. and Santarelli, G.}
}

@Article { LopezLSPXA2017,
   subid = {440},
   title = {Hybrid optical link for ultra-stable frequency comparison},
   journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)},
   year = {2017},
   month = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {optical fiber, optical frequency transfer},
   web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/FCS.2017.8088833},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lopez, O. and Lee, W.K. and Stefani, F. and Pottie, P.E. and Xu, D. and Amy-Klein, A.}
}

@Proceedings { LeCoqANDTAALTSLXLP2017,
   subid = {446},
   title = {Frequency comb-assisted QCL stabilization for high resolution molecular spectroscopy},
   journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)},
   year = {2017},
   month = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {optical fiber, optical frequency transfer},
   web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Besan\c{c}on, France},
   event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium},
   event_date = {10-07-2017 to 13-07-2017},
   language = {30},
   DOI = {10.1109/FCS.2017.8088928},
   stag_bib_extends_levelofaccess = {NA},
   author = {Le Coq, Y. and Abgrall, M. and Nicolodi, D. and Darqui{\'e}, B. and Tokunaga, S.K. and Amy-Klein, A. and Argence, B. and Lopez, O. and Tran, D.B.A. and Santagata, R. and Le Targat, R. and Xu, D. and Lee, W.K. and Pottie, P.E.}
}

@Proceedings { SliwczynskiKBBT2017,
   subid = {443},
   title = {Time and frequency transfer in modern DWDM telecommunication networks},
   journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)},
   year = {2017},
   month = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {optical fiber, optical frequency transfer},
   web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Besan\c{c}on, France},
   event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium},
   event_date = {10-07-2017 to 13-07-2017},
   language = {30},
   DOI = {10.1109/fcs.2017.8088894},
   stag_bib_extends_levelofaccess = {NA},
   author = {Śliwczyński, L. and Krehlik, P. and Bogacki, W. and Binczewski, A. and Turza, K.}
}

@Proceedings { SliwczynskiKKIPESB2017,
   subid = {444},
   title = {Fiber optic time transfer between PTB and Deutsche Telekom using multi-link redundant topology},
   journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)},
   year = {2017},
   month = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {optical fiber, optical frequency transfer},
   web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Besan\c{c}on, France},
   event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium},
   event_date = {10-07-2017 to 13-07-2017},
   language = {30},
   DOI = {10.1109/FCS.2017.8088999},
   stag_bib_extends_levelofaccess = {NA},
   author = {Śliwczyński, L. and Krehlik, P. and Kolodziej, J. and Imlau, H. and Piester, D. and Ender, H. and Schnatz, H. and Bauch, A.}
}

@Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017,
   subid = {477},
   title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks},
   journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)},
   year = {2017},
   month = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {optical fibre, network, clock, time, dissemination, service},
   web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/FCS.2017.8089004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schnatz, H. and Grosche, G. and Turza, K. and Bogacki, W. and Binczewski, A. and Urbaniak, R. and Nogaś, P. and Stefl, J. and Snajder, M. and John, F. and Tuckey, P. and Tavares, R. and Pottie, P.E. and Whibberley, P. and Kronj{\"a}ger, J. and English, E.L. and Lautier-Gaud, J. and Desruelle, B. and Camargo, F. and Lessing, M. and Holzwarth, R. and Rerucha, S. and Č{\'i}p, O. and Levi, F. and Clivati, C. and Calonico, D. and Campanella, M. and Vojtech, J. and Velc, R. and Smotlacha, V. and Radil, J. and Dostal, J. and Śliwczyński, L. and Krehlik, P. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.}
}

@Article { GarciaToranoVPMCP2017,
   title = {Direct measurement of alpha emission probabilities in the decay of  226 Ra},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {7},
   volume = {125},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {196-202},
   keywords = {Alpha spectrometry, 226Ra, Decay data, Alpha-particle emission probabilities},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.04.029},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garc{\'i}a-Tora{\~n}o, E. and Van Ammel, R. and Pomm{\'e}, S. and Marouli, M. and Crespo, T. and Pierre, S.}
}

@Proceedings { PousOAS2017_2,
   subid = {599},
   title = {Fast and automated verification of multi-channel full time-domain EMI measurement systems},
   journal = {2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)},
   year = {2017},
   month = {7},
   number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability},
   pages = {1-7},
   keywords = {electromagnetic compatibility, electromagnetic interference, just-before-test, quality management, standards},
   web_url = {https://upcommons.upc.edu/handle/2117/116687},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   event_place = {Turin, Italy},
   event_name = {2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)},
   event_date = {22-05-2017 to 25-05-2017},
   language = {30},
   ISBN = {978-1-5090-3596-0},
   DOI = {10.1109/I2MTC.2017.7969789},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pous, M. and Oliva, J.A. and Azpurua, M.A. and Silva, F.}
}

@Article { RuhlBTRFUPKHKHU2017,
   subid = {848},
   title = {Enhancing the sensitivity of nano-FTIR spectroscopy},
   journal = {Optics Express},
   year = {2017},
   month = {7},
   volume = {25},
   number = {14},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {16574},
   keywords = {Instrumentation, measurement, and metrology; Near-field microscopy},
   web_url = {https://www.osapublishing.org/DirectPDFAccess/158D237A-A0E8-5960-84426107CE1CBCF4_369006/oe-25-14-16574.pdf?da=1\&id=369006\&seq=0\&mobile=no},
   misc2 = {EMPIR 2015: Health},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.25.016574},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ruhl, E. and Beckhoff, B. and Tydecks, T. and Ries, M. and Feikes, J. and Ulrich, G. and Patoka, P. and Kashcheyevs, V. and Hoehl, A. and K{\"a}stner, B. and Hermann, P. and Ulm, G.}
}

@Article { HudlickaSBFH2017,
   subid = {769},
   title = {Optical and RF metrology for 5G},
   journal = {2017 IEEE Photonics Society Summer Topical Meeting Series (SUM)},
   year = {2017},
   month = {7},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {Optical variables measurement, 5G mobile communication, Transmission line measurements, Photodiodes, Adaptive optics, Optical fiber communication, Oscilloscopes},
   web_url = {https://arxiv.org/abs/1809.08934},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/PHOSST.2017.8012717},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hudlicka, M. and Struszewski, P. and Bieler, M. and Fatadin, I. and Humphreys, D.A.}
}

@Article { UnterumsbergerPLKHHWB2017,
   title = {Determination of SiO2 and C layers on a monocrystalline silicon sphere by reference-free x-ray fluorescence analysis},
   journal = {Metrologia},
   year = {2017},
   month = {6},
   day = {28},
   volume = {54},
   number = {4},
   number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells},
   pages = {481-486},
   keywords = {Avogadro project, X-ray fluorescence, quantification},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa765f},
   stag_bib_extends_levelofaccess = {NA},
   author = {Unterumsberger, R. and Pollakowski-Herrmann, B. and Lubeck, J. and Kolbe, M. and Holfelder, I. and H{\"o}nicke, P and Weser, J. and Beckhoff, B.}
}

@Article { PersijnKGSS2017,
   title = {Review of Portable and Low-Cost Sensors for the Ambient Air Monitoring of Benzene and Other Volatile Organic Compounds},
   journal = {Sensors},
   year = {2017},
   month = {6},
   day = {28},
   volume = {17},
   number = {7},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   pages = {1520},
   keywords = {PID based sensors; semiconductor and amperometric sensor; mini GC; portable on-line measuring devices; benzene; volatile organic compounds},
   web_url = {http://www.mdpi.com/1424-8220/17/7/1520},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s17071520},
   stag_bib_extends_levelofaccess = {NA},
   author = {Persijn, S. and Kok, G. and Gerboles, M. and Spinelle, L. and Sauerwald, T.}
}

@Article { ParkCL2017,
   subid = {311},
   title = {Experimental Demonstration of Four-Dimensional Photonic Spatial Entanglement between Multi-core Optical Fibres},
   journal = {Scientific Reports},
   year = {2017},
   month = {6},
   day = {27},
   volume = {7},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {1-8},
   keywords = {Ququarts, Quantum state tomography},
   web_url = {https://www.nature.com/articles/s41598-017-04444-8},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-04444-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Park, H.S. and Choi, S.K. and Lee, H.J.}
}

@Article { HughesCLLK2017_2,
   title = {Development of a high-accuracy multi-sensor, multi-target coordinate metrology system using frequency scanning interferometry and multilateration},
   journal = {Proc. SPIE},
   year = {2017},
   month = {6},
   day = {26},
   volume = {10332},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {1033202},
   keywords = {Interferometry, large volume metrology, sensors, distance measurement, calibration, traceability},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {SPIE},
   language = {30},
   DOI = {10.1117/12.2273644},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hughes, B. and Campbell, M. A. and Lewis, A. J. and Lazzarini, G. M. and Kay, N.}
}

@Thesis { Zhu2017,
   subid = {422},
   title = {Development of Transfer Standards for SSL Measurement},
   year = {2017},
   month = {6},
   day = {26},
   number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products},
   keywords = {solid-state lighting, LED, lamp, standard, driver, electronics, converter, stability, uncertainty},
   web_url = {http://resolver.tudelft.nl/uuid:dd6df3c3-fb96-4fbe-8cfe-56d664d2d9b4},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Delft University of Technology},
   address = {Delft},
   school = {Delft University of Technology},
   language = {30},
   ISBN = {-},
   ISSN = {-},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://resolver.tudelft.nl/uuid:dd6df3c3-fb96-4fbe-8cfe-56d664d2d9b4},
   author = {Zhu, Yiting}
}

@Article { SeidelinGFLPGJGL2017,
   subid = {399},
   title = {Dispersive heterodyne probing method for laser frequency stabilization based on spectral hole burning in rare-earth doped crystals},
   journal = {Optics Express},
   year = {2017},
   month = {6},
   day = {23},
   volume = {25},
   number = {13},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {15539},
   keywords = {Metrological  instrumentation, Fabry-Perot, Laser  stabilization, Rare-earth-doped materials},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.25.015539},
   stag_bib_extends_levelofaccess = {NA},
   author = {Seidelin, S. and Goldner, P. and Ferrier, A. and Le Targat, R. and Predehl, K. and Galland, N. and Jung, K. and Gobron, O. and Le Coq, Y.}
}

@Article { KazakovaKCMMI2017,
   subid = {899},
   title = {Angular Magnetoresistance of Nanowires with Alternating Cobalt and Nickel Segments},
   journal = {IEEE Transactions on Magnetics},
   year = {2017},
   month = {6},
   day = {22},
   volume = {53},
   number = {11},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {1-5},
   keywords = {Angular magnetoresistance (MR), cylindrical nanowires, domain-wall (DW) pinning, magnetic force microscopy (MFM)},
   web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/angular-magnetoresistance-of-nanowires-with-alternating-cobalt-and-nickel-segments(95f3afd6-6bb1-4548-843d-66a03bd12b0d).html},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9464, 1941-0069},
   DOI = {10.1109/TMAG.2017.2718623},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazakova, O. and Kosel, J. and Corte-Le{\'o}n, H. and Moreno, J. A. and Mohammed, H. and Ivanov, Y. P.}
}

@Article { MasowskiCZDBCAMWBL2017,
   subid = {387},
   title = {Absolute frequency determination of molecular transition in the Doppler regime at kHz level of accuracy},
   journal = {Journal of Quantitative Spectroscopy and Radiative Transfer},
   year = {2017},
   month = {6},
   day = {11},
   volume = {201},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {156-160},
   keywords = {Transition frequency, Absolute frequency measurement, Optical atomic clock, Oxygen B band, Cavity ring-down spectroscopy},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0022-4073},
   DOI = {10.1016/j.jqsrt.2017.07.010},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/pdf/1705.06639.pdf},
   author = {Masłowski, P. and Ciuryło, R. and Zawada, M. and Domysławska, J. and Bober, M. and Cygan, A. and Ablewski, P. and Morzyński, P. and W{\'o}jtewicz, S. and Bielska, K. and Lisak, D.}
}

@Article { CallegaroDO2017,
   title = {A Three-Arm Current Comparator Digitally Assisted Bridge for the Comparison of Arbitrary Four Terminal-Pair Impedances},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {6},
   volume = {66},
   number = {6},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {1496-1502},
   keywords = {Bridge circuits, electromagnetic devices,impedance measurement, precision measurements},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {445 Hoes Lane Piscataway NJ 08855-1331},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2016.2637458},
   stag_bib_extends_levelofaccess = {NA},
   author = {Callegaro, Luca and D'Elia, Vincenzo and Ortolano, Massimo}
}

@Article { JeanneretO2017,
   title = {Calibration of an LCR -Meter at Arbitrary Phase Angles Using a Fully Automated Impedance Simulator},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {6},
   volume = {66},
   number = {6},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {1516-1523},
   keywords = {Voltage measurement, Impedance, Calibration, Current measurement, Impedance measurement, Standards, Frequency measurement},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {Piscataway NJ},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2652500},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jeanneret, B. and Overney, F.}
}

@Article { HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017,
   subid = {141},
   title = {Test of Special Relativity Using a Fiber Network of Optical Clocks},
   journal = {Physical Review Letters},
   year = {2017},
   month = {6},
   volume = {118},
   number = {22},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   web_url = {https://arxiv.org/abs/1703.04426},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.118.221102},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hill, I. R. and Raupach, S. and Sterr, U. and Kuhl, A. and Grebing, C. and Grosche, G. and D{\"o}rscher, S. and Al-Masoudi, A. and Lisdat, C. and Lee, W.-K. and Quintin, N. and Amy-Klein, A. and Lopez, O. and Le Poncin-Lafitte, C. and Meynadier, F. and Guerlin, C. and Pottie, P.-E. and Le Targat, R. and Vallet, G. and Bookjans, E. and Bilicki, S. and Lodewyck, J. and Delva, P. and Hobson, R. and Bowden, W. and Kronj{\"a}ger, J. and Marra, G. and Rolland, A. and Baynes, F. N. and Margolis, H. S. and Gill, P.}
}

@Article { CrottiGMZ2017,
   title = {Accurate Numerical Modelling of MV and HV Resistive Dividers},
   journal = {IEEE Transactions on Power Delivery},
   year = {2017},
   month = {6},
   volume = {32},
   number = {3},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1645-1652},
   keywords = {Boundary element analysis, finite-element analysis, numerical simulation, voltage divider, voltage measurement},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0885-8977, 1937-4208},
   DOI = {10.1109/TPWRD.2015.2498705},
   stag_bib_extends_levelofaccess = {NA},
   author = {Crotti, G. and Giordano, D. and Modarres, M. and Zucca, M.}
}

@Article { PescettoLGC2017,
   title = {Improvement of Agilent 3458A Performances in Wideband Complex Transfer Function Measurement},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {6},
   volume = {66},
   number = {6},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1108-1116},
   keywords = {Frequency measurement, Cutoff frequency, Voltage measurement, Phase measurement, Transfer functions, Calibration, Impedance},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2661658},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pescetto, P. and Luiso, M. and Giordano, D. and Crotti, G.}
}

@Article { DavisCWL2017,
   title = {Multiple-Site Amplitude and Phase Measurements of Harmonics for Analysis of Harmonic Propagation on Bornholm Island},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {6},
   volume = {66},
   number = {6},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1176-1183},
   keywords = {Phasor measurement unit (PMU), power quality (PQ), power system harmonics, power system management, smart grids},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2660019},
   stag_bib_extends_levelofaccess = {NA},
   author = {Davis, P.N. and Christensen, A.E. and Wright, P.S. and Lippert, T.}
}

@Article { PoglianoST2017_2,
   title = {Asynchronous Phase Comparator for Characterization of Devices for PMUs Calibrator},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {6},
   volume = {66},
   number = {6},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1139-1145},
   keywords = {Analog–digital conversion, measurement standards, phase comparators,phasor measurement units (PMUs),resistive voltage dividers (RVDs)},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2648598},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pogliano, U. and Serazio, D. and Trinchera, B.}
}

@Article { FrigoRDHC2017,
   title = {Metrological characterization of a PMU calibrator in the 25 Hz to 3 kHz range},
   journal = {2017 IEEE Manchester PowerTech},
   year = {2017},
   month = {6},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   keywords = {Phasor Measurement Unit (PMU), PMU calibrator, distribution networks, IEEE C37.118},
   web_url = {http://ieeexplore.ieee.org/document/7981109/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/PTC.2017.7981109},
   stag_bib_extends_levelofaccess = {NA},
   author = {Frigo, G. and Rietveld, G. and Dierikx, E. and Hoogenboom, D. and Colangelo, D.}
}

@Proceedings { KummeFSW2017,
   subid = {246},
   title = {D6.2 - Characterisation of a 5 MN·m Torque Transducer by Combining Traditional Calibration and Finite Element Method Simulations},
   journal = {Proceedings Sensor 2017},
   year = {2017},
   month = {6},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   pages = {516 - 521},
   keywords = {torque calibration in the MN·m range, torque transfer standard, strain gauge simulation,torque range extension},
   misc2 = {EMPIR 2014: Industry},
   publisher = {AMA Service GmbH},
   event_place = {N{\"u}rnberg, Germany},
   event_name = {AMA Conferences 2017},
   event_date = {30-05-2017 to 01-06-2017},
   language = {30},
   ISBN = {978-3-9816876-4-4},
   DOI = {10.5162/sensor2017/D6.2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weidinger, P. and Foyer, G. and Schlegel, C. and Kumme, R.}
}

@Article { MortaraA2017,
   title = {A Calibration Setup for IEC 61850-9-2 Devices},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {6},
   volume = {66},
   number = {6},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {1124-1130},
   keywords = {IEC 61850-9-2, IEEE 1588, merging unit, sample values, test set},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2665938},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mortara, A. and Agustoni, M.}
}

@Article { MonteALBGRRKMAG2017,
   title = {Defect characterisation of tensile loaded CFRP and GFRP laminates used in energy applications by means of infrared thermography},
   journal = {Quantitative InfraRed Thermography Journal},
   year = {2017},
   month = {6},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   pages = {1-20},
   keywords = {Defect characterisation CFRP and GFRP laminates energy applications infrared thermography},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {1768-6733, 2116-7176},
   DOI = {10.1080/17686733.2017.1334312},
   stag_bib_extends_levelofaccess = {NA},
   author = {Monte, C. and Aktas, A. and Lodeiro, M. and Baker, G. and Gower, M. and Rehmer, B. and R{\"o}llig, M. and Krankenhagen, R. and Maierhofer, C. and Adibekyan, A. and Gutschwager, B.}
}

@Article { BoothGOVNNFDT2017,
   title = {Single-Ended Differential Protection in MTDC Networks Using Optical Sensors},
   journal = {IEEE Transactions on Power Delivery},
   year = {2017},
   month = {6},
   volume = {32},
   number = {3},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {1605-1615},
   keywords = {HVDC protection, multi-terminal direct current, modular multi-level converters, optical sensors.},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0885-8977, 1937-4208},
   DOI = {10.1109/TPWRD.2016.2645231},
   stag_bib_extends_levelofaccess = {NA},
   author = {Booth, C.D. and Gordon, N. and Orr, P. and Vozikis, D. and Niewczas, P. and Nelson, J. and Fusiek, G. and Dysko, A. and Tzelepis, D.}
}

@Article { JongepierPSR2017,
   title = {Pmu-Based Power System Analysis of A MV Distribution Grid},
   journal = {Proceedings of CIRED 2017},
   year = {2017},
   month = {6},
   volume = {1},
   number = {1},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   pages = {1035},
   keywords = {Power Systems, PMU, Smart Grids, Analysis},
   web_url = {http://cired.net/publications/cired2017/pdfs/CIRED2017_1035_final.pdf;\&\#10;doi: 10.1049/oap-cired.2017.1035},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {CIRED},
   address = {Glasgow},
   language = {30},
   ISBN = {978-178561-483-5},
   ISSN = {2032-9644},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jongepier, A and Popov, M and Save, N and Rietveld, G}
}

@Article { MougeotMKN2017,
   subid = {413},
   title = {Activity determination of  60 Co and the importance of its beta spectrum},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {6},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   keywords = {60Co, activity standardization, coincidence counting, TDCR, CIEMAT/NIST efficiency tracing, beta spectrum},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.06.015},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mougeot, X. and Marganiec-Gałązka, J. and Kossert, K. and N{\"a}hle, O.J.}
}

@Article { HerkommerRHSKTRGSTSFGR2017,
   subid = {412},
   title = {Single Quantum Dot with Microlens and 3D-Printed Micro-objective as Integrated Bright Single-Photon Source},
   journal = {ACS Photonics},
   year = {2017},
   month = {6},
   volume = {4},
   number = {6},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {1327-1332},
   keywords = {3D direct laser writing; 3D lithography; micro-objective; semiconductor quantum dot; single-photon source},
   web_url = {http://pubs.acs.org/doi/ipdf/10.1021/acsphotonics.7b00253},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2330-4022, 2330-4022},
   DOI = {10.1021/acsphotonics.7b00253},
   stag_bib_extends_levelofaccess = {NA},
   author = {Herkommer, A. and Rodt, S. and Heindel, T. and Strittmatter, A. and Kaganskiy, A. and Thiele, S. and Ristok, S. and Gissibl, T. and Srocka, N. and Thoma, A. and Schlehahn, A. and Fischbach, S. and Giessen, H. and Reitzenstein, S.}
}

@Proceedings { SchutzeKSGRSBL2017,
   title = {Highly sensitive benzene detection with MOS gas sensors},
   journal = {Proceedings Sensor 2017},
   year = {2017},
   month = {6},
   volume = {A4 - Gas S},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   pages = {92-97},
   keywords = {metal oxide semiconductor, MOS, temperature-cycled operation, TCO, benzene},
   web_url = {https://www.ama-science.org/proceedings/details/2498},
   misc2 = {EMRP A169: Call 2013 Environment II},
   event_place = {Nurember},
   event_name = {AMA Conferences 2017 – SENSOR 2017},
   event_date = {30-05-2017 to 01-06-2017},
   language = {30},
   ISBN = {978-3-9816876-4-4},
   DOI = {10.5162/sensor2017/A4.3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sch{\"u}tze, Andreas and Kok, Gertjan and Spinelle, Laurent and Gerboles, Michel and Reimringer, Wolfhard and Sauerwald, Tilman and Baur, Tobias and Leidinger, Martin}
}

@Article { RollandGSGPF2017,
   title = {New Generation of Low-Frequency Current Comparators Operated at Room Temperature},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {6},
   volume = {66},
   number = {6},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {1417-1424},
   keywords = {Cryogenic current comparator (CCC), Current comparator, Low-frequency, Resistance measurement, Sensitivity, Quantum Hall resistance},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2652198},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rolland, B. and Gournay, P. and Satrapinski, A. and G{\"o}tz, M. and Pesel, E. and Fletcher, N.}
}

@Article { HoutzagerBKv2017,
   title = {AC–DC Calibrations With a Pulse-Driven AC Josephson Voltage Standard Operated in a Small Cryostat},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {6},
   volume = {66},
   number = {6},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1391-1396},
   keywords = {AC–DC difference, Josephson voltage standard, measurement standards, measurement techniques, voltagemeasurement.},
   web_url = {http://ieeexplore.ieee.org/document/7898429/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2662381},
   stag_bib_extends_levelofaccess = {NA},
   author = {Houtzager, E. and Bauer, S. and Kieler, O.F.O. and van den Brom, H.E.}
}

@Article { HeinrichSPAPD2017,
   subid = {516},
   title = {Mutual interference in calibration line configurations},
   journal = {2017 89th ARFTG Microwave Measurement Conference (ARFTG)},
   year = {2017},
   month = {6},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Coupling, em simulation, measurements, parasitic modes, probes},
   web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/mutual-interference-in-calibration-line-configurations},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/ARFTG.2017.8000823},
   stag_bib_extends_levelofaccess = {NA},
   author = {Heinrich, W. and Schmuckle, F.J. and Probst, T. and Arz, U. and Phung, G.N. and Doerner, R. }
}

@Proceedings { WollensackHSRH2017,
   subid = {517},
   title = {VNA tools II: Calibrations involving eigenvalue problems},
   journal = {2017 89th ARFTG Microwave Measurement Conference (ARFTG)},
   year = {2017},
   month = {6},
   volume = {1},
   number = {1},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {1-4},
   keywords = {Vector Network Analyzer, S-parameters, Calibration, Uncertainty, Traceability},
   web_url = {http://dx.doi.org/10.1109/ARFTG.2017.8000832},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Honolulu},
   event_name = {Wollensack, Michael, et al.},
   event_date = {09-06-2017 to 10-06-2017},
   language = {30},
   ISBN = {978-1-5386-2748-8},
   DOI = {10.7795/EMPIR.14IND02.CA.20190404},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wollensack, M. and Hoffmann, J. and Stalder, D. and Ruefenacht, J. and Hoffmann, J.}
}

@Article { XuCJSCPVHSC2017,
   subid = {574},
   title = {Temperature dependence mitigation in stationary Fourier-transform on-chip spectrometers},
   journal = {Optics Letters},
   year = {2017},
   month = {6},
   volume = {42},
   number = {11},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {2239},
   keywords = {temperature, silicon on insulator, microspectrometer},
   web_url = {https://digital.csic.es/handle/10261/164048},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {0146-9592, 1539-4794},
   DOI = {10.1364/OL.42.002239},
   stag_bib_extends_levelofaccess = {NA},
   author = {Xu, D.X and Calvo, M.L. and Janz, S. and Schmid, J.H. and Cheben, P. and Podmore, H. and Velasco, A.V. and Herrero-Bermello, A. and Scott, A. and Corredera, P.}
}

@Article { HansenMBQJBNM2017,
   subid = {347},
   title = {Study on Microgratings Using Imaging, Spectroscopic, and Fourier Lens Scatterometry},
   journal = {Journal of Micro and Nano-Manufacturing},
   year = {2017},
   month = {6},
   volume = {5},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {031005},
   keywords = {Microgratings, scatterometry},
   web_url = {http://micronanomanufacturing.asmedigitalcollection.asme.org/article.aspx?articleid=2630287},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   DOI = {10.1115/1.4036889},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hansen, P. E. and Madsen, J. S and Boher, P. and Qwarakanath, D. and Joergensen, J. F. and Bilenberg, B. and Nygaard, J. and Madsen, M. H.}
}

@Proceedings { SebastianLMS2017,
   subid = {245},
   title = {Torque Tracebility for Nacelle's test benches: A design proposal},
   journal = {IMEKO  23 rd},
   year = {2017},
   month = {6},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   keywords = {wind turbine, torque, standard, nacelle test bench},
   misc2 = {EMPIR 2014: Industry},
   publisher = {International Measurement Confederation},
   event_place = {Helsinki, Finland},
   event_name = {IMEKO 23 rd  TC3, 13 th  TC5 and 4 th  TC22 International Conference},
   event_date = {30-05-2017 to 01-06-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-004.pdf},
   author = {Sebasti{\'a}n, M.A. and Lorente, R.M. and Medina, N. and S{\'a}enz, M.A.}
}

@Article { ManderEBCB2017,
   title = {A methodology for study of in-service drift of meteorological humidity sensors},
   journal = {Metrologia},
   year = {2017},
   month = {5},
   day = {26},
   volume = {54},
   number = {3},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {S63-S73},
   keywords = {humidty, meteorology, sensor drift},
   web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa6dd0/meta;jsessionid=69E0689027FB9B75F14F77239651C49F.ip-10-40-1-105},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa6dd0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mander, N and England, C and Beardmore, S L and Carroll, P A and Bell, S A}
}

@Article { ClivatiLIDCSDCBI2017,
   subid = {140},
   title = {Measuring molecular frequencies in the 1-10 µm range at 11-digits accuracy},
   journal = {Atomic Physics (physics.atom-ph)},
   year = {2017},
   month = {5},
   day = {18},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {molecular frequencies},
   misc2 = {EMPIR 2015: SI Broader Scope},
   language = {30},
   DOI = {10.1038/s41598-017-12891-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clivati, C. and Levi, F. and Inguscio, M. and D'Ambrosio, D. and Cancio Pastor, P. and Santambrogio, G. and De Natale, P. and Calonico, D. and Borri, S. and Insero, G.}
}

@Article { SchraderKSH2017,
   title = {Characterization of a 300-GHz Transmission System for Digital Communications},
   journal = {Journal of Infrared, Millimeter, and Terahertz Waves},
   year = {2017},
   month = {5},
   day = {17},
   volume = {38},
   number = {8},
   number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications},
   pages = {1004-1018},
   keywords = {Error vector magnitude, Waveform metrology, THz communication},
   web_url = {https://link.springer.com/article/10.1007/s10762-017-0395-9},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1866-6892, 1866-6906},
   DOI = {10.1007/s10762-017-0395-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schrader, T. and Kleine-Ostmann, T. and Salhi, M. and Hudlicka, M.}
}

@Proceedings { BurgerTMC2017,
   subid = {851},
   title = {Modelling of standard and specialty fibre-based systems using finite element methods},
   journal = {Proc. SPIE},
   year = {2017},
   month = {5},
   day = {17},
   volume = {10683},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {1068336},
   keywords = {Finite element modelling, modal distribution, specialty fibres},
   web_url = {http://arxiv.org/abs/1807.10811},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Strasbourg},
   event_name = {Fiber Lasers and Glass Photonics: Materials through Applications},
   event_date = {22-04-2018 to 26-04-2018},
   language = {30},
   DOI = {10.1117/12.2307372},
   stag_bib_extends_levelofaccess = {NA},
   author = {Burger, S. and Testa, L. and Morel, J. and Castagna, N.}
}

@Proceedings { PaakkolanvaaraKR2017,
   subid = {821},
   title = {Measurement of Thermoplastic Properties of Packaging Materials},
   journal = {28th IAPRI Symposium on Packaging 2017: Proceedings: Unlocking the full potential of packaging across the value-chain},
   year = {2017},
   month = {5},
   day = {12},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   keywords = {Thermoplastic Properties, Packaging Materials},
   web_url = {https://cris.vtt.fi/en/publications/measurement-of-thermoplastic-properties-of-packaging-materials},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IAPRI},
   event_place = {Lausanne, Switzerland},
   event_name = {28th IAPRI Symposium on Packaging 2017},
   event_date = {09-05-2017 to 12-05-2017},
   language = {30},
   ISBN = {978-2-8399-2120-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Paakkolanvaara, M and Kouko, J and Retulainen, E}
}

@Article { CaldersODN2017,
   title = {Influence of levelling technique on the retrieval of canopy structural parameters from digital hemispherical photography},
   journal = {Agricultural and Forest Meteorology},
   year = {2017},
   month = {5},
   volume = {237-238},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {143-149},
   keywords = {Plant area index, Sensor comparison, Levelling, Hemispherical photography.},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   address = {New York, USA},
   language = {30},
   ISSN = {0168-1923},
   DOI = {10.1016/j.agrformet.2017.02.004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calders, Kim and Origo, Niall and Disney, Mathias and Nightingale, Joanne}
}

@Article { CaldersBADNMOB2017,
   title = {Evaluation of the Range Accuracy and the Radiometric Calibration of Multiple Terrestrial Laser Scanning Instruments for Data Interoperability},
   journal = {IEEE Transactions on Geoscience and Remote Sensing},
   year = {2017},
   month = {5},
   volume = {55},
   number = {5},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {2716-2724},
   keywords = {Data interoperability, radiometric calibration, RIEGL VZ-400, terrestrial light detection and ranging (LiDAR).},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   language = {30},
   ISSN = {0196-2892, 1558-0644},
   DOI = {10.1109/TGRS.2017.2652721},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calders, Kim and Burt, Andrew and Armston, John and Disney, Mathias I. and Nightingale, Joanne and Muir, Jasmine and Origo, Niall and Brede, Benjamin}
}

@Article { LopezAPBSL2017,
   subid = {139},
   title = {Hybrid fiber links for accurate optical frequency comparison},
   journal = {Applied Physics B},
   year = {2017},
   month = {5},
   volume = {123},
   number = {5},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {Hybrid fiber links, accurate optical frequency comparison,},
   web_url = {https://link.springer.com/article/10.1007/s00340-017-6736-5},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   address = {New York},
   language = {30},
   ISSN = {0946-2171, 1432-0649},
   DOI = {10.1007/s00340-017-6736-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lopez, O. and Amy-Klein, A. and Pottie, P.E. and Bercy, A. and Stefani, F. and Lee, W.K.}
}

@Article { SantarelliLLCCMWKKCSNRQDLBRGGAWGALLPG2017,
   subid = {138},
   title = {First international comparison of fountain primary frequency standards via a long distance optical fiber link},
   journal = {Metrologia},
   year = {2017},
   month = {5},
   volume = {54},
   number = {3},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {348-354},
   keywords = {optical fiber frequency transfer, atomic fountain clocks, international fountain, clock comparison},
   web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa65fe},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa65fe},
   stag_bib_extends_levelofaccess = {NA},
   author = {Santarelli, G and Lours, M and Le Coq, Y and Chardonnet, C and Camisard, E and Meynadier, F and Wiotte, F and Kuhl, A and Koke, S and Chiodo, N and Stefani, F and Nicolodi, D and Raupach, S M F and Quintin, N and Denker, H and Lipphardt, B and Bize, S and Rosenbusch, P and Gerginov, V and Grebing, C and Abgrall, M and Weyers, S and Guena, J and Amy-Klein, A and Le Targat, R and Lopez, O and Pottie, P E and Grosche, G}
}

@Article { BhattacharyaUPRH2017,
   title = {Temperature measurement using frequency comb absorption spectroscopy of CO2},
   journal = {Review of Scientific Instruments},
   year = {2017},
   month = {5},
   volume = {88},
   number = {5},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {053113},
   keywords = {spectroscopy, frequency comb laser},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4984252},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.4984252},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bhattacharya, N. and Urbach, H. P. and Persijn, S. T. and Reyes-Reyes, A. and H{\"a}nsel, A.}
}

@Article { CowburnMCSFWK2017,
   subid = {251},
   title = {Detection of individual iron-oxide nanoparticles with vertical and lateral sensitivity using domain wall nucleation in CoFeB/Pt nanodevices},
   journal = {AIP Advances},
   year = {2017},
   month = {5},
   volume = {7},
   number = {5},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {056715},
   keywords = {We present new studies of the characteristics and detection ability of nanoscale sensors based on domain wall nucleation within perpendicularly magnetised ultrathin CoFeB/Pt films. A combination of MFM imaging and anomalous Hall effect transport measurements were used to verify and characterise the behaviour of fabricated devices. After initial characterisation, the influence of magnetic nanoparticles on device behaviour was studied using individual iron oxide (FeOx) particles mounted on modified atomic force microscopy probes. We demonstrate the successful detection of particles ranging in diameter between 2.8 \(\mu\)m and 100 nm. In the case of the 2.8 \(\mu\)m particle, we have mapped the signal amplitude produced at a variety of distances from the sensor. We find that the particle’s influence may be detected at separations up to 700 nm. Furthermore, we demonstrate a method for resolving the location of a particle with respect to the centre of the device, providing a lateral sensing ability.},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {2158-3226},
   DOI = {10.1063/1.4975357},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cowburn, R. and Mansell, R. and Cox, D. and Schumacher, H.W. and Fern{\'a}ndez Scarioni, A. and Wells, J. and Kazakova, O.}
}

@Inbook { MohnsL2017,
   title = {Kapitel 18, “Pr{\"u}ftechnik f{\"u}r Messwandler”},
   year = {2017},
   month = {5},
   volume = {3. Auflage},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {687-718},
   keywords = {Messwandler, Wandlermesseinrichtungen, nichtkonventionelle Messwandler},
   web_url = {https://www.vde-verlag.de/buecher/624403/handbuch-elektrizitaetsmesstechnik.html},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {VDE Verlag},
   address = {Berlin},
   booktitle = {Handbuch Elektrizit{\"a}tsmesstechnik,  Vorschriften-Ger{\"a}tetechnik-Pr{\"u}ftechnik-Systeme},
   language = {43},
   ISBN = {978-3-8007-4403-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mohns, E. and Latzel, H.G.}
}

@Proceedings { StyblikovaD2017,
   title = {Magnetic shielding of Rogowski coils},
   journal = {2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)},
   year = {2017},
   month = {5},
   volume = {N/A},
   number = {N/A},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {1467-1471},
   keywords = {Rogowski coil; magnetic shielding; AC current},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   event_place = {Turin, Italy},
   event_name = {Instrumentation and Measurement Technology Conference (I2MTC), 2017 IEEE International},
   event_date = {22-05-2017 to 25-05-2017},
   language = {30},
   ISBN = {978-1-5090-3596-0},
   DOI = {10.1109/I2MTC.2017.7969952},
   stag_bib_extends_levelofaccess = {NA},
   author = {Styblikova, R. and Draxler, K.}
}

@Article { SchmittWJRLSMK2017,
   subid = {604},
   title = {Validation of 4D dose calculation using an independent motion monitoring by the calypso tracking system and 3D polymer gel dosimetry},
   journal = {Journal of Physics: Conference Series},
   year = {2017},
   month = {5},
   volume = {847},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {012040},
   keywords = {3D dosimetry, gel dosimeter, radiotherapy, MRgRT},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/847/1/012040},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmitt, D and Witte, M and Johnen, W and Runz, A and Lang, C and Saito, N and Mann, P and Karger, C P}
}

@Article { SchlegelFWK2017,
   subid = {241},
   title = {Extending the Torque Calibration Range –  Necessity and Outline of a Mathematical Approach},
   journal = {Ukrainian Metrological Journal},
   year = {2017},
   month = {4},
   day = {20},
   number = {1A},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   pages = {57-60},
   keywords = {Calibration; Measurement; Mathematical methods},
   misc2 = {EMPIR 2014: Industry},
   publisher = {National Scientific Centre Institute of Metrology},
   language = {30},
   ISSN = {2306-7039},
   DOI = {10.24027/2306-7039.1A.2017.99993},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weidinger, P. and Foyer, G. and Schlegel, C. and Kumme, R.}
}

@Article { KochGIIGHKBWK2017,
   subid = {174},
   title = {Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI},
   journal = {PLOS ONE},
   year = {2017},
   month = {4},
   day = {12},
   volume = {12},
   number = {4},
   number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources},
   pages = {1-19},
   keywords = {Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI},
   misc2 = {EMPIR 2015: Health},
   address = {San Francisco, California, and Cambridge, United Kingdom.},
   language = {30},
   DOI = {10.1371/journal.pone.0174420},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koch, Christian and Gallinat, J{\"u}rgen and  Ittermann, Bernd and Ihlenfeld, Albrecht and Garcia Forlim, Caroline  and Hensel, Johannes and K{\"u}hler, Robert and Bauer, Martin and Weichenberger, Markus and K{\"u}hn, Simone}
}

@Article { Ken2017,
   subid = {63},
   title = {Robust and precise algorithm for aspheric surfaces characterization by the conic section},
   journal = {Journal of the European Optical Society-Rapid Publications},
   year = {2017},
   month = {4},
   day = {11},
   volume = {13},
   number = {11},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {1-7},
   keywords = {aspheric lens, robust algorithm, least squares fitting, metrology, ISO 10110},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   address = {233 Spring St, New York NY 10013, USA},
   language = {30},
   ISSN = {1990-2573},
   DOI = {10.1186/s41476-017-0040-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kren, Petr}
}

@Article { Fatadin2017,
   subid = {853},
   title = {Calibration of Estimated BER from Error Vector Magnitude with Carrier Phase Recovery},
   journal = {Recent Adv Photonics Opt},
   year = {2017},
   month = {4},
   day = {10},
   volume = {1},
   number = {1},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {1-6},
   keywords = {Error Vector Magnitude (EVM), Quadrature Phase Shift Keying (QPSK), Carrier phase recovery},
   web_url = {https://www.scholarlypages.org/Articles/photonics-and-optics/rapo-1-001.php?jid=photonics-and-optics},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Scholarly Pages},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://scholarlypages.org/Articles/photonics-and-optics/rapo-1-001.pdf},
   author = {Fatadin, I.}
}

@Article { HemmingWLEKJHL2017,
   title = {Application of Monte Carlo simulation for estimation of uncertainty of four-point roundness measurements of rolls},
   journal = {Precision Engineering},
   year = {2017},
   month = {4},
   volume = {48},
   number2 = {IND62: TIM: Traceable in-process dimensional measuremen},
   pages = {181-190},
   keywords = {Application of Monte Carlo simulation for estimation of uncertainty of four-point roundness measurements of rolls},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   address = {360 Park Ave S, New York, NY 10010, USA},
   language = {30},
   ISSN = {0141-6359},
   DOI = {10.1016/j.precisioneng.2016.12.001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hemming, B. and Widmaier, T. and Lassila, A. and Esala, V.-P. and Kuosmanen, P. and Juhanko, J. and Haikio, J. and Laukkanen, P.}
}

@Article { HogstromGSSLH2017,
   title = {Characterization of the Humidity Calibration Chamber by Numerical Simulations},
   journal = {International Journal of Thermophysics},
   year = {2017},
   month = {4},
   volume = {38},
   number = {6},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   keywords = {Calibration, Finite element method Humidity, calibration, Multiphysics, Simulation, Surface chemistry},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Springer Nature},
   address = {One New York Plaza, Suite 4500 New York NY 10004-1562 United States},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-017-2221-y},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"o}gstr{\"o}m, R. and Grahn, P. and Sairanen, H. and Salminen, J. and Lakka, A. and Heinonen, M.}
}

@Article { BialekH2017,
   title = {Cause, Effect, and Correction of Field Spectroradiometer Interchannel Radiometric Steps},
   journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing},
   year = {2017},
   month = {4},
   volume = {10},
   number = {4},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {1542-1551},
   keywords = {Fieldspectroscopy,  radiometry,  sensor model,  temperature dependence},
   web_url = {http://ieeexplore.ieee.org/document/7819458/},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New Jersey},
   language = {30},
   ISSN = {1939-1404, 2151-1535},
   DOI = {10.1109/JSTARS.2016.2625043},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bialek, A. and Hueni, A.}
}

@Article { FanQYFZ2017,
   title = {Thermal/luminescence characterization and degradation mechanism analysis on phosphor-converted white LED chip scale packages},
   journal = {Microelectronics Reliability},
   year = {2017},
   month = {4},
   volume = {74},
   number = {July 2017},
   number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting},
   pages = {179–185},
   keywords = {Phosphor-converted white LED, Chip scale packages, Multicolor phosphors, Thermal/luminescence characterization, Degradation mechanisms},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0026271417301026},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {dongsheng ZHAO},
   address = {New York},
   language = {30},
   ISSN = {0026-2714},
   DOI = {10.1016/j.microrel.2017.04.012},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fan, X. and Qian, C. and Yu, C. and Fan, J. and ZHAO, G.}
}

@Article { CarmeleRBSSSGSSvTHKR2017,
   subid = {234},
   title = {A bright triggered twin-photon source in the solid state},
   journal = {Nature Communications},
   year = {2017},
   month = {4},
   volume = {8},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {14870},
   keywords = {Quantum dots, Quantum optics, Single photons and quantum effects .},
   web_url = {https://www.nature.com/articles/ncomms14870},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/ncomms14870},
   stag_bib_extends_levelofaccess = {NA},
   author = {Carmele, A. and Rodt, S. and Beyer, J. and Strittmatter, A. and Schulze, J. -H. and Schnauber, P. and Gschrey, M. and Schlehahn, A. and Schmidt, M. and von Helversen, M. and Thoma, A. and Heindel, T. and Knorr, A. and Reitzenstein, S.}
}

@Article { KataokaAKBG2017,
   subid = {313},
   title = {Robust operation of a GaAs tunable barrier electron pump},
   journal = {Metrologia},
   year = {2017},
   month = {4},
   volume = {54},
   number = {3},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {299-306},
   keywords = {single-electron pumps, primary electrical metrology, current standards},
   web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/54/1/S1/meta;jsessionid=4918445C3978B8F392DE6A658FA21463.ip-10-40-1-105},
   web_url2 = {http://www.e-si-amp.eu/outputs/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa634c},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kataoka, M and Ahn, Ye-Hwan and Kim, N and Bae, M-H and Giblin, S P}
}

@Article { SchmidtSPKHSL2017,
   subid = {389},
   title = {On-line estimation of local oscillator noise and optimisation of servo parameters in atomic clocks},
   journal = {Metrologia},
   year = {2017},
   month = {4},
   volume = {54},
   number = {3},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {307-321},
   keywords = {quantum projection noise, atomic frequency standards, local oscillator noise, servo optimisation},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa66e9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmidt, P.O. and Stepanova, M. and Pelzer, L. and Kramer, J. and Hannig, S. and Scharnhorst, N. and Leroux, I.D.}
}

@Article { JehlBKCVSHLBKC2017,
   subid = {369},
   title = {Design and Operation of CMOS-Compatible Electron Pumps Fabricated With Optical Lithography},
   journal = {IEEE Electron Device Letters},
   year = {2017},
   month = {4},
   volume = {38},
   number = {4},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {414-417},
   keywords = {Quantum dots, Quantum effect semiconductor devices, Quantization, Current control},
   web_url = {https://arxiv.org/abs/1612.09547},
   web_url2 = {http://www.e-si-amp.eu/outputs/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0741-3106, 1558-0563},
   DOI = {10.1109/LED.2017.2670680},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jehl, X. and Barinovs, G. and Kashcheyevs, V. and Cinins, A. and Vinet, M. and Sanquer, M. and Hutin, L. and Lavieville, R. and Barraud, S. and Klochan, J. and Clapera, P.}
}

@Article { PrancePPJHHGGBPB2017,
   subid = {504},
   title = {On-chip magnetic cooling of a nanoelectronic device},
   journal = {Scientific Reports},
   year = {2017},
   month = {4},
   volume = {7},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {45566},
   keywords = {Electronic devices, Electronic properties and materials},
   web_url = {https://www.nature.com/articles/srep45566},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/srep45566},
   stag_bib_extends_levelofaccess = {NA},
   author = {Prance, J. R. and Penttil{\"a}, J. and Pashkin, Y. A. and Jones, A. T. and Holt, S. and Haley, R. P. and Gunnarsson, D. and Gu{\'e}nault, A. M. and Bradley, D. I. and Prunnila, M. and Barlow, Cameron}
}

@Article { SpiritoG2017,
   subid = {522},
   title = {Millimeter-Wave on-Wafer TRL Calibration employing 3D EM Simulation-Based Characteristic Impedance Extraction},
   journal = {IEEE Transactions on Microwave Theory and Techniques},
   year = {2017},
   month = {4},
   volume = {65},
   number = {4},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {9},
   keywords = {Calibration, characteristic impedance, measurement, millimeter wave, silicon, TRL, vector network analyzer (VNA)},
   web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7837598},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   address = {Piscataway},
   language = {30},
   ISSN = {0018-9480},
   DOI = {10.1109/TMTT.2016.2609413},
   stag_bib_extends_levelofaccess = {NA},
   author = {Spirito, Marco and Galatro, Luca}
}

@Thesis { Boles2017,
   subid = {312},
   title = {Development of Traceable Capabilities in Non-Contact Thermal Metrology},
   year = {2017},
   month = {3},
   day = {31},
   number2 = {14RPT05: Eura-Thermal: Developing traceable capabilities in thermal metrology},
   keywords = {Blackbody cavity, Radiation thermometer, Blackbody orientation, Infrared thermometer, Calibration},
   web_url = {http://arrow.dit.ie/engmas/53/},
   misc2 = {EMPIR 2014: Research Potential},
   publisher = {DIT, Dublin, Ireland},
   school = {Dublin Institute of Technology},
   language = {30},
   ISBN = {10.21427/D7B90D},
   ISSN = {10.21427/D7B90D},
   DOI = {10.21427/D7B90D},
   stag_bib_extends_levelofaccess = {NA},
   author = {Boles, S.}
}

@Article { VelascoVSVCSP2017,
   subid = {573},
   title = {Demonstration of a compressive-sensing Fourier-transform on-chip spectrometer},
   journal = {Optics Letters},
   year = {2017},
   month = {3},
   day = {31},
   volume = {42},
   number = {7},
   number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {1440},
   keywords = {Fourier transform, silicon on insulator, compressive sensing},
   web_url = {https://digital.csic.es/handle/10261/164048},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {0146-9592, 1539-4794},
   DOI = {10.1364/OL.42.001440},
   stag_bib_extends_levelofaccess = {NA},
   author = {Velasco, A.V. and Vachon, M. and Schmid, J.H. and Velasco, A.V. and Cheben, P. and Scott, A. and Podmore, H.}
}

@Article { LassilaHPBH2017,
   title = {Interferometric 2D small angle generator for autocollimator calibration},
   journal = {Metrologia},
   year = {2017},
   month = {3},
   day = {30},
   volume = {54},
   number = {3},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {253-261},
   keywords = {autocollimator, interferometry, metrology, angle measurement},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa648d},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lassila, A. and Hemming, B. and Palosuo, I. and Byman, V. and Heikkinen, V.}
}

@Article { GolubevLKMLM2017,
   title = {Characterizing superconducting filters using residual microwave background},
   journal = {Superconductor Science and Technology},
   year = {2017},
   month = {3},
   day = {27},
   volume = {30},
   number = {5},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   pages = {055006},
   keywords = {superconductivity, microwave propagation, single-electron trap, microwave photon detection, on-chip filters, Josephson array},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0953-2048, 1361-6668},
   DOI = {10.1088/1361-6668/aa63bc},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lehtinen, J S and Mykk{\"a}nen, E and Kemppinen, A and Lotkhov, S V and Golubev, D and Manninen, A J}
}

@Article { HusainLTYBSSTKFH2017,
   subid = {30},
   title = {Single Carrier Trapping and De-trapping in Scaled Silicon Complementary Metal-Oxide-Semiconductor Field-Effect Transistors at Low Temperatures},
   journal = {Semiconductor Science and Technology},
   year = {2017},
   month = {3},
   day = {24},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Coulomb blockade, MOSFETs, Carrier Trapping and De-trapping, quantum dots},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0268-1242, 1361-6641},
   DOI = {10.1088/1361-6641/aa6910},
   stag_bib_extends_levelofaccess = {NA},
   author = {Husain, Muhammad and Li, Zuo  and Tani, Kazuki and Yoshimoto, Hiroyuki  and Byers, James and Sasago, Yoshitaka and Saito, Shinichi and Tsuchiya, Yoshishige and Kataoka, Masaya and Fletcher, Jonathan and Hisamoto, Digh}
}

@Article { FujiwaraKKGY2017,
   subid = {407},
   title = {High-accuracy current generation in the nanoampere regime from a silicon single-trap electron pump},
   journal = {Scientific Reports},
   year = {2017},
   month = {3},
   day = {21},
   volume = {7},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {45137},
   keywords = {Single-electron pump, silicon, trap level, current standard},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/srep45137},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fujiwara, A. and Karasawa, T. and Kataoka, M. and Giblin, S.P. and Yamahata, G.}
}

@Article { GotzingerVPCLSMIBS2017,
   title = {Experimental demonstration of a predictable single photon source with variable photon flux},
   journal = {Metrologia},
   year = {2017},
   month = {3},
   day = {21},
   volume = {54},
   number = {2},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {218-223},
   keywords = {single photon sources, single photon metrology, silicon vacancy center, low optical flux detector, photon on demand},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa5ba2},
   stag_bib_extends_levelofaccess = {NA},
   author = {G{\"o}tzinger, S. and Vaigu, A. and Porrovecchio, G. and Chu, X.L. and Lindner, S. and Smid, M. and Manninen, A. and Ikonen, E. and Becher, C. and Sandoghdar, V.}
}

@Miscellaneous { RoscoeB,
   title = {Real-time measurement of Phasor Measurement Unit (PMU) reporting latency},
   journal = {Github},
   year = {2017},
   month = {3},
   day = {20},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   keywords = {Communications, IEC 61850, IEEE 1588, IEEE C37.118, phasor measurement units (PMUs), Sampled Values, time synchronisation},
   misc2 = {EMRP A169: Call 2013 Energy II},
   language = {30},
   DOI = {10.5281/zenodo.400934},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roscoe, Andrew and Blair, Steven}
}

@Article { BrunzendorfWSLEW2017,
   title = {High-resolution Fourier transform measurements of line strengths in the 00\verb=^=02-00\verb=^=00 main isotopologue band of nitrous oxide},
   journal = {Applied Optics},
   year = {2017},
   month = {3},
   day = {17},
   volume = {56},
   number = {11},
   number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring},
   pages = {E99-E105},
   keywords = {Nitrous oxide, Fourier transform infrared spectroscopy, spectral line parameters, line strengths, gas metrology},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {The Optical Society},
   address = {2010 Massachusetts Ave, NW Washington, DC 20036-1023, USA},
   language = {30},
   ISSN = {0003-6935, 1539-4522},
   DOI = {10.1364/ao.56.000e99},
   stag_bib_extends_levelofaccess = {NA},
   author = {Brunzendorf, Jens and Werwein, Viktor and Serdyukov, Anton and Li, Gang and Ebert, Volker and Werhahn, Olav}
}

@Article { NovikovaMLR2017,
   title = {Measurement of K fluorescence yields of niobium and rhodium using monochromatic radiation},
   journal = {X-Ray Spectrometry},
   year = {2017},
   month = {3},
   day = {15},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   keywords = {radiation, fluorescence},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Wiley-Blackwell},
   address = {111 River Street Hoboken,NJ 07030, USA},
   language = {30},
   ISSN = {0049-8246},
   DOI = {10.1002/xrs.2757},
   stag_bib_extends_levelofaccess = {NA},
   author = {Novikova, Anastasiia and M{\'e}nesguen, Yves and L{\'e}py, Marie-Christine and Riffaud, Jonathan}
}

@Article { deClercqGYCAB2017,
   title = {A high-performance Raman-Ramsey Cs vapor cell atomic clock},
   journal = {Journal of Applied Physics},
   year = {2017},
   month = {3},
   day = {14},
   volume = {121},
   number = {10},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   pages = {104903},
   keywords = {Frequency standard, laser, resonances, stability, shift},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0021-8979, 1089-7550},
   DOI = {10.1063/1.4977955},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Clercq, E. and Gu{\'e}randel, S. and Yun, P. and Coget, G. and Abdel Hafiz, M. and Boudot, R.}
}

@Article { ZoladekLemanczykBNKCS2017,
   title = {Fabrication of air-stable, large-area, PCDTBT:PC70BM polymer solar cell modules using a custom built slot-die coater},
   journal = {Solar Energy Materials and Solar Cells},
   year = {2017},
   month = {3},
   volume = {161},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {388-396},
   keywords = {Slot-die coating; Polymer Solar Cells (PSC); Large-area; Ambient stability; PCDTBT:PC70BM; Light beam induced current (LBIC); Photoluminescence (PL)},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   address = {New York, United States},
   language = {30},
   ISSN = {0927-0248},
   DOI = {10.1016/j.solmat.2016.12.019},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zoladek-Lemanczyk, Alina and Bausi, Francesco and New, Edward and Kutsarov, Dimitar I. and Castro, Fernando A. and Silva, S. Ravi P.}
}

@Article { MarsteinPHRCDS2017,
   title = {Surface Passivation Properties of $\{\textbackslashtextrm\{HfO\}\}_\{2\}$ Thin Film on n-Type Crystalline Si},
   journal = {IEEE Journal of Photovoltaics},
   year = {2017},
   month = {3},
   volume = {7},
   number = {2},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {479-485},
   keywords = {Passivation,  Hafnium compounds,  Silicon,  Annealing,  Temperature, silicon,  atomic layer deposition,  carrier lifetime,  crystal growth from melt,  dielectric thin films,  electrical resistivity,  hafnium compounds,  passivation,  refractive index, Si,  surface passivation,  hafnium oxide thin film,  atomic layer deposition,  resistivity,  low temperature anneal,  precleaning,  precursors,  deposition temperature,  postannealing temperature,  minority carrier lifetime,  surface recombination velocity,  Czochralski n-type wafers,  light soaking,  refractive index,  solar cells,  HfO2, silicon surface passivation,  Atomic layer deposition (ALD),  defect density,  fixed charges,  hafnium oxide (HfO2),  photovoltaic cells},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA},
   language = {30},
   ISSN = {2156-3381, 2156-3403},
   DOI = {10.1109/JPHOTOV.2016.2645399},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marstein, Erik Stensrud and Perros, Alexander Pyymaki and Halvard, Haug and Repo, Paivikki and Cheng, Xuemei and Di Sabatino, Marisa and Savin, Hele}
}

@Article { PolanskyW2017,
   title = {Proper Orthogonal Decomposition as a technique for identifying two-phase flow pattern based on electrical impedance tomography},
   journal = {Flow Measurement and Instrumentation},
   year = {2017},
   month = {3},
   volume = {53},
   number2 = {ENG58: MultiFlowMet: Multiphase flow metrology in oil and gas production},
   pages = {126-132},
   keywords = {Proper Orthogonal Decomposition as a technique for identifying two-phase flow pattern based on electrical impedance tomography},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   address = {New York, USA},
   language = {30},
   ISSN = {0955-5986},
   DOI = {10.1016/j.flowmeasinst.2016.10.004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Polansky, Jiri and Wang, Mi}
}

@Article { SewellSFZK2017,
   title = {A new profile roughness measurement approach for involute helical gears},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {3},
   volume = {28},
   number = {5},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   pages = {055004},
   keywords = {involute gear, roughness},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa5d96},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sewell, I and Shaw, B A and Frazer, R C and Zhang, J and Koulin, G}
}

@Article { BettsBHCKG2017,
   title = {Compressed Sensing Current Mapping Spatial Characterization of Photovoltaic Devices},
   journal = {IEEE Journal of Photovoltaics},
   year = {2017},
   month = {3},
   volume = {7},
   number = {2},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {486-492},
   keywords = {Compressed sensing (CS), light beam induced current (LBIC)measurements, solar cells, spatial characterization},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {Piscataway, New Jersey},
   language = {30},
   ISSN = {2156-3381, 2156-3403},
   DOI = {10.1109/JPHOTOV.2016.2646900},
   stag_bib_extends_levelofaccess = {NA},
   author = {Betts, TR and Bliss, M and Hall, SRG and Cashmore, M and Koutsourakis, G and Gottschalg, R}
}

@Article { MartinezVerduLAKOGKJFSPSC2017,
   title = {Multilateral spectral radiance factor scale comparison},
   journal = {Applied Optics},
   year = {2017},
   month = {3},
   volume = {56},
   number = {7},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {1996},
   keywords = {BSDF, BRDF, BTDF, Densitometers, reflectometers, Reflection.},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {The Optical Society},
   address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States},
   language = {30},
   ISSN = {0003-6935, 1539-4522},
   DOI = {10.1364/AO.56.001996},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mart{\'i}nez-Verd{\'u}, F. M. and Leloup, F. B. and Audenaert, J. and K{\"a}llberg, S. and Obein, G. and Ged, G. and Koo, A. and Jaanson, P. and Ferrero, A. and Strothk{\"a}mper, C. and Perales, E. and Schirmacher, A. and Campos, J.}
}

@Article { MottonenVPTGKL2017,
   title = {Microwave Admittance of Gold-Palladium Nanowires with Proximity-Induced Superconductivity},
   journal = {Advanced Electronic Materials},
   year = {2017},
   month = {3},
   volume = {3},
   number = {6},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   pages = {1600227},
   keywords = {proximity Josephson junction, microwave admittance},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/aelm.201600227/abstract},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {2199-160X},
   DOI = {10.1002/aelm.201600227},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\"o}tt{\"o}nen, M. and Virtanen, P. and Partanen, M. and Tan, K.Y. and Govenius, J. and Kokkoniemi, R. and Lake, R.E.}
}

@Article { SchumacherACMMCKMSCK2017,
   subid = {252},
   title = {Magnetic scanning gate microscopy of CoFeB lateral spin valve},
   journal = {AIP Advances},
   year = {2017},
   month = {3},
   volume = {7},
   number = {5},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {056808},
   keywords = {AbstractDevices comprised of CoFeB nanostructures with perpendicular magnetic anisotropy and non-magnetic Ta channel were operated in thermal lateral spin valve (LSV) mode and studied by magnetotransport measurements and magnetic scanning gate microscopy (SGM). Due to the short spin diffusion length of Ta, the spin diffusion signal was suppressed, allowing the study of the contribution from the anomalous Nernst (ANE) and anomalous Hall effects (AHE). The magnetotransport measurements identified the switching fields of the CoFeB nanostructures and demonstrated a combination of AHE and ANE when the devices were operated in thermally-driven spin-injection mode. Modified scanning probe microscopy probes were fabricated by placing a NdFeB magnetic bead (MB) on the apex of a commercial Si probe. The dipole magnetic field distribution around the MB was characterized by using differential phase contrast technique and direct measurement of the switching field induced by the bead in the CoFeB nanodevices. Using SGM we demonstrate the influence of localized magnetic field on the CoFeB nanostructures near the non-magnetic channel. This approach provides a promising route towards the study of thermal and spin diffusion effects using local magnetic fields.},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {2158-3226},
   DOI = {10.1063/1.4977891},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schumacher, H.W. and Antonov, V. and Cowburn, R. and McVitie, S. and McGrouther, D. and Cox, D. and Krzysteczko, P. and Mansell, R. and Scarioni, A.F. and Corte-Le{\'o}n, H. and Kazakova, O.}
}

@Article { EbertWQN2017,
   title = {Interband cascade laser-based optical transfer standard for atmospheric carbon monoxide measurements},
   journal = {Applied Optics},
   year = {2017},
   month = {3},
   volume = {56},
   number = {11},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {E84},
   keywords = {optical transfer standard, CO measurement},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {0003-6935, 1539-4522},
   DOI = {10.1364/AO.56.000E84},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ebert, V. and Werhahn, O. and Qu, Z. and Nwaboh, J.A.}
}

@Article { SchaepmanSKDH2017,
   title = {Field and Airborne Spectroscopy Cross Validation—Some Considerations},
   journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing},
   year = {2017},
   month = {3},
   volume = {10},
   number = {3},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {1117-1135},
   keywords = {Spectroscopy, Atmospheric measurements, Uncertainty, Surface treatment, Vegetation mapping, Measurement uncertainty, Instruments},
   web_url = {https://ieeexplore.ieee.org/document/7582439/keywords},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {1939-1404, 2151-1535},
   DOI = {10.1109/JSTARS.2016.2593984},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schaepman, M.E. and Schlapfer, D. and Kneubuehler, M. and Damm, A. and Hueni, A.}
}

@Article { WollschlagerHBGLP2017,
   title = {Note: Nanomechanical characterization of soft materials using a micro-machined nanoforce transducer with an FIB-made pyramidal tip},
   journal = {Review of Scientific Instruments},
   year = {2017},
   month = {3},
   volume = {88},
   number = {3},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   pages = {036104},
   keywords = {MEMS, nanoindentation, soft materials},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.4977474},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wollschl{\"a}ger, N. and Hiller, K. and Brand, U. and Gao, S. and Li, Z. and Pohlenz, F.}
}

@Proceedings { LiSLHZYTSHTFKS2017,
   subid = {1123},
   title = {Random-telegraph-noise by resonant tunnelling at low temperatures},
   journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)},
   year = {2017},
   month = {2},
   day = {28},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Random-telegraph-noise, charge trap, low temperatures},
   web_url = {https://eprints.soton.ac.uk/418401/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Toyama},
   event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)},
   event_date = {28-02-2017 to 02-03-2017},
   language = {30},
   DOI = {10.1109/EDTM.2017.7947569},
   stag_bib_extends_levelofaccess = {NA},
   author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Zeimpekis, I. and Yoshimoto, H. and Tani, K. and Sasago, Y. and Hisamoto, D. and Tsuchiya, Y. and Fletcher, J.D. and Kataoka, M. and Saito, S.}
}

@Proceedings { LiSBFKHTLS2017,
   subid = {1124},
   title = {Transport properties in silicon nanowire transistors with atomically flat interfaces},
   journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)},
   year = {2017},
   month = {2},
   day = {28},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {narrow channel effect, silicon nanowire, SOI, TMAH, self-limiting oxidation},
   web_url = {https://eprints.soton.ac.uk/402316/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Toyama},
   event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)},
   event_date = {28-02-2017 to 02-03-2017},
   language = {30},
   DOI = {10.1109/EDTM.2017.7947561},
   stag_bib_extends_levelofaccess = {NA},
   author = {Li, Z. and Sotto, M.S.H. and Burt, D. and Fletcher, J.D. and Kataoka, M. and Husain, M.K. and Tsuchiya, Y. and Liu, F. and Saito, S.}
}

@Article { deLauretoBPSSFD2017,
   subid = {453},
   title = {\(\alpha\)-Synuclein structural features inhibit harmful polyunsaturated fatty acid oxidation, suggesting roles in neuroprotection},
   journal = {Journal of Biological Chemistry},
   year = {2017},
   month = {2},
   day = {23},
   volume = {292},
   number = {17},
   number2 = {15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases},
   pages = {6927-6937},
   keywords = {\(\alpha\)-synuclein (\(\alpha\)-synuclein), lipid oxidation, mass spectrometry, (MS) polyunsaturated fatty acid (PUFA), protein chemical modification},
   web_url = {http://www.jbc.org/content/292/17/6927},
   misc2 = {EMPIR 2015: Health},
   publisher = {American Society for Biochemistry \& Molecular Biology (ASBMB)},
   language = {30},
   ISSN = {0021-9258, 1083-351X},
   DOI = {10.1074/jbc.M116.765149},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Laureto, P.P. and Bellotti, V. and Proukakis, C. and Schapira, A.H.V. and Sharon, R. and Fecchio, C. and De Franceschi, G.}
}

@Proceedings { GrobnerVKEI2017,
   title = {Monte Carlo analysis of uncertainty of total atmospheric ozone derived from measured spectra},
   journal = {AIP Conference Proceedings},
   year = {2017},
   month = {2},
   day = {22},
   volume = {1810},
   number = {1},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {110005},
   keywords = {Monte Carlo, TOC, Ozone, Uncertainty, Spectral irradiance},
   web_url = {http://aip.scitation.org/toc/apc/1810/1?size=all\&expanded=1810},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {American Institute of Physics},
   event_place = {The University of Auckland},
   event_name = {International Radiation Symposium},
   event_date = {16-04-2016 to 22-04-2016},
   language = {30},
   ISBN = {978-0-7354-1478-5},
   ISSN = {1551-7616},
   DOI = {10.1063/1.4975567},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gr{\"o}bner, J. and Vaskuri, A. and K{\"a}rh{\"a}, P. and Egli, L. and Ikonen, E.}
}

@Article { ,
   title = {The new INRIM rotating encoder angle comparator (REAC)},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {2},
   day = {16},
   volume = {28},
   number = {4},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-10},
   keywords = {angle metrology, angle encoder, absolute encoder, nanoradians, autocollimators},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa5af6},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing Ltd.},
   address = {Bristol BS1 6HG, United Kingdom},
   language = {30},
   ISSN = {Online ISSN: 1361-6501,  Print ISSN: 0957-0233},
   DOI = {10.1088/1361-6501/aa5af6},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Pisani, M and Astrua, M}
}

@Article { YacootRPCHCL2017,
   title = {Laser source for dimensional metrology: investigation of an iodine stabilized system based on narrow linewidth 633 nm DBR diode},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {2},
   day = {16},
   volume = {28},
   number = {4},
   number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom},
   pages = {045204},
   keywords = {optical metrology, DBR laser diode, frequency stabilization, laser interferometry, dimensional metrology, iodine stabilization, displacement measurement},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   address = {Temple Circus,Temple Way, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa5ab9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yacoot, Andrew and Rerucha, Simon and Pham, Tuan M and Cizek, Martin and Hucl, Vaclav and Č{\'i}p, Ondřej and Lazar, Josef}
}

@Article { PalafoxBH2017,
   title = {A Josephson Impedance Bridge Based on Programmable Josephson Voltage Standards},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {2},
   day = {16},
   volume = {66},
   number = {6},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {1539 - 1545},
   keywords = {mpedance, Josephson array, programmable Josephson system,  Bridge circuits, Impedance, Uncertainty, Transient analysis, Standards, Measurement uncertainty, Frequency measurement},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {445 Hoes Lane Piscataway NJ 08855-1331},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2659898},
   stag_bib_extends_levelofaccess = {NA},
   author = {Palafox, L. and Behr, R. and Hagen, T.}
}

@Article { ClarksonCSC2017,
   title = {Enhancing Prony’s method by nuclear norm penalization and extension to missing data},
   journal = {Signal, Image and Video Processing},
   year = {2017},
   month = {2},
   day = {16},
   volume = {2017},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   pages = {1-8},
   keywords = {Convex relaxation, Nuclear Norm, Hankel approximation, Prony’s method, Exponential sums, Signal approximation, Missing Data},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1863-1703, 1863-1711},
   DOI = {10.1007/s11760-017-1062-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clarkson, Paul and Chr{\'e}tien, St{\'e}phane and Sarray, Basad Al and Cottez, Guillaume}
}

@Article { RobinsonSGWZMRLHSY2017,
   title = {1.5 \(\mu\)m lasers with sub 10 mHz linewidth},
   journal = {APS Physics},
   year = {2017},
   month = {2},
   day = {15},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   keywords = {tiem and frequency metrology, ultra-stable laser, oprical clock},
   web_url = {https://arxiv.org/abs/1702.04669},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   language = {30},
   DOI = {10.1103/PhysRevLett.118.263202},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, J.M.  and Sonderhouse, L. and Grebing, C. and Weyrich, R.  and Zhang, W. and Matei, D.G. and Riehle, F. and Legero, T. and H{\"a}fner, S. and Sterr, U. and Ye, J.}
}

@Article { EswardSEE2017,
   subid = {390},
   title = {Evaluation of dynamic measurement uncertainty – an open-source software package to bridge theory and practice},
   journal = {Journal of Sensors and Sensor Systems},
   year = {2017},
   month = {2},
   day = {14},
   volume = {6},
   number = {1},
   number2 = {14SIP08: Dynamic: Standards and software to maximise end user uptake of NMI calibrations of dynamic force, torque and pressure sensors},
   pages = {97-105},
   keywords = {dynamic measurement, uncertainty, digital filtering, PyDynamic, software},
   web_url = {https://www.j-sens-sens-syst.net/6/97/2017/jsss-6-97-2017.pdf},
   misc2 = {EMPIR 2014: Support for Impact},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {2194-878X},
   DOI = {10.5194/jsss-6-97-2017},
   stag_bib_extends_levelofaccess = {NA},
   author = {Esward, T.J. and Smith, I.M. and Elster, C. and Eichst{\"a}dt, S.}
}

@Article { ,
   title = {Lattice reorientation in tetragonal PMN-PT thin film induced by focused ion beam preparation for transmission electron microscopy},
   journal = {Journal of Applied Physics 121, 055302 (2017); doi: 10.1063/1.4975114},
   year = {2017},
   month = {2},
   volume = {121, 055302 (2017);},
   number = {121, 055302 (2017);},
   number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale},
   pages = {not provided in pdf},
   keywords = {Lattice reorientation  tetragonal PMN-PT},
   web_url = {http://aip.scitation.org/doi/abs/10.1063/1.4975114},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {American Institute of Physics},
   address = {Not provided},
   language = {30},
   ISSN = {055302},
   DOI = {10.1063/1.4975114},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Thibaud Denneulin, and Wanjoo Maeng, and Chang-Beom Eom, and and Martin H{\"y}tch}
}

@Article { DrungSK2017,
   subid = {12},
   title = {Measurement of sub-picoampere direct currents with uncertainties below ten attoamperes},
   journal = {Review of Scientific Instruments},
   year = {2017},
   month = {2},
   volume = {88},
   number = {2},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {024711},
   keywords = {ULCA, ultrastable low-noise current amplifier, single-electron transport pumps, measurement uncertainty},
   web_url = {http://www.e-si-amp.eu/outputs/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.4975826},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Drung, D. and Scherer, H. and Krause, C.}
}

@Article { VilloingMGB2017,
   subid = {92},
   title = {Internal dosimetry with the Monte Carlo code GATE: validation using the ICRP/ICRU female reference computational model},
   journal = {Physics in Medicine and Biology},
   year = {2017},
   month = {2},
   volume = {62},
   number = {5},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   pages = {1885-1904},
   keywords = {Monte Carlo modelling, internal dosimetry, GATE, MCNPX, voxelized models},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/62/5/1885},
   stag_bib_extends_levelofaccess = {NA},
   author = {Villoing, D and Marcatili, S and Garcia, M-P and Bardi{\`e}s, M}
}

@Proceedings { Hafner2017,
   title = {Development Of A Reference Method For The Analysis Of Total Silicon Content In Biogas},
   journal = {XI Conference of Chemists, Technologists and Environmentalists of Republic of SRPSKA Proceedings},
   year = {2017},
   month = {2},
   number2 = {ENG54: Biogas: Metrology for biogas},
   pages = {49-57},
   keywords = {biogas, siloxanes, microwave plasma atomic emission},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {University of Banja Luka  Faculty of Technology  Banja Luka},
   address = {Banja Luka},
   event_place = {Teslić, Bosnia and Herzegovina},
   event_name = {XI Conference of Chemists, Technologists and Environmentalists of Republic of SRPSKA Proceedings},
   event_date = {18-11-2016 to 19-11-2016},
   language = {30},
   ISBN = {978-99938-54-67-8},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {COBISS.RS-ID 6330904},
   author = {Hafner, K.}
}

@Article { StagniRPNNMMLFBBAACZC2017,
   subid = {134},
   title = {A VLBI experiment using a remote atomic clock via a coherent fibre link},
   journal = {Scientific Reports},
   year = {2017},
   month = {2},
   volume = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {40992},
   keywords = {VLBI experiment, remote atomic clock},
   web_url = {https://www.nature.com/articles/srep40992},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   address = {New York},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/srep40992},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stagni, M. and Roma, M. and Perini, F. and Negusini, M. and Nanni, M. and Maccaferri, G. and Mura, A. and Levi, F. and Frittelli, M. and Bortolotti, C. and Bertarini, A. and Artz, T. and Ambrosini, R. and Clivati, C. and Zucco, M. and Calonico, D.}
}

@Article { IbraimETZHHHM2017,
   title = {Tracking nitrous oxide emission processes at a suburban site with semicontinuous, in situ measurements of isotopic composition},
   journal = {Journal of Geophysical Research: Atmospheres},
   year = {2017},
   month = {2},
   volume = {122},
   number = {3},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {1850-1870},
   keywords = {nitrous oxide, isotopic composition},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {2169-897X},
   DOI = {10.1002/2016JD025906},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ibraim, E. and Emmenegger, L. and Tuzson, B. and Zellweger, C. and H{\"u}glin, C. and Henne, S. and Harris, E. and Mohn, J.}
}

@Article { FinlaysonGUBd2017,
   title = {An improved non-contact thermometer and hygrometer with rapid response},
   journal = {Metrologia},
   year = {2017},
   month = {1},
   day = {25},
   volume = {54},
   number = {1},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {S9-S15},
   keywords = {temperature, humidity, non-contact, rapid response, thermometer, hygrometer, TDLAS},
   web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa54c6},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa54c6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Finlayson, A and Gardiner, T and Underwood, R and Bell, S and De Podesta, M}
}

@Article { deClercqGBFMCTY2017,
   title = {High-Performance Coherent Population Trapping Clock with Polarization Modulation},
   journal = {Physical Review Applied},
   year = {2017},
   month = {1},
   day = {25},
   volume = {7},
   number = {1},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   keywords = {Frequency standards, atomic clock, ramsey fringes, dark-line, vapor, laser spectroscopy},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.7.014018},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Clercq, E. and Gu{\'e}randel, S. and Boudot, R. and Fran\c{c}ois, B. and Micalizio, S. and Calosso, C.E. and Tricot, F. and Yun, P.}
}

@Article { JelinekKC2017,
   title = {Study of uncertainties of height measurements of monoatomic steps on Si 5 \(\times\) 5 using DFT},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {1},
   day = {24},
   volume = {28},
   number = {3},
   number2 = {SIB61: CRYSTAL: Crysalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology},
   pages = {034005},
   keywords = {density functional theory, atomic force microscopy, uncertainty},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing},
   address = {Temple Circus, Temple Way,  Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa5075},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jel{\'i}nek, Pavel and Klapetek, Petr and Campbell, Anna Charv{\'a}tov{\'a}}
}

@Article { ,
   title = {Atomic force microscope adhesion measurements and atomistic molecular dynamics simulations at different humidities},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {1},
   day = {23},
   volume = {28},
   number = {3},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   pages = {034004 (10pp)},
   keywords = {Atomic force microscopy, metrology, adhesion, capillary effects, humidity, force measurement},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034004/meta;jsessionid=1CDCAA65608F84971489636A33CB4FD2.c3.iopscience.cld.iop.org},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0957-0233},
   DOI = {10.1088/1361-6501/28/3/034004},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2018-1-23},
   author = {Sepp{\"a}, J and Reischl, B and Sairanen, H and Korpelainen, V and Husu, H and Heinonen, M and Raiteri, P and Rohl, A and Nordlund, K and Lassila, A}
}

@Article { KorpelainenLKLS2017,
   title = {DNA origami structures as calibration standards for nanometrology},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {1},
   day = {23},
   volume = {28},
   number = {3},
   number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology},
   pages = {034001},
   keywords = {atomic force microscopy, DNA nanotechnology, DNA origami, self-assembly},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing},
   address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/28/3/034001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Korpelainen, Virpi and Lassila, Antti and Kostiainen, Mauri A and Linko, Veikko and Sepp{\"a}, Jeremias}
}

@Article { DucourtieuxCBAFF2017,
   title = {Modelling of the X,Y,Z positioning errors and uncertainty evaluation for the LNE's mAFM using the Monte Carlo method},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {1},
   day = {23},
   volume = {28},
   number = {3},
   number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom},
   pages = {034007},
   keywords = {atomic force microscope, metrology, virtual instrument, measurement uncertainty, Monte Carlo method, Morris design, Sobol indices},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   address = {Temple Circus, Temple, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/28/3/034007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ducourtieux, Sebastien and Ceria, Paul and Boukellal, Younes and Allard, Alexandre and Fischer, Nicolas and Feltin, Nicolas}
}

@Article { PfaffenbergerNJK2017,
   subid = {600},
   title = {Generation of synthetic CT data using patient specific daily MR image data and image registration},
   journal = {Physics in Medicine and Biology},
   year = {2017},
   month = {1},
   day = {23},
   volume = {62},
   number = {4},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {1358-1377},
   keywords = {MRgRT, synthetic CT data, MRI, CT, Radiotherapy},
   web_url = {https://doi.org/10.1088/1361-6560/aa5200},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/aa5200},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pfaffenberger, A. and Niebuhr, N.I. and J{\"a}kel, O. and Kraus, K.M.}
}

@Article { MillesSSEGBNL2017,
   title = {Comparing AFM cantilever stiffness measured using the thermal vibration and the improved thermal vibration methods with that of an SI traceable method based on MEMS},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {1},
   day = {23},
   volume = {28},
   number = {3},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   pages = {034010},
   keywords = {cantilever stiffness calibration, active reference spring, micro-electro-mechanical system},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034010/pdf},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/28/3/034010},
   stag_bib_extends_levelofaccess = {NA},
   author = {Milles, L.F. and Stahl, S.W. and Sulzbach, T. and Engl, W. and Gao, S. and Brand, U. and Nesterov, V. and Li, Z.}
}

@Article { ElGawhary2017,
   subid = {366},
   title = {Helmholtz Natural Modes: the universal and discrete spatial fabric of electromagnetic wavefields},
   journal = {New Journal of Physics},
   year = {2017},
   month = {1},
   day = {20},
   volume = {19},
   number = {1},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {013021},
   keywords = {electromagnetic},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/aa57c3},
   stag_bib_extends_levelofaccess = {NA},
   author = {El Gawhary, Omar}
}

@Article { CalonicoLCCMBRTP2017,
   subid = {111},
   title = {Absolute frequency measurement of the 1S0 – 3P0 transition of 171Yb},
   journal = {Metrologia},
   year = {2017},
   month = {1},
   day = {20},
   volume = {54},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {102-112},
   keywords = {optical lattice clock, SI second, frequency metrology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa4e62},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calonico, D and Levi, F and Costanzo, G.A. and Clivati, C and Milani, G and Bregolin, F and Rauf, B and Thoumany, P and Pizzocaro, M}
}

@Article { ElGawhary20170,
   subid = {366},
   title = {Helmholtz Natural Modes: the universal and discrete spatial fabric of electromagnetic wavefields},
   journal = {New Journal of Physics},
   year = {2017},
   month = {1},
   day = {20},
   volume = {19},
   number = {1},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {013021},
   note = {joint publication with ENG53},
   keywords = {electromagnetic},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/aa57c3},
   stag_bib_extends_levelofaccess = {NA},
   author = {El Gawhary, Omar}
}

@Article { NovikovaKGBWLRBMNL2017,
   title = {CASTOR, a new instrument for combined XRR-GIXRF analysis at SOLEIL},
   journal = {X-Ray Spectrometry},
   year = {2017},
   month = {1},
   day = {13},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   keywords = {x-ray},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Wiley-Blackwell},
   address = {111 River Street Hoboken, NJ 07030, USA},
   language = {30},
   ISSN = {0049-8246},
   DOI = {10.1002/xrs.2742},
   stag_bib_extends_levelofaccess = {NA},
   author = {Novikova, A. and Kanngie{\ss}er, B. and Gr{\"o}tzsch, D. and Beckhoff, B. and Weser, J. and Lubeck, J. and Rotella, H. and Boyer, B. and M{\'e}nesguen, Y. and Nolot, E. and L{\'e}py, M.-C.}
}

@Article { JennettAH2017,
   subid = {381},
   title = {Establishing isothermal contact at a known temperature under thermal equilibrium in elevated temperature instrumented indentation testing},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {1},
   day = {13},
   volume = {28},
   number = {2},
   number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials},
   pages = {025016},
   keywords = {nano-indentation, elevated temperature, thermal equilibrium, isothermal contact},
   web_url = {https://pure.coventry.ac.uk/ws/portalfiles/portal/8188288/Establishing_isothermal_contact_accepted_MST_104245_corrected_postprint.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa533d},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jennett, N.M. and Alvarez, C.L.M. and Hou, X.D.}
}

@Article { ,
   title = {Spectroscopic thermometry for long-distance surveying},
   journal = {Applied Optics},
   year = {2017},
   month = {1},
   day = {6},
   volume = {56},
   number = {2},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {239-246},
   keywords = {long-distance surveying, laser absorption spectroscopy, refractive index compensation},
   web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-56-2-239},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {OSA Publishing},
   address = {Washington},
   language = {30},
   ISSN = {1559-128X (print), 2155-3165 (online)},
   DOI = {10.1364/AO.56.000239},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Tomberg, T. and Fordell, T. and Jokela, J. and Merimaa, M. and Hieta, T.}
}

@Article { ,
   title = {Novel high-temperature ferroelectric domain morphology in PbTiO3 ultrathin films},
   journal = {Physical Chemistry Chemical Physics},
   year = {2017},
   month = {1},
   volume = {Issue 6, 2017},
   number = {Issue 6, 2017},
   number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale},
   pages = {Phys. Chem. Chem. Phys., 2017,19, 4243-4250},
   keywords = {high-temperature ferroelectric domain morphology PbTiO3 ultrathin films},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2017/CP/C6CP08157F\#!divAbstract},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {RSC},
   address = {London},
   language = {30},
   ISSN = {Issue 6, 2017},
   DOI = {10.1039/C6CP08157F},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Duffy, Dorothy M. and Kimmel, Anna V. and Chapman,, Jacob B. J.}
}

@Proceedings { DedesD2017,
   subid = {96},
   title = {Narrowing the Confidence Intervals in Nuclear Structure Predictions Through Elimination of Parametric Correlations},
   journal = {Acta Physica Polonica B Proceedings Supplement},
   year = {2017},
   month = {1},
   volume = {10},
   number = {1},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {51-68},
   keywords = {Inverse problemsRegularisation methodNuclear mean field applicationsMonte Carlo methodsPhenomenological Woods-Saxon HamiltonianPb-208},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Jagiellonian University},
   address = {Krakow},
   event_place = {Kazimierz Dolny, Poland},
   event_name = {XXIII Nuclear Physics Workshop “Marie and Pierre Curie” Essential Problems in Nuclear Physics},
   event_date = {27-09-2016 to 02-10-2016},
   language = {30},
   ISSN = {1899-2358, 2082-7865},
   DOI = {10.5506/APhysPolBSupp.10.51},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dedes, I. and Dudek, J.}
}

@Article { Huld2017,
   title = {PVMAPS: Software tools and data for the estimation of solar radiation and photovoltaic module performance over large geographical areas},
   journal = {Solar Energy},
   year = {2017},
   month = {1},
   volume = {142},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {171-181},
   keywords = {Solar radiationPhotovoltaic energyGIS},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0038092X16306089},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   address = {New York},
   language = {30},
   ISSN = {0038-092X},
   DOI = {10.1016/j.solener.2016.12.014},
   stag_bib_extends_levelofaccess = {NA},
   author = {Huld, T.}
}

@Article { CobbenNN2017,
   title = {Basis-Adaptive Sparse Polynomial Chaos Expansion for Probabilistic Power Flow},
   journal = {IEEE Transactions on Power Systems},
   year = {2017},
   month = {1},
   volume = {32},
   number = {1},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   pages = {694-704},
   keywords = {Chaos expansion, probabilistic power flow,},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0885-8950, 1558-0679},
   DOI = {10.1109/TPWRS.2016.2558622},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cobben, J.F.G. and Nguyen, P.H. and Ni, F.}
}

@Article { SchubertHSMTGW2017,
   title = {Angle Dependence of Solar Cells and Modules: The Role of Cell Texturization},
   journal = {IEEE Journal of Photovoltaics},
   year = {2017},
   month = {1},
   volume = {7},
   number = {1},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {19-24},
   keywords = {photovoltaic},
   web_url = {http://ieeexplore.ieee.org/document/7600397/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2156-3381, 2156-3403},
   DOI = {10.1109/JPHOTOV.2016.2614120},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schubert, M.C. and Hohl-Ebinger, J. and Steinkemper, H. and Muller, B. and Tucher, N. and Geisemeyer, I. and Warta, W.}
}

@Article { MihailescuBKC2017,
   subid = {497},
   title = {Key comparison BIPM.RI(I)-K1 of the air-kerma standards of the SCK·CEN, Belgium and the BIPM in 60Co gamma radiation},
   journal = {Metrologia},
   year = {2017},
   month = {1},
   volume = {54},
   number = {1A},
   number2 = {14RPT04: Absorb: Absorbed dose in water and air},
   pages = {06004-06004},
   keywords = {cavity chamber, air kerma reference, comparison},
   misc2 = {EMPIR 2014: Research Potential},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/0026-1394/54/1a/06004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mihailescu, L C and Burns, D and Kessler, C and Chiriotti, S}
}

@Article { BecherLSGCSPHLRK2017_2,
   title = {Experimental realization of an absolute single-photon source based on a single nitrogen vacancy center in a nanodiamond},
   journal = {Optica},
   year = {2017},
   month = {1},
   volume = {4},
   number = {1},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {71},
   keywords = {Metrology, Radiometry, Sources, Photon statistics},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {2334-2536},
   DOI = {10.1364/OPTICA.4.000071},
   stag_bib_extends_levelofaccess = {NA},
   author = {Becher, C. and Lindner, S. and Sandoghdar, V. and G{\"o}tzinger, S. and Chu, X.L. and Smid, M. and Porrovecchio, G. and Hofer, H. and L{\'o}pez, M. and Rodiek, B. and K{\"u}ck, S.}
}

@Article { TengenN2017,
   title = {Uncertainty assessment in geodetic network adjustment by combining GUM and Monte-Carlo-simulations},
   journal = {Journal of Applied Geodesy},
   year = {2017},
   month = {1},
   volume = {11},
   number = {2},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   keywords = {GUM Analysis, Geodetic Network Adjustment, Quality Assessment, Monte-Carlo Simulations, Local Tie},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Walter de Gruyter GmbH},
   language = {30},
   ISSN = {1862-9024, 1862-9016},
   DOI = {10.1515/jag-2016-0017},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tengen, D. and Niemeier, W.}
}

@Article { BuermannR2017,
   subid = {1320},
   title = {Dynamic determination of equivalent CT source models for personalized dosimetry},
   journal = {Current Directions in Biomedical Engineering},
   year = {2017},
   month = {1},
   volume = {3},
   number = {2},
   number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion},
   keywords = {dosimetry, personalised medicine, CT source models},
   misc2 = {EMPIR 2015: Health},
   publisher = {Walter de Gruyter GmbH},
   language = {30},
   ISSN = {2364-5504},
   DOI = {10.1515/cdbme-2017-0167},
   stag_bib_extends_levelofaccess = {NA},
   author = {B{\"u}ermann, L. and Rosendahl, S.}
}

@Inbook { ,
   title = {Total Ozone Data Retrieval from the Phaethon DOAS System},
   year = {2017},
   volume = {2},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {989-994/141},
   keywords = {total ozone, DOAS, Phaethon, Langley},
   web_url = {http://link.springer.com/chapter/10.1007\%2F978-3-319-35095-0_141},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Springer International Publishing},
   address = {Switzerland},
   booktitle = {Perspectives on Atmospheric Sciences},
   language = {30},
   ISBN = {978-3-319-35094-3},
   DOI = {10.1007/978-3-319-35095-0_141},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-12-31},
   author = {Gkertsi, F. and Bais, A.F. and Drosoglou, Th. and Fragkos, K. and Fountoulakis, I. and Kouremeti, N.}
}

@Proceedings { SchmutzLFFGWW2017,
   title = {Direct Solar Irradiance measurements with a Cryogenic Solar Absolute Radiometer},
   journal = {AIP Conference Proceedings},
   year = {2017},
   volume = {1810},
   number = {1},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   keywords = {Radiometers, Error analysis, Solar irradiance, Cryogenics, Electric measurements},
   web_url = {http://aip.scitation.org/doi/abs/10.1063/1.4975538},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {AIP Conference Proceedings},
   address = {Melville},
   event_place = {Auckland, New Zealand},
   event_name = {Proceedings of the International Radiation Symposium (IRC/IAMAS)},
   event_date = {16-04-2016 to 22-04-2016},
   language = {30},
   ISBN = {978-0-7354-1478-5},
   DOI = {10.1063/1.4975538},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmutz, W. and Li, V. and Fox, N. and Finsterle, W. and Graber, F. and Winkler, R. and Walter, B.}
}

@Proceedings { WeidingerBJK2017,
   subid = {243},
   title = {Torque measurement uncertainty in multi-MW nacelle test benches = Messunsicherheit des Drehmomentes in multi-MW Windenergieanlagen Pr{\"u}fst{\"a}nden},
   journal = {3rd Conference for Wind Power Drives},
   year = {2017},
   volume = {1},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   pages = {1-14},
   keywords = {nacelle test bench, FEM simulation, measurement uncertainty},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Books on Demand},
   address = {Norderstedt},
   event_place = {Aachen, Germany},
   event_name = {3rd Conference for Wind Power Drives , Aachen , Germany},
   event_date = {07-03-2017 to 08-03-2017},
   language = {30},
   ISBN = {978-3-7431-3456-0},
   DOI = {10.18154/RWTH-2017-02946},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kock, S. and Jacobs, G. and Bosse, D. and Weidinger, P.}
}

@Article { VavassoriAMCNCPK2017,
   subid = {255},
   title = {V-shaped domain wall probes for calibrated magnetic force microscopy},
   journal = {IEEE Transactions on Magnetics},
   year = {2017},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {1-1},
   keywords = {Probes, Magnetic domains, Magnetic resonance imaging, Magnetic field measurement, Perpendicular magnetic anisotropy, Saturation magnetization},
   web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/vshaped-domain-wall-probes-for-calibrated-magnetic-force-microscopy(9c2d50b1-9b1a-4aae-9b39-ca8c1864daf3).html},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9464, 1941-0069},
   DOI = {10.1109/TMAG.2017.2694324},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vavassori, P. and Antonov, V. and Manzin, A. and Cox, D. and Neu, V. and Corte-Le{\'o}n, H. and Puttock, R. and Kazakova, O.}
}

@Proceedings { Genovese2017,
   subid = {333},
   title = {A few reflections on protective measurements and more},
   journal = {Journal of Physics: Conference Series},
   year = {2017},
   volume = {880},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {012012},
   keywords = {Quantum Measurements},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/880/1/012012/pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing Ltd.},
   event_place = {Castiglioncello (ITALY)},
   event_name = {8th International Workshop DICE2016: Spacetime - Matter - Quantum Mechanics},
   event_date = {12-09-2016 to 16-09-2016},
   language = {30},
   ISSN = {1742-6596},
   DOI = {10.1088/1742-6596/880/1/012012},
   stag_bib_extends_levelofaccess = {NA},
   author = {Genovese, M.}
}

@Proceedings { ZschiedrichGWHBB2017,
   subid = {423},
   title = {Quantifying parameter uncertainties in optical scatterometry using Bayesian inversion},
   journal = {Proc. SPIE},
   year = {2017},
   volume = {10330},
   number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {1033004},
   keywords = {computational  metrology,  optical  metrology,  computational  lithography,  nanolithography,  finite-element methods, nanooptics},
   web_url = {https://arxiv.org/pdf/1707.08467},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Munich},
   event_name = {Modeling Aspects in Optical Metrology VI},
   event_date = {25-06-2017 to 29-06-2017},
   language = {30},
   DOI = {10.1117/12.2270596},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hammerschmidt, M and Weiser, M and Garcia Santiago, X and Zschiedrich, L and Bodermann, B and Burger, S}
}

@Article { CoxD2017,
   subid = {430},
   title = {Uncertainty Analysis in the Calibration of an Emission Tomography System for Quantitative Imaging},
   journal = {Computational and Mathematical Methods in Medicine},
   year = {2017},
   volume = {2017},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   pages = {1-9},
   keywords = {Uncertainty, Calibration,Quantitative Imaging},
   web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5660760/},
   misc2 = {EMPIR 2015: Health},
   publisher = {Hindawi Limited},
   language = {30},
   ISSN = {1748-670X, 1748-6718},
   DOI = {10.1155/2017/9830386},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cox, M. and D’Arienzo, M.}
}

@Proceedings { LinesS2017,
   subid = {509},
   title = {Determining the Quality of Mathematical Software Using Reference Data Sets},
   journal = {Software Quality Management XXV: Achieving Software Quality in Development and in Use},
   year = {2017},
   volume = {XXV},
   number = {1},
   number2 = {15SIP06: ValTrac: Validation of software development and analysis tools using TraCIM},
   pages = {39-52},
   keywords = {Software, Standards, Traceability, TraCIM, ValTraC, Verification},
   web_url = {http://ssudl.solent.ac.uk/id/eprint/3580},
   misc2 = {EMPIR 2015: Support for Impact},
   publisher = {Southampton Solent University},
   event_place = {Southampton},
   event_name = {British Computer Society (BCS) Quality Specialist Group's Annual International Software Quality Management (SQM) Conference},
   event_date = {10-04-2017 to 11-04-2017},
   language = {30},
   ISBN = {978-0-9932889-6-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lines, Keith J. and Smith, Ian M.}
}

@Proceedings { 7113ed82b02017_2,
   title = {Comparison of Primary and Secondary Solar Cell Calibrations},
   journal = {Proceedings of the 33rd European PV Solar Energy Conference and Exhibition (EU PVSEC 2017)},
   year = {2017},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {1544 - 1547},
   keywords = {Calibration, Spectral Response, Characterisation, Characterization, Experimental Methods},
   misc2 = {EMRP A169: Call 2013 Energy II},
   event_place = {Amsterdam, Netherlands},
   event_name = {33rd European PV Solar Energy Conference and Exhibition},
   event_date = {25-09-2017 to 29-09-2017},
   language = {30},
   DOI = {10.4229/EUPVSEC20172017-5BV.4.5},
   stag_bib_extends_levelofaccess = {NA}
}

@Proceedings { Grum2017,
   subid = {593},
   title = {Traceable calibration of automatic weighing instruments in dynamic operation},
   journal = {18th International Congress of Metrology},
   year = {2017},
   number2 = {14RPT02: AWICal: Traceable calibration of automatic weighing instruments operating in the dynamic mode},
   keywords = {traceability, calibration, automatic weighing instruments, dynamic operation, uncertainty},
   misc2 = {EMPIR 2014: Research Potential},
   publisher = {EDP Sciences},
   event_place = {Paris},
   event_name = {18th International Congress of Metrology},
   event_date = {19-09-2017 to 21-09-2017},
   language = {30},
   DOI = {10.1051/metrology/201714001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Grum, M.}
}

@Article { MuelanerRYM2017,
   title = {Thermal compensation for large volume metrology and structures},
   journal = {International Journal of Metrology and Quality Engineering},
   year = {2017},
   volume = {8},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {21},
   keywords = {thermal compensation, large volume metrology, finite element analysis , assembly},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {EDP Sciences},
   language = {30},
   ISSN = {2107-6847},
   DOI = {10.1051/ijmqe/2017004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Muelaner, J. and Ross-Pinnock, D. and Yang, B. and Mullineux, G.}
}

@Proceedings { VenceljPGB2017,
   title = {MetroERM - Metrology for Radiological Early Warning Networks in Europe},
   journal = {Proceedings of the eleventh symposium of the Croatian radiation protection association},
   year = {2017},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {175-181},
   keywords = {MetroERM, dose rate equivalent rate, radioactivity concentrations in air and ground},
   misc2 = {EMRP A169: Call 2013 Environment II},
   event_place = {Osijek, Croatia},
   event_name = {11th Symposium Of The Croatian Radiation Protection Association},
   event_date = {05-04-2017 to 07-04-2017},
   language = {30},
   ISSN = {1849 - 5060},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vencelj, M. and Petrovič, T. and Glavič - Cindro, D. and Brodnik, D.}
}

@Proceedings { RoskeTL2017,
   title = {Practical applications of an enhanced uncertainty model for build-up systems},
   journal = {IMEKO-TC3-2017},
   year = {2017},
   number2 = {SIB63: Force: Force traceability within the meganewton range},
   keywords = {Transfer standard, force measurement, buildup system},
   web_url = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-012.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Helsinki Finland},
   event_name = {IMEKO 23rd TC3, 13th TC5 and 4th TC22 International Conference},
   event_date = {30-05-2017 to 01-06-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-012.pdf},
   author = {R{\"o}ske, D. and Tegtmeier, F. and Lang, W.}
}

@Proceedings { Medina2017,
   title = {Validity of extrapolation based on polynomial approximations},
   journal = {IMEKO-TC3-2017},
   year = {2017},
   number2 = {SIB63: Force: Force traceability within the meganewton range},
   keywords = {Extrapolation, sensor, polynomial approximation, partial range},
   web_url = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-005.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Helsinki Finland},
   event_name = {IMEKO 23rd TC3, 13th TC5 and 4th TC22 International Conference},
   event_date = {30-05-2018 to 01-06-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-005.pdf},
   author = {Medina, N.}
}

@Article { MillerCL2017_2,
   subid = {310},
   title = {A millimeter wave MIMO testbed for 5G communications},
   journal = {IEEE},
   year = {2017},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {Link Assessment, Millimeter Wave, MIMO, 5G Communications},
   web_url = {http://arxiv.org/abs/1809.07805},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/ARFTG.2017.8000845},
   stag_bib_extends_levelofaccess = {NA},
   author = {Miller, P. and Cheadle, D. and Loh, T.H.}
}

@Article { PlimmerOHB2017,
   subid = {809},
   title = {A high-accuracy working standard for absolute pressure from 5 kPa to 130 kPa},
   journal = {International Journal of Metrology and Quality Engineering},
   year = {2017},
   volume = {8},
   number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range},
   pages = {26},
   keywords = {absolute pressure, calibration, working standard, capacitance diaphragm gauge,  resonantsilicon gauge},
   misc2 = {EMPIR 2014: Industry},
   publisher = {EDP Sciences},
   language = {30},
   ISSN = {2107-6847},
   DOI = {10.1051/ijmqe/2017020},
   stag_bib_extends_levelofaccess = {NA},
   author = {Plimmer, M. and Otal, P. and Huret, S. and Boineau, F.}
}

@Article { Nopchinda2017,
   subid = {792},
   title = {An active load-pull technique creating time-variant impedances to emulate coupling between power amplifiers},
   journal = {IEEE},
   year = {2017},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {5G mobile communication, arrays, power amplifiers, coupling, distortion, load-pull},
   web_url = {https://research.chalmers.se/publication/253655/file/253655_Fulltext.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/MWSYM.2017.8058889},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nopchinda, D.}
}

@Article { BuismanTGF2017_2,
   subid = {813},
   title = {Vector-corrected nonlinear multi-port IQ-mixer characterization using modulated signals},
   journal = {IEEE},
   year = {2017},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {Microwave measurement, Nonlinear distortion, Mixers, Frequency-domain analysis, Time-domain analysis},
   web_url = {https://research.chalmers.se/publication/248288/file/248288_Fulltext.pdf},
   misc2 = {EMPIR 2014: Industry},
   language = {30},
   DOI = {10.1109/MWSYM.2017.8058888},
   stag_bib_extends_levelofaccess = {NA},
   author = {Buisman, K. and Thorsell, M. and Gustafsson, S. and Fager, C.}
}

@Proceedings { KockF2017,
   subid = {242},
   title = {Measurement uncertainty evaluation of torque measurements in nacelle test benches},
   journal = {Conference Proceedings IMEKO 23rd TC3, 13th TC5 and 4 th TC22 International Conference},
   year = {2017},
   number = {2017},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   keywords = {torque measurement, measurement, uncertainty, nacelle test bench calibration, wind energy},
   web_url = {https://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-010.pdf},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Helsinki Finland},
   event_name = {IMEKO 23rd TC3, 13th TC5 and 4 th TC22 International Conference},
   event_date = {30-05-2017 to 01-06-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-010.pdf},
   author = {Kock, S. and Foyer, G.}
}

@Proceedings { SebastianSML2017,
   subid = {245},
   title = {Torque traceability for nacelle’s test benches: a design proposal},
   journal = {Conference Proceedings IMEKO 23rd TC3, 13th TC5 and 4 th TC22 International Conference},
   year = {2017},
   number = {2017},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   keywords = {wind turbine, torque, standard, nacelle test bench},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Helsinki Finland},
   event_name = {IMEKO 23rd TC3, 13th TC5 and 4th TC22 International Conference},
   event_date = {30-05-2017 to 01-06-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-004.pdf},
   author = {Sebasti{\'a}n, M.A. and S{\'a}enz, M.A. and Medina, N. and Lorente, R.M.}
}

@Proceedings { KummeWKS2017,
   subid = {876},
   title = {New perspectives for MN·m torque measurement in PTB},
   journal = {Conference Proceedings IMEKO 23rd TC3, 13th TC5 and 4 th TC22 International Conference},
   year = {2017},
   number = {2017},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   keywords = {torque, calibration, transfer standard, wind energy, nacelle test bench},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Helsinki Finland},
   event_name = {IMEKO 23rd TC3, 13th TC5 and 4th TC22 International Conference},
   event_date = {30-05-2017 to 01-06-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-045.pdf},
   author = {Kumme, R. and Weidinger, P. and Kahmann, H. and Schlegel, C.}
}

@Article { CoppolaCGMBGOS2017,
   subid = {931},
   title = {Measurement of macro-scale indentation modulus using the primary hardness standard machines at INRIM},
   journal = {IMEKO},
   year = {2017},
   number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials},
   keywords = {Hardness, indentation modulus, macro-scale.},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Imeko},
   address = {.},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc5-2017/IMEKO-TC5-2017-001.pdf},
   author = {Coppola, G. and Cagliefo, R. and Genta, G. and Maizza, G. and Barbato, G. and Germak, A. and Origlia, C. and  Schiavi, A.}
}

@Proceedings { PavanelloCLS2017,
   subid = {966},
   title = {Comparison of Electrical Performance of Bifacial Silicon PV Modules},
   journal = {Proceedings of EUPVSEC 2017},
   year = {2017},
   volume = {5CO.7.3},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   keywords = {Bifacial, c-Si, n-Type, Energy Performance, PV Modules},
   web_url = {https://www.eupvsec-proceedings.com/proceedings?paper=43071},
   misc2 = {EMPIR 2016: Energy},
   event_place = {Amsterdam, the Netherlands},
   event_name = {33rd European Photovoltaic Solar Energy Conference and Exhibition},
   event_date = {25-09-2017 to 29-09-2017},
   language = {30},
   ISBN = {3-936338-47-7},
   DOI = {10.4229/EUPVSEC20172017-5CO.7.3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pavanello, D. and Casado, A. and Lopez-Garcia, J. and Sample, T.}
}

@Article { BojkovskiOKMSISFZSSJoHHPV2017,
   subid = {1095},
   title = {Expansion of European research capabilities in humidity measurement},
   journal = {18th International Congress of Metrology},
   year = {2017},
   number = {2017 18th},
   number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement},
   pages = {4/06006},
   keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison},
   web_url = {https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {EDP Sciences},
   language = {30},
   DOI = {10.1051/metrology/201706006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bojkovski, J. and Oguz Aytekin, S. and Karaboce, N. and Mac Lochlainn, D. and Simic, S. and Iacomini, L. and Smorgon, D. and Fernicola, V. and Zvizdić, D. and Sestan, D. and Strnad, R. and Jandrić, N. and Čohodarević, S. and Hodzic, N. and Hudoklin, D. and Petrušova, O. and Vukičević, T.}
}

@Proceedings { PokatilovPNETLICDYNPVTC2017_2,
   subid = {1152},
   title = {EMPIR project TracePQM: Traceability routes for electrical power quality measurements},
   journal = {18th International Congress of Metrology},
   year = {2017},
   number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements},
   pages = {8},
   keywords = {power quality; metrology; power; traceability; measurement},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {EDP Sciences},
   event_place = {Paris},
   event_name = {18th International Congress of Metrology},
   event_date = {19-09-2017 to 21-09-2017},
   language = {30},
   DOI = {10.1051/metrology/201704001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pokatilov, A. and Philominraj, A. and Ndilimabaka, H. and Ellingsberg, K. and Trinchera, B. and Lončarević, J. and Ilić, D. and Caballero Santos, R. and Diaz de Aguilar, J. and Yovcheva, A. and Nov{\'a}kov{\'a} Zachovalov{\'a}, V. and Power, O. and Voljc, B. and Tarasso, V. and \c{C}aycı, H.}
}

@Article { NeumaierKBD2016,
   title = {Characterization of detector-systems based on CeBr3, LaBr3, SrI2 and CdZnTe for the use as dosemeters},
   journal = {Radiation Physics and Chemistry},
   year = {2016},
   month = {12},
   day = {31},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   keywords = {Environmental monitoring, Scintillation detectors, Monte-Carlo simulations},
   misc2 = {EMRP A169: Call 2013 Environment II},
   language = {30},
   DOI = {10.1016/j.radphyschem.2016.12.015},
   stag_bib_extends_levelofaccess = {NA},
   author = {Neumaier, S. and Kessler, P. and Behnke, B. and Dombrowski, H.}
}

@Article { ,
   title = {Comparison of the performance of a microwave-based and an NMR-based biomaterial moisture measurement instrument},
   journal = {ACTA IMEKO},
   year = {2016},
   month = {12},
   day = {30},
   volume = {5},
   number = {4},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {88-99},
   keywords = {moisture measurement, bioenergy, microwave, NMR, Loss-on-Drying},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {International Measurement Confederation (IMEKO)},
   address = {Budapest},
   language = {30},
   ISSN = {2221-870X},
   DOI = {10.21014/acta_imeko.v5i4.391},
   extern = {1},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-05\%20\%282016\%29-04-14/pdf},
   author = {{\"O}sterberg, Petri and Heinonen, Martti and Ojanen-Saloranta, Maija and M{\"a}kynen, Anssi and {\"O}sterberg, Petri}
}

@Article { MaringerWKSB2016,
   title = {Study of particular problems appearing in NORM samples and recommendations for best practice gamma-ray spectrometry},
   journal = {Applied Radiation and Isotopes},
   year = {2016},
   month = {12},
   day = {28},
   volume = {126},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {285-288},
   keywords = {Gamma-ray spectrometry; NORM; Spectral interference; Radon tightness},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0969804316304961},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier},
   language = {30},
   DOI = {10.1016/j.apradiso.2016.12.035},
   stag_bib_extends_levelofaccess = {NA},
   author = {Maringer, F.J. and Wiedner, H. and Kabrt, F. and Stietka, M. and Baumgartner, A.}
}

@Article { GarciaToranoMCPWM2016,
   title = {Application of an artificial neural network for evaluation of activity concentration exemption limits in NORM industry},
   journal = {Applied Radiation and Isotopes},
   year = {2016},
   month = {12},
   day = {27},
   volume = {126},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {289-292},
   keywords = {Artificial neural network; ANN; Exemption limit; NORM; Monte Carlo; Gamma-spectrometry; PENELOPE; PENNUC},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0969804316304985},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier},
   language = {30},
   DOI = {10.1016/j.apradiso.2016.12.044},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garc{\'i}a-Tora{\~n}o, E. and Mejuto, M. and Crespo, T. and Peyres, V. and Wiedner, H. and Maringer, F.J.}
}

@Article { CuenatCMSHKSWK2016,
   subid = {249},
   title = {Combined anomalous Nernst effect and thermography studies of ultrathin CoFeB/Pt nanowires},
   journal = {AIP Advances},
   year = {2016},
   month = {12},
   day = {22},
   volume = {7},
   number = {5},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {055904},
   keywords = {Abstract: Using electrical and thermal measurements, we present a method for characterising the anomalous Nernst effect (ANE) within nanoscale devices implementing perpendicular anisotropy materials. Perpendicularly magnetised CoFeB/Pt nanowires were fabricated in close proximity to Pt heater elements on an electrically insulating substrate. The voltages induced within the magnetic material as a result of the ANE were recorded for increasing heater powers, and for both out-of-plane saturated states of the device. Scanning thermal probe microscopy was used to map the temperature distribution within the region of the device at a range of heater powers. By analysing the results from each thermography measurement, it was possible to correlate the temperature gradient induced at the magnetic nanowire against the anomalous Nernst voltage measured within the device. For the particular material, geometry and substrate used, a Nernst coefficient value KN = 2.3 \(\mu\)V(K.T)-1 was calculated. This combination of measurements can provide a powerful tool to characterise the ANE within a number of nanoscale systems, a necessary task for the future implementation and optimisation of the effect within spin-caloritronic devices.},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {2158-3226},
   DOI = {10.1063/1.4973196},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cuenat, A. and Cowburn, R. and Mansell, R. and Schumacher, H.W. and Hu, X. and Krzysteczko, P. and Selezneva, E. and Wells, J. and Kazakova, O.}
}

@Article { GersterSSPGBWULHSP2016,
   subid = {11},
   title = {Robustness of single-electron pumps at sub-ppm current accuracy level},
   journal = {Metrologia},
   year = {2016},
   month = {12},
   day = {20},
   volume = {54},
   number = {1},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {S1-S8},
   keywords = {single-electron pumps, small-current measurement,},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/54/1/S1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gerster, T and Scherer, H and Stein, F and Pesel, E and G{\"o}tz, M and Behr, R and Weimann, T and Ubbelohde, N and Leicht, C and Hohls, F and Schumacher, H W and Pierz, K}
}

@Article { PenttilaRGPMKMHP2016,
   subid = {94},
   title = {Traceable Coulomb blockade thermometry},
   journal = {Metrologia},
   year = {2016},
   month = {12},
   day = {20},
   volume = {54},
   number = {1},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {69-76},
   keywords = {Coulomb blockade thermometry, primary thermometer, traceability, thermodynamic temperature},
   web_url = {https://arxiv.org/abs/1609.06943v2},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa4f84},
   stag_bib_extends_levelofaccess = {NA},
   author = {Penttil{\"a}, J and Roschier, L and Gunnarsson, D and Prunnila, M and Meschke, M and Kemppinen, A and Mykk{\"a}nen, E and Hahtela, O and Pekola, J}
}

@Article { ,
   title = {Alternative Conducted Immunity Tests},
   journal = {IEEE Electromagnetic Compatibility Magazine},
   year = {2016},
   month = {12},
   day = {15},
   volume = {5},
   number = {3},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {45-51},
   keywords = {Alternative, Current Probe, CDN, Conducted Immunity, EMC, High Current, Industry, Mains Impedance},
   web_url = {http://ieeexplore.ieee.org/document/7764249/},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {USA},
   language = {30},
   ISSN = {2162-2272},
   DOI = {10.1109/MEMC.0.7764249},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {\c{C}akır, Soydan and Şen, Osman and ACAK, Savaş and AZPURUA, Marco and SILVA, Ferran and \c{C}etintaş, Mustafa}
}

@Article { LepratDBSP2016,
   subid = {66},
   title = {Practical Quantum Realization of the Ampere from the Elementary Charge},
   journal = {Physical Review X},
   year = {2016},
   month = {12},
   day = {12},
   volume = {6},
   number = {4},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {041051},
   keywords = {Quantum current source, realization of the ampere, programmable Josephson voltage standard, quantum Hall resistance standard, cryogenic current comparator, SI},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   address = {New York, USA},
   language = {30},
   ISSN = {2160-3308},
   DOI = {10.1103/PhysRevX.6.041051},
   stag_bib_extends_levelofaccess = {NA},
   author = {Leprat, D. and Djordjevic, S. and Brun-Picard, J. and Schopfer, F. and Poirier, W.}
}

@Proceedings { ,
   title = {Influencia del Tama{\~n}o de Pigmento en la Distancia de Detecci{\'o}n del Sparkle},
   journal = {Resumen de la Contribuciones. XI Reuni{\'o}n Nacional de {\'O}ptica},
   year = {2016},
   month = {12},
   day = {10},
   volume = {1},
   number = {1},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {168},
   keywords = {size pigment, sparkle, visual detection},
   web_url = {-},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Universidad de Salamanca},
   address = {Salamanca},
   event_place = {Salamanca, Spain},
   event_name = {XI Reuni{\'o}n Nacional de {\'O}ptica},
   event_date = {01-09-2015 to 03-09-2015},
   language = {112},
   ISBN = {978-84-608-4609-3},
   ISSN = {-},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {G{\'o}mez, O. and Perales, E. and Chorro, E. and Viqueira, V. and Mart{\'i}nez-Verd{\'u}, F.M. and Ferrero, A. and Campos, J.}
}

@Proceedings { ,
   title = {Evaluaci{\'o}n de la f{\'o}rmula de diferencia de color AUDI2000: an{\'a}lisis del croma},
   journal = {Res{\'u}menes de las contribuciones. XI Reuni{\'o}n Nacional de {\'O}ptica},
   year = {2016},
   month = {12},
   day = {10},
   volume = {1},
   number = {1},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {171},
   keywords = {goniochromatism, AUDI2000 color difference formula, STRESS},
   web_url = {-},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Universidad de Salamanca},
   address = {Salamnaca},
   event_place = {Salamanca},
   event_name = {XI Reuni{\'o}n Nacional de {\'O}ptica},
   event_date = {01/09/2015 to 03/09/2015},
   language = {112},
   ISBN = {978-84-608-4609-3},
   ISSN = {-},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Perales, E. and Chorro, E. and G{\'o}mez, O. and Viqueira, V. and Mart{\'i}nez-Verd{\'u}, F.M. and G{\'o}mez-Robledo, L. and Melgosa, M.}
}

@Proceedings { ,
   title = {Comparaci{\'o}n de las propiedades fotom{\'e}tricas y colorim{\'e}tricas  de diferentes cabinas de iluminaci{\'o}n},
   journal = {Res{\'u}menes de las contribuciones. XI Reuni{\'o}n Nacional de {\'O}ptica},
   year = {2016},
   month = {12},
   day = {10},
   volume = {1},
   number = {1},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {170},
   keywords = {lighting booths, goniochromatism, color rendering},
   web_url = {-},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Universidad de Salamanca},
   address = {Salamanca},
   event_place = {Salamanca, Spain},
   event_name = {XI Reuni{\'o}n Nacional de {\'O}ptica},
   event_date = {01-09-2015 to 03-09-2015},
   language = {112},
   ISBN = {978-84-608-4609-3},
   ISSN = {-},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Perales, E. and Chorro, E. and Viqueira, V. and Mart{\'i}nez-Verd{\'u}, F.M.}
}

@Article { ,
   title = {Transient photocurrent and photovoltage mapping for characterisation of defects in organic photovoltaics},
   journal = {Solar Energy Materials and Solar Cells},
   year = {2016},
   month = {12},
   day = {2},
   volume = {161},
   number = {November 2016},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {89-95},
   keywords = {Printed solar cells, Organic photovoltaics, Defects, Transient photovoltage, Transient photocurrent, Characterisation},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0927024816304974},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {0927-0248},
   DOI = {10.1016/j.solmat.2016.11.029},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Wood, S and O'Connor, D and Jones, C W and Claverley, J D and Blakesley, J C and Giusca, C and Castro, F A}
}

@Article { ,
   title = {Numerical comparison of sampling strategies for BRDF data manifolds},
   journal = {Measurement},
   year = {2016},
   month = {12},
   volume = {94},
   number = {1},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {578-584},
   keywords = {Design of experiments, active learning, BRDF,
diffuse reflection, specular reflection, computer graphics, computer vision,
metrology, data analysis, statistics of manifolds, distance on the space of BRDFs.},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2016.08.010},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Langovoy, M. and Schm{\"a}hling, F. and W{\"u}bbeler, G.}
}

@Article { ,
   title = {MN·m torque calibration for nacelle test benches using transfer standards},
   journal = {ACTA IMEKO},
   year = {2016},
   month = {12},
   volume = {5},
   number = {4},
   number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range},
   pages = {7},
   keywords = {torque calibration; transfer standard; nacelle test bench},
   web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-05\%20\%282016\%29-04-03},
   misc2 = {EMPIR 2014: Industry},
   publisher = {International Measurement Confederation},
   address = {Budapest},
   language = {30},
   ISSN = {2221-870X},
   DOI = {10.21014/acta_imeko.v5i4.414},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Schlegel, C and Kahmann, H and Kumme, R}
}

@Article { MillingtonKQWWKPW2016,
   title = {Experimental tomographic methods for analysing flow dynamics of gas-oil-water flows in horizontal pipeline},
   journal = {Journal of Hydrodynamics, Ser. B},
   year = {2016},
   month = {12},
   volume = {28},
   number = {6},
   number2 = {ENG58: MultiFlowMet: Multiphase flow metrology in oil and gas production},
   pages = {1018-1021},
   keywords = {Experimental tomographic methods for analysing flow dynamics of gas-oil-water flows in horizontal pipeline},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   address = {New York, USA},
   language = {30},
   ISSN = {1001-6058},
   DOI = {10.1016/S1001-6058(16)60704-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Millington, David and Kenibar, Asaad and Qui, Changhua and Wei, Kent and Wang, Mi and Karki, Bishal and Polansky, Jiri and Wang, Qiang}
}

@Article { VandervorstDPFLTHVBTFCS2016,
   subid = {158},
   title = {Understanding Physico-Chemical Aspects in the Depth Profiling of Polymer:Fullerene Layers},
   journal = {The Journal of Physical Chemistry C},
   year = {2016},
   month = {12},
   volume = {120},
   number = {49},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {28074-28082},
   keywords = {ToF-SIMS, GCIB, Ar cluster, quantification, depth profiling, organics, solar cells, polymer, fullerenes},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Chemical Society (ACS)},
   address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Columbus Ohio 43210 United States},
   language = {30},
   ISSN = {1932-7447, 1932-7455},
   DOI = {10.1021/acs.jpcc.6b09911},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vandervorst, W. and Delcorte, A. and Poleunis, C. and Felten, A. and Louette, P. and Turbiez, M. and Havelund, R. and Voroshazi, E. and Bastos, J.P. and Tait, J.G. and Fleischmann, C. and Conard, T. and Surana, S.}
}

@Article { ElsterCW2016,
   title = {Evaluation of uncertainties for CIELAB color coordinates},
   journal = {Color Research \& Application},
   year = {2016},
   month = {12},
   volume = {Na},
   number = {Na},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {1-7},
   keywords = {Measurement uncertainty; CIELAB color coordinates; Monte Carlo method},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {0361-2317},
   DOI = {10.1002/col.22109},
   stag_bib_extends_levelofaccess = {NA},
   author = {Elster, Clemens and Campos Acosta, Joaquin and W{\"u}bbeler, Gerd}
}

@Article { GenoveseBYTDM2016,
   subid = {233},
   title = {Quantifying backflash radiation to prevent zero-error attacks in quantum key distribution},
   journal = {Light: Science \& Applications},
   year = {2016},
   month = {12},
   volume = {6},
   number = {6},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {e16261},
   keywords = {Backflash, Quantum Key Distribution, Single-photon avalanche diode, Zero-error attack},
   web_url = {http://www.nature.com/lsa/journal/v6/n6/full/lsa2016261a.html},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2047-7538},
   DOI = {10.1038/lsa.2016.261},
   stag_bib_extends_levelofaccess = {NA},
   author = {Genovese, M. and Brida, G. and Yuan, Z. and Tosi, A. and Degiovanni, I.P. and Meda, A.}
}

@Article { HenaultBRPDBFBH2016,
   title = {Development of facilities and methods for the metrological characterization of distributed temperature sensing systems based on optical fibres},
   journal = {Measurement Science and Technology},
   year = {2016},
   month = {12},
   volume = {28},
   number = {1},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   pages = {015009},
   keywords = {Distributed sensing, Temperature, Metrology, Raman},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/1/015009},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/28/1/015009},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\'e}nault, J M and Beck, Y L and Razouk, R and Plumeri, S and Delepine-Lesoille, S and Beaumont, O and Failleau, G and Bertrand, J and Hay, B}
}

@Techreport { HultMSMLAVP2016,
   title = {Metrodecom: JRC-Geel Radionuclide Metrology Sector contribution to WP5 Task 2: Reference materials and standard sources for radiochemical analysis},
   journal = {JRC Technical report},
   year = {2016},
   month = {12},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   keywords = {Reference materials, Radiochemical analysis, standard sources},
   web_url = {http://publications.jrc.ec.europa.eu/repository/handle/JRC103355},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {European commission Publication office},
   address = {Luxemburg},
   language = {30},
   ISBN = {978-92-79-63506-9},
   ISSN = {1831-9424},
   DOI = {10.2789/949534},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hult, M. and Marissens, G. and Stroh, H. and Marouli, M. and Lutter, G. and Altzitzoglou, T. and Van Ammel, R. and Pomm{\'e}, S.}
}

@Article { BrownZQ2016,
   title = {Temperature dependence of Hg vapour mass concentration at saturation in air: New SI traceable results between 15 and 30\(^{\circ}\)C},
   journal = {TrAC Trends in Analytical Chemistry},
   year = {2016},
   month = {12},
   volume = {85},
   number2 = {ENV51: MeTra: Traceability for mercury measurements},
   pages = {81-88},
   keywords = {Hg vapour mass concentrationIsotope dilution mass spectrometryTemperature dependent evolutionSI traceable resultsMeasurement procedure validationCombined uncertainty estimationISO/IEC 17025Internationally recommended reference datasets},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0165-9936},
   DOI = {10.1016/j.trac.2015.12.010},
   stag_bib_extends_levelofaccess = {NA},
   author = {Brown, R.J.C. and Zampella, M. and Qu{\'e}tel, C.R.}
}

@Article { FengKF2016,
   title = {Development of CO2 snow cleaning for in situ cleaning of µCMM stylus tips},
   journal = {Measurement Science and Technology},
   year = {2016},
   month = {11},
   day = {28},
   volume = {28},
   number = {1},
   number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products},
   pages = {015007},
   keywords = {snow cleaning, µCMM, precision cleaning, cleaning force},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/28/1/015007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Feng, X. and Kinnell, P.K. and Feng, X.}
}

@Article { FallaniICCLFCFDLC2016,
   subid = {136},
   title = {Synthetic Dimensions and Spin-Orbit Coupling with an Optical Clock Transition},
   journal = {Physical Review Letters},
   year = {2016},
   month = {11},
   day = {23},
   volume = {117},
   number = {22},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {synthetic dimensions, spin-orbit coupling, optical clock transition},
   web_url = {https://arxiv.org/abs/1609.04800},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.117.220401},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fallani, L. and Inguscio, M. and Catani, J. and Calonico, D. and Levi, F. and Franchi, L. and Clivati, C. and Frittelli, M. and Diem, M. and Livi, L. F. and Cappellini, G.}
}

@Article { ReitzensteinKLRSSKSMRWFDJK2016,
   subid = {336},
   title = {Impact of Phonons on Dephasing of Individual Excitons in Deterministic Quantum Dot Microlenses},
   journal = {ACS Photonics},
   year = {2016},
   month = {11},
   day = {22},
   volume = {3},
   number = {12},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {2461-2466},
   keywords = {single-photon source, 3D lithography, 3D direct laser writing, semiconductor quantum dot, micro-objective},
   web_url = {http://pubs.acs.org/doi/pdf/10.1021/acsphotonics.7b00253},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2330-4022, 2330-4022},
   DOI = {10.1021/acsphotonics.6b00707},
   stag_bib_extends_levelofaccess = {NA},
   author = {Reitzenstein, S. and Kuhn, T. and Langbein, W. and Rodt, S. and Strittmatter, A. and Schulze, J.H. and Kaganskiy, A. and Schnauber, P. and Mermillod, Q. and Reiter, D.E. and Wigger, D. and Fischbach, S. and Delmonte, V. and Jakubczyk, T. and Kasprzak, J.}
}

@Article { RietveldZOBCL2016,
   title = {Traceable measurements of the electrical parameters of solid-state lighting products},
   journal = {Metrologia},
   year = {2016},
   month = {11},
   day = {21},
   volume = {53},
   number = {6},
   number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting},
   pages = {1384-1394},
   keywords = {uncertainty analysis, electrical measurement, solid-state lighting},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/0026-1394/53/6/1384},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, G and Zhao, D and Overney, F and Braun, J-P and Christensen, A and Lippert, T}
}

@Techreport { LutterSV2016,
   title = {Preparation of 1100 60Co calibration sources},
   journal = {JRC Technical reports},
   year = {2016},
   month = {11},
   day = {18},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   keywords = {Calibration, Decommissioning, reference standards},
   web_url = {http://publications.jrc.ec.europa.eu/repository/handle/JRC103167},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {European commission Publication office},
   language = {30},
   ISBN = {978-92-79-62200-7},
   ISSN = {1831-9424},
   DOI = {10.2789/787831},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lutter, G. and Sobiech-Matura, K. and Van Ammel, R.}
}

@Article { ,
   title = {Near-unity quantum efficiency of broadband black silicon photodiodes with an induced junction},
   journal = {Nature Photonics},
   year = {2016},
   month = {11},
   day = {14},
   volume = {-},
   number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry},
   keywords = {Imaging and sensing, Nanowires, Optical metrology, Optical sensors,  X-rays},
   web_url = {http://www.nature.com/nphoton/journal/vaop/ncurrent/full/nphoton.2016.226.html},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Nature},
   address = {-},
   language = {30},
   DOI = {10.1038/nphoton.2016.226},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Juntunen, M.A. and Heinonen, J. and V{\"a}h{\"a}nissi, V. and Repo, P. and Valluru, D. and Savin, H.}
}

@Article { ,
   title = {A reference material with close to Lambertian reflectance and fluorescence emission profiles},
   journal = {Metrologica},
   year = {2016},
   month = {11},
   day = {4},
   volume = {53},
   number = {6},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {1331-1338},
   keywords = {fluorescence, reference standard, Lambertian, angle resolved, goniometrical,
radiance factor, bispectral luminescent radiance factor},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/6/1330/meta},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {BIPM \& IOP Publishing Ltd},
   address = {Bistol},
   language = {30},
   DOI = {10.1088/0026-1394/53/6/1330},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Jaanson, PJ and Pulli, TP and Manoocheri, FM and Ikonen, EI}
}

@Proceedings { ,
   title = {New radiometric calibration site located at Gobabeb, Namib desert.},
   journal = {Geoscience and Remote Sensing Symposium (IGARSS)},
   year = {2016},
   month = {11},
   day = {3},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {6094 - 6097},
   keywords = {vicarious calibration, RadCalNet, site characterisation, HDRF},
   web_url = {http://ieeexplore.ieee.org/abstract/document/7730592/?reload=true},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Institute of Electrical and Electronics Engineers International},
   event_place = {Beijing, China.},
   event_name = {Geoscience and Remote Sensing Symposium (IGARSS)},
   event_date = {10th-15th July 2016},
   language = {30},
   ISSN = {2153-7003},
   DOI = {10.1109/IGARSS.2016.7730592},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/abstract/document/7730592/?reload=true},
   author = {Bialek, AB and Greenwell, CG and Lamare, ML and Meygret, AM and Marcq, SM and Lacherade, SL and Woolliams, EW and Berthelot, BB and Bouvet, MB and King, MK and Underwood, CU and Fox, NF}
}

@Article { ,
   title = {Creation and characterization of He-related color centers in diamond},
   journal = {Journal of Luminescence},
   year = {2016},
   month = {11},
   day = {1},
   volume = {179},
   number = {November 2016},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {59-63},
   keywords = {Diamond; Color center; Defect; Ion implantation; Photoluminescence},
   web_url = {http://www.journals.elsevier.com/journal-of-luminescence},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {0022-2313},
   DOI = {10.1016/j.jlumin.2016.06.039},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2018-12-1},
   author = {J. Forneris, J. and A. Tengattini, A. and S. Ditalia Tchernij, S. and F. Picollo, F. and A. Battiato, A. and P. Traina, P. and I.P. Degiovanni, I.P. and E. Moreva, E. and G. Brida, G. and V. Grilj, V. and N. Skukan, N. and M. Jakšić, M. and M. Genovese, M. and P. Olivero, P.}
}

@Article { KraehnertHORH2016,
   title = {Ellipsometric porosimetry on pore-controlled TiO2 layers},
   journal = {Applied Surface Science},
   year = {2016},
   month = {11},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   keywords = {Spectroscopic ellipsometry; Porous materials; Porosimetry; Multi-sample analysis; Thin film metrology},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   address = {New York, USA},
   language = {30},
   ISSN = {0169-4332},
   DOI = {10.1016/j.apsusc.2016.11.055},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kraehnert, Ralph and Hodoroaba, Vasile-Dan and Ortel, Erik and Rosu, Dana-Maria and Hertwig, Andreas}
}

@Article { PlagFHPFFMAEAFH2016,
   title = {Results of the Fifth International Spectroradiometer Comparison for Improved Solar Spectral Irradiance Measurements and Related Impact on Reference Solar Cell Calibration},
   journal = {IEEE Journal of Photovoltaics},
   year = {2016},
   month = {11},
   volume = {6},
   number = {4},
   number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells},
   pages = {1004-1011},
   keywords = {Intercomparison, irradiance, calibration, solar simulator},
   web_url = {http://ieeexplore.ieee.org/document/7576644/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2156-3381, 2156-3403},
   DOI = {10.1109/JPHOTOV.2016.2606698},
   stag_bib_extends_levelofaccess = {NA},
   author = {Plag, F. and Friederichs, M. and Halwachs, M. and Pravettoni, M. and Fucci, R. and Ferretti, N. and Minuto, A. and Alonso-Alvarez, D. and Ekins-Daukes, N. and Alonso-Alvarez, D. and Friedrich, D. and Haverkamp, E.}
}

@Article { FernandezVicenteMSLd2016,
   title = {Speeds of sound for a biogas mixture CH 4  +  N 2  +  CO 2  +  CO from  p  =  (1–12)  MPa at  T  =  (273, 300 and 325)  K measured with a spherical resonator},
   journal = {The Journal of Chemical Thermodynamics},
   year = {2016},
   month = {11},
   volume = {102},
   number2 = {ENG54: Biogas: Metrology for biogas},
   pages = {348-356},
   keywords = {Speed of sound, acoustic resonance, spherical resonator, virial acoustic coefficients, heat capacities as perfect gas, biogas.},
   web_url = {https://core.ac.uk/download/pdf/61544743.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0021-9614},
   DOI = {10.1016/j.jct.2016.07.033},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fern{\'a}ndez-Vicente, T. and Mart{\'i}n, M.C. and Segovia, J.J. and Lozano-Mart{\'i}n, D. and del Campo, D.}
}

@Article { GorenBTZSMPRFAF2016,
   title = {Towards tributyltin quantification in natural water at the Environmental Quality Standard level required by the Water Framework Directive},
   journal = {Talanta},
   year = {2016},
   month = {11},
   volume = {160},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {499-511},
   keywords = {ICP-MS, Isotope Dilution, Limit of quantification, Metrological traceability, Tributyltin, Water Framework Directive},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0039-9140},
   DOI = {10.1016/j.talanta.2016.07.056},
   stag_bib_extends_levelofaccess = {NA},
   author = {Goren, A.C. and B{\'i}lsel, M. and Tun\c{c}, M. and Zuliani, T. and Sčančar, J. and Milačič, R. and Philipp, R. and Richter, J. and Fettig, I. and Alasonati, E. and Fisicaro, P.}
}

@Article { YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016,
   subid = {321},
   title = {Versailles Project on Advanced Materials and Standards Interlaboratory Study on Measuring the Thickness and Chemistry of Nanoparticle Coatings Using XPS and LEIS},
   journal = {The Journal of Physical Chemistry C},
   year = {2016},
   month = {10},
   day = {27},
   volume = {120},
   number = {42},
   number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles},
   pages = {24070-24079},
   keywords = {VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Chemical Society (ACS)},
   address = {CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States},
   language = {30},
   ISSN = {1932-7447, 1932-7455},
   DOI = {10.1021/acs.jpcc.6b06713},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yang, L. and Werner, W. and Wang, Y.C. and Wang, M. and Wang, H. and Wagstaffe, M. and Veith, L. and Treacy, J.P.W. and Thomas, A.G. and Sturm, J.M. and Spampinato, V. and Smith, E.F. and Pseiner, J. and Nunney, T.S. and Luftman, H.S. and Lartundo-Rojas, L. and Kim, J.W. and Kalbe, H. and Galhardo, C.E. and Fearn, S. and Engelhard, M.H. and Dietrich, P.M. and Counsell, J.D.P. and Ceccone, G. and Castner, D.G. and Br{\"u}ner, P. and Bock, B. and Araujo, J.R. and Minelli, C. and Cant, D.J.H. and Belsey, N.A. and Cant, D.}
}

@Article { ,
   title = {On the evaluation of uncertainties for state estimation with the Kalman filter},
   journal = {Measurement Science and Technology.},
   year = {2016},
   month = {10},
   day = {25},
   volume = {27},
   number = {12},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   pages = {125009},
   keywords = {Kalman filter, measurement uncertainty, Monte Carlo, particle filter, extended Kalman filter, GUM},
   web_url = {http://iopscience.iop.org/article/10.1088/0957-0233/27/12/125009/meta},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing Ltd.},
   address = {Bristol},
   language = {30},
   ISSN = {None},
   DOI = {10.1088/0957-0233/27/12/125009},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-10-1},
   author = {Eichst{\"a}dt, S and Makarava, N and Elster, C}
}

@Article { VilllaLCDBGLAPTZG2016,
   subid = {231},
   title = {Measuring Incompatible Observables by Exploiting Sequential Weak Values},
   journal = {Physical Review Letters},
   year = {2016},
   month = {10},
   day = {20},
   volume = {117},
   number = {17},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {170402},
   keywords = {Weak Measurements, Optical tests of quantum theory, Weak Values},
   web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.170402},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.117.170402},
   stag_bib_extends_levelofaccess = {NA},
   author = {Villla, F. and Lussana, R. and Cohen, E. and Degiovanni, I. P. and Brida, G. and Gramegna, M. and Levi, M. P. and Avella, A. and Piacentini, F. and Tosi, A. and Zappa, F. and Genovese, M.}
}

@Article { YoshidaWDKLSGIHTGMB2016,
   title = {Reassessment of the NH4NO3thermal decomposition technique for calibration of the N2O isotopic composition},
   journal = {Rapid Communications in Mass Spectrometry},
   year = {2016},
   month = {10},
   day = {20},
   volume = {30},
   number = {23},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {2487-2496},
   keywords = {thermal decomposition, isotopic composition},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {0951-4198},
   DOI = {10.1002/rcm.7736},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yoshida, N. and Werner, R.A. and Decock, C. and Kuhn, T. and Lehmann, M.F. and Schleppi, P. and Geilmann, H. and Ibraim, E. and Harris, E. and Toyoda, S. and Gutjahr, W. and Mohn, J. and Brand, W.A.}
}

@Article { EngertRGPMKHSCLSKMP2016,
   title = {New Evaluation of T − T2000 from 0.02K to 1K by Independent Thermodynamic Methods},
   journal = {International Journal of Thermophysics},
   year = {2016},
   month = {10},
   day = {20},
   volume = {37},
   number = {12},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   keywords = {Temperature, Thermodynamic Methods, Kelvin},
   web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/new-evaluation-of-t-t2000-from-002k-to-1k-by-independent-thermodynamic-methods(dc393a64-8d59-4083-9435-f2bd70eea8ed).html},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   stag_bib_extends_levelofaccess = {NA},
   author = {Engert, J. and Roschier, L. and Gunnarsson, D. and Prunnila, M. and Mykk{\"a}nen, E. and Kemppinen, A. and Hahtela, O. and Saunders, J. and Casey, A. and Levitin, L.V. and Shibahara, A. and Kirste, A. and Meschke, M. and Pekola, J.}
}

@Article { BillasSGBSFS2016,
   subid = {91},
   title = {Development of a primary standard for absorbed dose from unsealed radionuclide solutions},
   journal = {Metrologia},
   year = {2016},
   month = {10},
   day = {19},
   volume = {53},
   number = {6},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   pages = {1259-1271},
   keywords = {dosimetry, radionuclide solution, extrapolation chamber, primary standard,validation of dose calculation},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/0026-1394/53/6/1259},
   stag_bib_extends_levelofaccess = {NA},
   author = {Billas, I and Shipley, D and Galer, S and Bass, G and Sander, T and Fenwick, A and Smyth, V}
}

@Article { KhoramshahiRVKHHNN2016,
   title = {Close-range environmental remote sensing with 3D hyperspectral technologies},
   journal = {Earth Resources and Environmental Remote Sensing/GIS Applications VII},
   year = {2016},
   month = {10},
   day = {18},
   volume = {10005},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   keywords = {Remote sensing, Unmanned aerial vehicles, Clouds, Radiative energy transfer, Modeling, RGB color model, Radiation, Hyperspectral imaging, LIDAR, Anisotropy},
   web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2571414\&resultClick=1},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {SPIE},
   language = {30},
   DOI = {10.1117/12.2240936},
   stag_bib_extends_levelofaccess = {NA},
   author = {Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Kaasalainen, S. and Hakala, T. and Honkavaara, E. and Nevalainen, O. and N{\"a}si, R.}
}

@Article { ,
   title = {Fundamental uncertainty equations for nuclear dating applied to the 140Ba-140La and 227Th-223Ra chronometers},
   journal = {Journal of Environmental Radioactivity},
   year = {2016},
   month = {10},
   volume = {162-163},
   number = {-},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {358-370},
   keywords = {Nuclear chronometry; Uncertainty; CTBT; Non-proliferation; Geochronology; Nuclear medicine; Dosimetry},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0265931X16302144},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {0265-931X},
   DOI = {10.1016/j.jenvrad.2016.06.013},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S0265931X16302144},
   author = {Pomm{\'e}, S and Collins, SM and Harms, A and Jerome, SM}
}

@Article { ,
   title = {A pan-European project to enhance manufacturing process efficiency through improved temperature control},
   journal = {Measurement and Control},
   year = {2016},
   month = {10},
   volume = {49},
   number = {8},
   number2 = {14IND04: EMPRESS: Enhancing process efficiency through improved temperature measurement},
   pages = {252-255},
   keywords = {EMPRESS, high value manufacturing},
   web_url = {http://mac.sagepub.com/content/49/8/252.short},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institute of Measurement and Control},
   language = {30},
   DOI = {10.1177/0020294016656892},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Pearce, J.V.}
}

@Article { HuangGYKLZF2016,
   title = {Lumen degradation modeling of white-light LEDs in step stress accelerated degradation test},
   journal = {Reliability Engineering \& System Safety},
   year = {2016},
   month = {10},
   volume = {154},
   number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting},
   pages = {152-159},
   keywords = {Accelerated test, Brownian motion, Degradation test, Light-emitting diodes, Step stress, Wiener process},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   address = {Suite 800, 230 Park Avenue, New York, NY 10169, USA},
   language = {30},
   ISSN = {0951-8320},
   DOI = {10.1016/j.ress.2016.06.002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Huang, Jianlin and Golubović, Dušan S and Yang, Daoguo and Koh, Sau and Li, Xiupeng and Zhang, G.Q. and Fan, Xuejun}
}

@Article { SmithHRGLI2016,
   title = {Estimation of background gas concentration from differential absorption lidar measurements},
   journal = {Atmospheric Measurement Techniques},
   year = {2016},
   month = {10},
   volume = {9},
   number = {10, 2016},
   number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions},
   pages = {4879-4890},
   keywords = {gas concentration, differential absorption, atmosphere, metrology, emission fluxes, lidar, pollutants, measurement},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   address = {G{\"o}ttingen},
   language = {30},
   ISSN = {18678548},
   DOI = {10.5194/amt-9-4879-2016},
   stag_bib_extends_levelofaccess = {NA},
   author = {Smith, N. and Harris, P. and Robinson, R. and Gardiner, T. and Livina, V. and Innocenti, F.}
}

@Article { BrabanCEFBLPHTPMPVWvTNP2016,
   title = {A metrological approach to improve accuracy and reliability of ammonia measurements in ambient air},
   journal = {Measurement Science and Technology},
   year = {2016},
   month = {10},
   volume = {27},
   number = {11},
   number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air},
   pages = {115012},
   keywords = {ammonia in ambient air, traceability, reference gas standards, optical transfer standard, validation and testing infrastructure},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   address = {Bristol, United Kingdom},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/0957-0233/27/11/115012},
   stag_bib_extends_levelofaccess = {NA},
   author = {Braban, Christine F and Cassidy, Nathan and Ebert, Volker and Ferracci, Valerio and Balslev-Harder, David and Leuenberger, Daiana and Pascale, C{\'e}line and Hieta, Tuomas and Tiebe, Carlo and Peltola, Jari and Martin, Nicholas A and Persijn, Stefan and Vaittinen, Olavi and Wirtz, Klaus and van Wijk, Janneke and Twigg, Marsailidh M and Niederhauser, Bernhard and Pog{\'a}ny, Andrea}
}

@Article { RietveldvJJNCAC2016,
   title = {Measurement of the harmonic impedance of the aggregated distribution network},
   journal = {2016 17th International Conference on Harmonics and Quality of Power (ICHQP)},
   year = {2016},
   month = {10},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   keywords = {Phasor measurement units, Power Quality, Power system harmonics, Impedance measurement, Harmonic impedance, Load modeling},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/ICHQP.2016.7783374},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, G. and van den Brom, H.E. and Jongepier, A. and Jin, W. and Ni, F. and Cuk, V. and Acanski, M. and Cobben, J.F.G.}
}

@Article { CobbenNNT2016,
   title = {Application of non-intrusive polynomial chaos expansion in probabilistic power flow with truncated random variables},
   journal = {2016 International Conference on Probabilistic Methods Applied to Power Systems (PMAPS)},
   year = {2016},
   month = {10},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   keywords = {ordinary least squares, Uncertainty quantification, Probabilistic power flow, Polynomial chaos expansion, Truncated Normal distribution},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/PMAPS.2016.7764175},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cobben, J. F. G. and Nguyen, P. H. and Ni, F. and Tang, J.}
}

@Article { ReganCBABS2016,
   title = {A comparison of emerging gamma detector technologies for airborne radiation monitoring},
   journal = {Journal of Physics: Conference Series},
   year = {2016},
   month = {10},
   volume = {763},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {012010},
   keywords = {gamma detector, airborne radiation monitoring, radiation monitoring},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/763/1/012010},
   stag_bib_extends_levelofaccess = {NA},
   author = {Regan, P H and Collins, S M and Beeke, S and Aitken-Smith, P and Bell, S J and Shearman, R}
}

@Article { BecherCLB2016,
   title = {Highly efficient heralded single-photon source for telecom wavelengths based on a PPLN waveguide},
   journal = {Optics Express},
   year = {2016},
   month = {10},
   volume = {24},
   number = {21},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {23992},
   keywords = {Nonlinear wave mixing, Photon statistics},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.24.023992},
   stag_bib_extends_levelofaccess = {NA},
   author = {Becher, C. and Chunnilall, C. and Lenhard, A. and Bock, M.}
}

@Article { DrungK2016,
   subid = {10},
   title = {Ultrastable Low-Noise Current Amplifiers With Extended Range and Improved Accuracy},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2016},
   month = {9},
   day = {30},
   volume = {PP},
   number = {99},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {1-8},
   keywords = {Resistors, Current measurement, Uncertainty, Standards, Temperature measurement, Measurement uncertainty, Resistance},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {445 Hoes Lane, Piscataway, NJ 08855-1331, United States},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2016.2611298},
   stag_bib_extends_levelofaccess = {NA},
   author = {Drung, Dietmar and Krause, Christian}
}

@Thesis { AlMasoudi2016,
   title = {A strontium lattice clock with reduced blakbody radiation shift},
   year = {2016},
   month = {9},
   day = {30},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   keywords = {optical lattice clock, black body radiation shift, frequency accuracy},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Leibnitz university},
   school = {Leibnitz university},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.tib.eu/en/search/id/TIBKAT\%3A870652028/A-strontium-lattice-clock-with-reduced-blackbody/?tx_tibsearch_search\%5Bsearchspace\%5D=tn},
   author = {Al-Masoudi, A.}
}

@Article { DeLeoCVSMTFB2016,
   subid = {161},
   title = {4-Nitrobenzene Grafted in Porous Silicon: Application to Optical Lithography},
   journal = {Nanoscale Research Letters},
   year = {2016},
   month = {9},
   day = {29},
   volume = {11},
   number = {436},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {1-10},
   keywords = {Porous silicon, Optical lithography, 4-Nitrobenzenediazonium, grafting, Improved chemical resistance},
   web_url = {https://nanoscalereslett.springeropen.com/articles/10.1186/s11671-016-1654-8},
   misc2 = {EMPIR 2014: Industry},
   publisher = {SpringerOpen},
   address = {London},
   language = {30},
   ISSN = {1556-276X},
   DOI = {10.1186/s11671-016-1654-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {De Leo, N. and Cara, E. and Vacca, A. and Secchi, E. and Mula, G. and Tiddia, M.V. and Fretto, M. and Boarino, L.}
}

@Article { ,
   title = {Improvement of an Atomic Clock using Squeezed Vacuum},
   journal = {Physical Review Letters},
   year = {2016},
   month = {9},
   day = {28},
   volume = {117},
   number = {14},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {143004},
   keywords = {clock, spin squeezing, squeezed vacuum},
   web_url = {http://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.143004},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {American Physical Society},
   address = {Washington, DC, USA},
   language = {30},
   ISSN = {0031-9007},
   DOI = {10.1103/PhysRevLett.117.143004},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Kruse, I and Lange, K and Peise, J and L{\"u}cke, B and Pezz{\`e}, L and Arlt, J and Ertmer, W and Lisdat, C and Santos, L and Smerzi, A and Klempt, C}
}

@Proceedings { ,
   title = {Uncertainty Analysis of Aggregated Smart Meter Data for State Estimation},
   journal = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2016},
   month = {9},
   day = {28},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   pages = {13-18},
   keywords = {Smart meter; state estimation; distribution system; measurement uncertainty; data aggregation},
   web_url = {http://ieeexplore.ieee.org/document/7602805/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {Piscataway, NJ 08855-1331 USA},
   event_place = {Aachen, Germany},
   event_name = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   event_date = {28-30 September 2016},
   language = {30},
   ISBN = {978-1-5090-2373-8},
   DOI = {10.1109/AMPS.2016.7602805},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ni, F. and Nguyen, P.H. and Cobben, J.F.G. and van den Brom, H.E. and Zhao, D.}
}

@Article { XanthosLCA2016,
   title = {Radon migration in soil and its relation to terrestrial gamma radiation in different locations of the Greek early warning system network},
   journal = {Radiation Protection Dosimetry},
   year = {2016},
   month = {9},
   day = {24},
   volume = {175},
   number = {1},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   keywords = {radon in soil, radon migration in soil, long term measurements},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Oxford University Press (OUP)},
   language = {30},
   ISSN = {0144-8420, 1742-3406},
   DOI = {10.1093/rpd/ncw277},
   stag_bib_extends_levelofaccess = {NA},
   author = {Xanthos, S. and Leontaris, F. and Clouvas, A. and Alifragis, D.}
}

@Article { RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016,
   title = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network},
   journal = {Atmospheric Chemistry and Physics},
   year = {2016},
   month = {9},
   day = {23},
   volume = {16},
   number = {18},
   number2 = {ENV51: MeTra: Traceability for mercury measurements},
   pages = {11915-11935},
   keywords = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1680-7324},
   DOI = {10.5194/acp-16-11915-2016},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ramachandran, R. and Fu, X. and Zhang, H. and Feng, X.B. and Wip, D. and Obolkin, V. and Mashyanov, N. and Sena, F. and Gawlik, B.M. and Neves, L.M. and Read, K.A. and Kotnik, J. and Horvat, M. and Skov, H. and Magand, O. and Angot, H. and Dommergue, A. and Garcia, P.E. and Di{\'e}guez, M.D.C and Barbante, C. and Cairns, W. and Brito, J. and Barbosa, H.D.M.J and Morais, F. and Artaxo, P. and W{\"a}ngberg, I. and Munthe, J. and Martin, L. and Labuschagne, C. and Brunke, E.G. and Weigelt, A. and Ebinghaus, R. and Landis, M. and Mannarino, V. and Cinnirella, S. and Carbone, F. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Cossa, D. and Knoery, J. and Marusczak, Nicolas and Nerentorp, M. and Fisicaro, P.}
}

@Manual { ,
   title = {Good practice guide: Characterisation of ADCs in the time and frequency domains using a Programmable Josephson Voltage Standard},
   journal = {Not published in a Journal},
   year = {2016},
   month = {9},
   day = {20},
   volume = {2},
   number = {2},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1-13},
   keywords = {ADC, Calibration},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {None},
   address = {None},
   institution = {METAS},
   language = {30},
   ISBN = {123-123},
   ISSN = {123-123},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Blaise Jeanneret, Blaise Jeanneret}
}

@Article { ,
   title = {Comb mode filtering silver mirror cavity for spectroscopic distance measurement},
   journal = {Review of Scientific Instruments},
   year = {2016},
   month = {9},
   day = {19},
   volume = {87},
   number = {2016},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {093107},
   keywords = {Mirrors, frequency combs, silver, Fabry-Perot interfermoters, piezoelectric transducers},
   web_url = {http://scitation.aip.org/content/aip/journal/rsi/87/9/10.1063/1.4962681},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   address = {Melville},
   language = {30},
   DOI = {10.1063/1.4962681},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Šm{\'i}d, R. and H{\"a}nsel, A. and Pravdova, L. and Cip, O. and Bhattacharya, N.}
}

@Article { LegreKKJGCBMMS2016,
   subid = {751},
   title = {Creation of backdoors in quantum communications via laser damage},
   journal = {Physical Review A},
   year = {2016},
   month = {9},
   day = {15},
   volume = {94},
   number = {3},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {030302(R)},
   keywords = {Quantum Cryptography, Quantum Communication},
   web_url = {https://link.aps.org/accepted/10.1103/PhysRevA.94.030302},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.94.030302},
   stag_bib_extends_levelofaccess = {NA},
   author = {Legr{\'e}, M. and Kashyap, R. and Kaiser, S. and Jennewein, T. and Gagn{\'e}, M. and Chaiwongkhot, P. and Bourgoin, J.P. and Makarov, V. and Minshull, C. and Sajeed, S.}
}

@Article { MartiUGKKTD2016,
   title = {Experimental determination of the effective attenuation length of palladium 3d 5/2 photoelectrons in a magnetron sputtered Pd nanolayer},
   journal = {Surface and Interface Analysis},
   year = {2016},
   month = {9},
   day = {15},
   volume = {49},
   number = {5},
   number2 = {IND15: SurfChem: Traceable quantitative surface chemical analysis for industrial applications},
   pages = {464-468},
   keywords = {XPS, electron effective attenuation length, Pd 3d},
   web_url = {https://onlinelibrary.wiley.com/doi/abs/10.1002/sia.6141},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Wiley},
   language = {30},
   ISSN = {0142-2421},
   DOI = {10.1002/sia.6141},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marti, K. and Unger, W.E.S. and Gross, T. and Krumrey, M. and Kalbe, H. and Treu, D. and Dietrich, P.M.}
}

@Article { ,
   title = {Color characterization of coatings with diffraction pigments},
   journal = {Journal of the Optical Society of America A},
   year = {2016},
   month = {9},
   day = {14},
   volume = {33},
   number = {10},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {1978-1988},
   keywords = {BSDF, BRDF, BTDF, Diffraction, Radiometry, Scattering measurements.},
   web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-33-10-1978},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {OSA},
   address = {Washington, DC, USA},
   language = {30},
   ISSN = {1084-7529 (print), 1520-8532 (online)},
   DOI = {10.1364/JOSAA.33.001978},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ferrero, A and Bernad, B and Campos, J and Perales, E and Vel{\'a}zquez, J L and Mart{\'i}nez-Verd{\'u}, F M}
}

@Article { BennettBHWRBBRC2016,
   title = {Double differential cross sections for proton induced electron emission from molecular analogues of DNA constituents for energies in the Bragg peak region},
   journal = {The Journal of Chemical Physics},
   year = {2016},
   month = {9},
   day = {14},
   volume = {145},
   number = {10},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {104301},
   keywords = {DNA, cross sections, proton impact, tetrahydrofuran, pyrimidine, trimethylphosphate, Bragg peak},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {AIP Publishing},
   address = {2 Huntington Quadrangle, Ste 1 No 1 Suite 300, Melville 11747-4502 ,United States},
   language = {30},
   ISSN = {0021-9606, 1089-7690},
   DOI = {10.1063/1.4962171},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bennett, Daniel and Bug, Marion U. and Hilgers, Gerhard and Wang, Mingjie and Rudek, Benedikt and Baek, Woon Yong and Buhr, Ticia and Rabus, Hans and Champion, Christophe}
}

@Article { Zorin2016,
   title = {Josephson Traveling-Wave Parametric Amplifier with Three-Wave Mixing},
   journal = {Physical Review Applied},
   year = {2016},
   month = {9},
   day = {12},
   volume = {6},
   number = {3},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   keywords = {travel wave amplifier, qubit, nonlinear circuits, parametric amplifyier},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.6.034006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zorin, A. B.}
}

@Proceedings { ,
   title = {Proficiency Testing for Conducted Immunity with a new Round Robin Test Device},
   journal = {International Symposium and Exhibition on Electromagnetic Compatibility Proceedings},
   year = {2016},
   month = {9},
   day = {10},
   volume = {1},
   number = {1},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {1-100},
   keywords = {Electromagnetic Compatibility (EMC), IEC 61000- 4-6, EN ISO 17025, EN ISO 17043, proficiency testing, round robin, test device, conducted immunity, common mode, disturbance signal, Coupling-Decoupling Network (CDN), inter-laboratory comparison, Equipment under Test (EUT), Auxiliary Equipment (AE).},
   web_url = {http://www.emceurope.org/2016/index.html},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {Piscataway, USA},
   event_place = {Wroclaw / Poland},
   event_name = {EMC Europe 2016 Wroclaw International Symposium and Exhibition on Electromagnetic Compatibility},
   event_date = {05-09-2016 to 09-09-2016},
   language = {30},
   ISBN = {978-1-4799-6615-8},
   ISSN = {2158-110X},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Tas, Emrah and Cakir, Soydan and Cetintas, Mustafa and Hamouz, Pavel and Isbring, Thomas and Kokalj, Miha and Lopez, Daniel and Lundgren, Urban and Mandaris, Dwi and Pinter, Borut and Poriz, Martin and Pous, Marc and Pythoud, Fr{\'e}d{\'e}ric and Sen, Osman and Silva, Ferran and Svaboda, Marek and Trincaz, Braise and Zhao, Dongsheng}
}

@Proceedings { ,
   title = {GTEM cell as an alternative method for radiated immunity tests: A comparison with an anechoic chamber},
   journal = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe},
   year = {2016},
   month = {9},
   day = {9},
   volume = {2016},
   number = {2016},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {251-256},
   keywords = {Alternative Test Methods, EMC, GTEM cell, Anechoich chamber, radiated immunity},
   web_url = {http://ieeexplore.ieee.org/document/7739215/},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {USA},
   event_place = {Wroclaw},
   event_name = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe},
   event_date = {05-09-2016 to 09-09-2016},
   language = {30},
   ISBN = {978-1-5090-1416-3},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2016.7739215},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {SALHI, Mohammed and \c{C}akır, Soydan and \c{C}ınar, Mehmet and TEKTAŞ, Bahadır and \c{C}etintaş, Mustafa}
}

@Proceedings { ,
   title = {3D/2D radiation pattern measurement of different GSM phones for EMC applications},
   journal = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe},
   year = {2016},
   month = {9},
   day = {9},
   volume = {2016},
   number = {2016},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {695-700},
   keywords = {Alternative test methods, EMC, GSM, Radiation pattern, Radiated immunity},
   web_url = {http://ieeexplore.ieee.org/document/7739219/},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {USA},
   event_place = {Wroclaw},
   event_name = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe},
   event_date = {05-09-2016 to 09-09-2016},
   language = {30},
   ISBN = {978-1-5090-1416-3},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2016.7739219},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {SALHI, Mohammed and Şen, Osman and \c{C}akır, Soydan and \c{C}etintaş, Mustafa}
}

@Proceedings { ,
   title = {Improvements in alternative radiated emission test methods with surface wire},
   journal = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe},
   year = {2016},
   month = {9},
   day = {9},
   volume = {2016},
   number = {2016},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {799-804},
   keywords = {Surface Wire, Alternative, Emission, On-Site, Radiated},
   web_url = {http://ieeexplore.ieee.org/document/7739212/},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {USA},
   event_place = {Wroclaw},
   event_name = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe},
   event_date = {05-09-2016 to 09-09-2016},
   language = {30},
   ISBN = {-},
   ISSN = {2325-0364},
   DOI = {10.1109/EMCEurope.2016.7739212},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {TEKTAŞ, Bahadır and Şen, Osman and \c{C}akır, Soydan and \c{C}etintaş, Mustafa}
}

@Article { ,
   title = {Uncertainty budgets of major ozone absorption cross-sections used in UV remote sensing applications},
   journal = {Atmospheric Measurement Technique},
   year = {2016},
   month = {9},
   day = {8},
   volume = {9},
   number = {9},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {4459-4470},
   keywords = {absorption cross section, uncertainty, remote sensing},
   web_url = {http://www.atmos-meas-tech.net/9/4459/2016/},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus Publications},
   address = {G{\"o}ttingen},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-9-4459-2016},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Weber, M and Gorshelev, V and Serdyuchenko, A}
}

@Proceedings { ,
   title = {Impact of Surface Curvature on Spectral BRDF of Effect Coatings},
   journal = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance},
   year = {2016},
   month = {9},
   day = {7},
   volume = {N/A},
   number = {N/A},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {295-302},
   keywords = {BRDF, effect coatings, colour},
   web_url = {http://div2.cie.co.at/?i_ca_id=985},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {CIE},
   address = {Vienna, Austria},
   event_place = {Prague},
   event_name = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance},
   event_date = {09-06-2016 to 09-07-2016},
   language = {30},
   ISBN = {978-3-902842-59-6},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {CIE x043:2016},
   author = {Ferrero, A and Bernad, B and Campos, J and Perales, E and Mart{\'i}nez-Verd{\'u}, F M and Smid, M and Porrovecchio, G and Strothk{\"a}mper, C}
}

@Proceedings { ,
   title = {Multi-Angle Colour Characterization of Coatings with Diffraction Pigments},
   journal = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance},
   year = {2016},
   month = {9},
   day = {7},
   volume = {N/A},
   number = {N/A},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {51-59},
   keywords = {BRDF, gonio-spectrophotometry, effect coatings, diffraction},
   web_url = {http://div2.cie.co.at/?i_ca_id=985},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {CIE},
   address = {Vienna, Austria},
   event_place = {Prague},
   event_name = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance},
   event_date = {09-06-2016 to 09-07-2016},
   language = {30},
   ISBN = {978-3-902842-59-6},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {CIE x043:2016},
   author = {Ferrero, A and Bernad, B and Campos, J and Perales, E and Mart{\'i}nez-Verd{\'u}, F M}
}

@Proceedings { ,
   title = {Methodology for testing a parameter-free fault locator for transmission lines},
   journal = {Electric Power Systems Research},
   year = {2016},
   month = {9},
   day = {1},
   volume = {138},
   number = {n/a},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {92 - 98},
   keywords = {Fault location; 
Line parameters; 
ATPDraw; 
Parameter-free; 
Transmission line; 
Protection},
   web_url = {http://www.sciencedirect.com/science/article/pii/S037877961630013X},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elesvier},
   address = {Amsterdam},
   event_place = {Cavtat, Croatia,},
   event_name = {Special Issue: Papers from the 11th International Conference on Power Systems Transients (IPST)},
   event_date = {15-06-2015 to ‐18-6-2015},
   language = {30},
   ISBN = {n/a},
   ISSN = {N/A},
   DOI = {10.1016/j.epsr.2016.02.007},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2018-9-1},
   author = {Popov, M and Parmar, S and Rietveld, G and Preston, G and Radojevic, Z and Terzija, V}
}

@Proceedings { ,
   title = {Convolution and deconvolution of bidirectional scatter distribution function data to enable inter-instrument comparison},
   journal = {Proceedings of the 4th CIE Expert Symposium on Colour and Visual Appearance},
   year = {2016},
   month = {9},
   volume = {CIE x043:2016},
   number = {-},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {427-431},
   keywords = {Bidirectional Scatter Distribution Function, Convolution, Deconvolution},
   web_url = {http://div2.cie.co.at/?i_ca_id=985},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {CIE},
   address = {Vienna},
   event_place = {Prague},
   event_name = {4th CIE Expert Symposium on Colour and Visual Appearance},
   event_date = {06-09-2016 to 07-11-2016},
   language = {30},
   ISBN = {978-3-902842-59-6},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Audenaert, J. and Hanselaer, P. and Leloup, F. B.}
}

@Article { ,
   title = {Experimental Evaluation of Ball Bar Standard Thermal Properties by Simulating Real Shop Floor Conditions},
   journal = {International Journal of Simulation Modelling},
   year = {2016},
   month = {9},
   volume = {15},
   number = {3},
   number2 = {IND62: TIM: Traceable in-process dimensional measurement},
   pages = {511-521},
   keywords = {Traceability, Co-Ordinate Measurement, Measurement Standard, Thermal Expansion},
   web_url = {http://www.ijsimm.com/Full_Papers/Fulltext2016/text15-3_511-521.pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {DAAAM Internbational},
   address = {Vienna},
   language = {30},
   ISSN = {1726-4529},
   DOI = {10.2507/IJSIMM15(3)10.356},
   extern = {1},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.ijsimm.com/},
   author = {Klobucar, R. and Acko, B.}
}

@Article { ,
   title = {Modelling the structure of Zr-rich Pb(Zr1-xTix)O3, x=0.4 with a multiphase approach},
   journal = {Physical Chemistry Chemical Physics · September 2016},
   year = {2016},
   month = {9},
   number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale},
   keywords = {Modelling Zr-rich Pb(Zr1-
xTix)O3},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/CP/C6CP04976A\#!divAbstract},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Reasearch Gate},
   language = {30},
   DOI = {10.1039/C6CP04976A},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Kimmel, A. V. and Mysovsky, Andrey S.}
}

@Proceedings { IrvineBR2016,
   title = {Real-time compression of IEC 61869-9 sampled value data},
   journal = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2016},
   month = {9},
   volume = {1},
   number = {1},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-6},
   keywords = {Communications, IEC 61850-9-2, IEC 61869-9, merging units, phasor measurement units, power system protection, time synchronization},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA},
   event_place = {E.ON Energy Research Centre, RWTH Aachen University, Aachen, Germany},
   event_name = {IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   event_date = {28-09-2016 to 30-09-2016},
   language = {30},
   ISBN = {978-1-5090-2373-8},
   ISSN = {978-1-5090-2374-5},
   DOI = {10.1109/AMPS.2016.7602854},
   stag_bib_extends_levelofaccess = {NA},
   author = {Irvine, James and Blair, Steven M. and Roscoe, Andrew J.}
}

@Proceedings { BlairR2016,
   title = {Choice and properties of adaptive and tunable digital boxcar (moving average) filters for power systems and other signal processing applications},
   journal = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2016},
   month = {9},
   volume = {1},
   number = {1},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-6},
   keywords = {Adaptive filters, Array signal processing, Finite impulse response filters, Power system measurements, Fourier transforms, Frequency measurement, Phase estimation, Power system state estimation, Power system parameter estimation},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA},
   event_place = {E.ON Energy Research Centre, RWTH Aachen University, Aachen, Germany},
   event_name = {IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   event_date = {28-09-2016 to 30-09-2016},
   language = {30},
   ISBN = {978-1-5090-2373-8},
   ISSN = {978-1-5090-2374-5},
   DOI = {10.1109/AMPS.2016.7602853},
   stag_bib_extends_levelofaccess = {NA},
   author = {Blair, Steven M. and Roscoe, Andrew J.}
}

@Article { ,
   title = {A broadband tapered nanocavity for efficient nonclassical light emission},
   journal = {Optics Express},
   year = {2016},
   month = {8},
   day = {31},
   volume = {24},
   number = {18},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {20904},
   note = {Stefan sent an email 14/09/2016 asking to change the status to: No, EURAMET is never allowed to make the publication publicly available. 

and he sent also a copyright statement ti be included here, now it is updated},
   keywords = {Laser beam shaping, Microcavity devices, Quantum-well, -wire and -dot devices, Nanophotonics and photonic crystals.},
   web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-24-18-20904},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {The Optical Society},
   address = {Washington, DC},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.24.020904},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Gregersen, N. and McCutcheon, D. P. S. and M{\o}rk, J. and G{\'e}rard, J. and Claudon, J.}
}

@Article { ,
   title = {Comparing methods for evaluating measurement uncertainty given in the JCGM ‘Evaluation of Measurement Data’ documents},
   journal = {Measurement},
   year = {2016},
   month = {8},
   day = {31},
   volume = {94},
   number = {December 2016},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   pages = {847–851},
   keywords = {measurement uncertainty, GUM, GUM supplements, microwave scattering parameters, standard uncertainty},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116304766},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier},
   address = {Amsterdam, Netherlands},
   language = {30},
   DOI = {10.1016/j.measurement.2016.08.015},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-8-31},
   author = {Stant, L.T. and Aaen, P.H. and Ridler, N. M.}
}

@Proceedings { ,
   title = {THE COMPARISON OF A MICROWAVE BASED BIOENERGY MOISTURE MEASUREMENT INSTRUMENT AGAINST THE LOSS-ON-DRYING METHOD},
   journal = {Proceedings  of XXI IMEKO World Congress, Prague, CZECH REPUBLIC, 2015},
   year = {2016},
   month = {8},
   day = {30},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   keywords = {moisture measurement, bioenergy, microwave, oven drying, LoD},
   web_url = {www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC24-458.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IMEKO},
   address = {Budapest, Hungary},
   event_place = {Prague. Czech Republic},
   event_name = {XXI IMEKO World Congress, Prague, CZECH REPUBLIC, 2015},
   event_date = {August 30 - September 4, 2015},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {{\"O}sterberg, P and Heinonen, M and Ojanen-Saloranta, M and M{\"a}kynen, A}
}

@Article { ,
   title = {Reasons justifying a revision of the existing sound power measurement standards},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {29},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {sound power level, transfer standard source, sound power measurement standards , Traceability I-INCE Classifacation of Subjects Number(s): 72.4},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Arendt, I. and Kurtz, P.}
}

@Article { ,
   title = {Investigations on the suitability of an electroacoustic sound source as a secondary sound power standard},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {29},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {Sound power, tonal components, secondary source, electroacoustics
I-INCE Classification of Subjects Numbers: 10, 72.4},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Bietz, H. and Wittstock, V. and Brezas, S.}
}

@Article { ,
   title = {Numerical modeling of the primary source in a hemi-anechoic room},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {26},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {Sound power, Free Field, Directivity},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {German Acoustical Society (Deutsche Gesellschaft f{\"u}r Akustik, DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Arina, R. and V{\"o}lkel, K.}
}

@Article { ,
   title = {Introducing the concept of traceability into sound power measurements},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {26},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {Sound power, traceability I-INCE Classification of Subjects Number(s): 72.4},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Wittstock, V. and Guglielmone, C.}
}

@Article { ,
   title = {Main achievements of the EMRP sound power project and future prospects},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {26},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {Sound Power, Primary Standard I-INCE Classification of Subjects Number(s): 72.4},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Guglielmone, C. and Wittstock, V. and Kirbas, C. and Andersson, H.}
}

@Article { ,
   title = {Automatic sound field sampling mechanisms to disseminate the unit watt in airborne sound},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {26},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {Sound power, traceability; Calibration; Free-field over a reflecting plane (hemi-anechoic rooms)I-INCE Classification of Subjects Number(s): 72.4, 71.9 and 73.2},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Cellard, P. and Andersson, H. and Brezas, S. and Wittstock, V.}
}

@Article { ,
   title = {Dissemination of the unit watt in airborne sound: aerodynamic reference sound sources as transfer standards},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {26},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {Sound power, dissemination, directivity, correction, substitution I-INCE Classification of Subjects Number(s): 72.4},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Brezas, S. and Cellard, P. and Andersson, H. and Guglielmone, C. and Kirbas, C.}
}

@Article { ,
   title = {Primary sound power sources for the realisation of the unit watt in airborne sound},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {26},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {Sound Power, Primary Sound Power Source, Rayleigh’s Integral},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Kirbas, C. and Andersson, H. and Guglielmone, C. and Bilgi\c{c}, E.}
}

@Article { ,
   title = {Traceable sound power measurements in essentially diffuse or free fields},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {26},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {Sound power, traceability I-INCE Classification of Subjects Number(s): 72.4},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Andersson, H. and Wittstock, V.}
}

@Article { ,
   title = {Influence of Directivity and spetral shape on the measured sound power level},
   journal = {InterNoise 2016},
   year = {2016},
   month = {8},
   day = {26},
   number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound},
   keywords = {Sound power, directivity, spectral shape},
   web_url = {http://www.internoise2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)},
   address = {Berlin},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {V{\"o}lkel, K. and Wittstock, V.}
}

@Article { TsaidPA2016,
   title = {Tuneable on-demand single-photon source in the microwave range},
   journal = {Nature Communications},
   year = {2016},
   month = {8},
   day = {22},
   volume = {7},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   pages = {12588},
   keywords = {Microwave photonics, Quantum information, Single photons and quantum effects},
   web_url = {http://www.nature.com/articles/ncomms12588},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/ncomms12588},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tsai, J. S. and de Graaf, S. E. and Peng, Z. H. and Astafiev, O. V.}
}

@Proceedings { ,
   title = {Characterization of HMDS treated CVD Graphene},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {16},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Chemical vapor deposition (CVD), Hexame-thyldisilazane (HMDS), Copper (Cu), CVD graphene (CVDG)},
   web_url = {http://ieeexplore.ieee.org/document/7540498/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540498},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Thodkar, K. and Sch{\"o}nenberger, C. and Calame, M. and L{\"u}{\"o}nd, F. and Overney, F. and Jeanneret, B.}
}

@Article { QuinonesANSBM2016,
   title = {The Influence of Radon (Gas and Progeny) and Weather Conditions on Ambient Dose Equivalent Rate},
   journal = {Radiation Protection Dosimetry},
   year = {2016},
   month = {8},
   day = {13},
   volume = {174},
   number = {3},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {1-8},
   keywords = {radon, radon progeny, ambient dose equivalent rate, dosimetry},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Oxford University Press (OUP)},
   language = {30},
   ISSN = {0144-8420, 1742-3406},
   DOI = {10.1093/rpd/ncw219},
   stag_bib_extends_levelofaccess = {NA},
   author = {Qui{\~n}ones, J. and Alvarez, A. and Navarro, N. and Saez, J. C. and Benito, G. and M{\'a}rquez, J. L.}
}

@Proceedings { ,
   title = {AC quantum Hall effect in epitaxial graphene},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Graphene, AC quantum Hall effect, quantum Hall resistance, frequency dependence, AC coaxial bridge,  Resistance, Electrical resistance measurement, Bridge circuits, Frequency measurement, Standards},
   web_url = {http://ieeexplore.ieee.org/document/7540655/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540655},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {L{\"u}{\"o}nd, F. and Overney, F. and Jeanneret, B. and M{\"u}ller, A. and Kruskopf, M. and Pierz, K.}
}

@Proceedings { ,
   title = {Convenient Graphene-Based Quantum Hall Resistance Standards},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Graphene, materials science and technology, measurement standards, metrology, quantum Hall effect devices},
   web_url = {http://ieeexplore.ieee.org/document/7540650/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540650},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Brun-Pcard, J. and Ribeiro-Palau, R. and Lafont, F. and Kazazis, D. and Michon, A. and Cheynis, F. and Couturaud, O. and Consejo, C. and Jouault, B. and Poirier, W. and Schopfer, F.}
}

@Proceedings { ,
   title = {Experimental Study of Carrier Density Tuning in Epitaxial Graphene QHR Devices},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Epitaxial graphene, graphene fabrication, carrier concentration, chemical functionalization, precision measurement},
   web_url = {http://ieeexplore.ieee.org/document/7540518/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540518},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Fletcher, N. and Gournay, P. and Rolland, B. and G{\"o}tz, M. and Notikov, S. and Lebedeva, N. and Satrapinski, A.}
}

@Proceedings { ,
   title = {Fabrication of graphene quantum Hall resistance standard in a cryogen-freee table-top system},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Epitaxial layers, Graphene, measurement standards, microfabrication, quantum hall effect},
   web_url = {http://ieeexplore.ieee.org/document/7540516/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540516},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {He, H. and Janssen, T.J.B.M. and Rozhko, S. and Tzalenchuk, A. and Lara-Avila, S. and Yakimova, R. and Kubatkin, S.}
}

@Proceedings { ,
   title = {Magnetocapacitance and Dissipation Factor of Epitaxial Graphene Hall Bars},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {graphene, quantum Hall effect, coaxial bridge circuit, magnetocapacitance, dissipation factor},
   web_url = {http://ieeexplore.ieee.org/document/7540651/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540651},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Schurr, J. and Kalmbach, C.C. and Kruskopf, M. and M{\"u}ller, A. and Pierz, K. and Ahlers, F.}
}

@Proceedings { ,
   title = {Precision Measurements of Quantum Hall Resistance Plateau in Doping-Controlled Graphene Device},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Graphene, quantum Hall effect, precision measurement, resistance metrology, cryogenic current comparator},
   web_url = {http://ieeexplore.ieee.org/document/7540495/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540495},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Chae, D.H. and Kim, W.S. and Satrapinski, A. and Novikov, S.}
}

@Proceedings { ,
   title = {Testing the new generation of low-frequency current comparators},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Resistance measurement, CCC, current comparator, low frequency, measurement uncertainty, sensitivity},
   web_url = {http://ieeexplore.ieee.org/document/7540594/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540594},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Satrapinski, A. and G{\"o}tz, M. and Pesel, E. and Fletcher, N. and Gournay, P. and Rolland, B.}
}

@Proceedings { ,
   title = {Tests of Series Quantum Hall Arrays Based on Epitaxial Graphene},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Epitaxial graphene, graphene fabrication, quantum Hall array, quantum resistance standard},
   web_url = {http://ieeexplore.ieee.org/document/7540653/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540653},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Novikov, S. and Lebedeva, N. and Manninen, A.J. and Satrapinski, A.}
}

@Proceedings { ,
   title = {Towards a cryogen-free table-top primary resistance standard},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {quantum Hall effect, graphene, primary resistance metrology, cryogenic current comparators.},
   web_url = {http://ieeexplore.ieee.org/document/7540654/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540654},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Janssen, T.J.B.M. and Rhozhko, S. and Williams, J.M. and Ireland, J. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Tzalenchuk, A.}
}

@Proceedings { ,
   title = {Measurement comparison up to 65 GHz in coaxial 1.85 mm line},
   journal = {Proceedings of the Conference on Precision Electromagnetic Measurements},
   year = {2016},
   month = {8},
   day = {11},
   volume = {n/a},
   number = {n/a},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-2},
   keywords = {high frequency circuits, metrology,},
   web_url = {http://ieeexplore.ieee.org/document/7540504/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Melville},
   event_place = {Ottawa, Canada},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540504},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ei⊘, C and Allal, D and Huerlimann, P and Ruefenacht, J and Zinal, S}
}

@Proceedings { ,
   title = {Comparison between time- and frequency-domain high-frequency device characterizations},
   journal = {CPEM 2016, Conference on Precision Electromagnetic Measurements: conference digest: (2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {high-frequency devices, vector network analyzer, electro-optic sampling},
   web_url = {http://dx.doi.org/10.1109/CPEM.2016.7540727},
   web_url2 = {https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016, Conference on Precision Electromagnetic Measurements},
   event_date = {10-15 July 2016},
   language = {30},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540727},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-1},
   stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E},
   author = {Bieler, M. and Arz, U.}
}

@Proceedings { ,
   title = {Design of delta-sigma feedback loop for quantum voltage digitizer},
   journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on},
   year = {2016},
   month = {8},
   day = {11},
   volume = {1},
   number = {1},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1-2},
   keywords = {Delta-sigma modulation, Josephson junctions, measurement, metrology, voltage measurement.},
   web_url = {http://ieeexplore.ieee.org/document/7540457/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {New York},
   event_place = {Ottawa},
   event_name = {Conference on Precision Electromagnetic Measurements 2016, (CPEM 2016)},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540457},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540457/},
   author = {Ireland, J and Cryer, A and Williams, JM and Houtzager, E and Hornecker, R and van den Brom, HE}
}

@Proceedings { ,
   title = {Stable arbitrary waveform generator as a transfer standard for ADC calibration},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016), Conference Digest},
   year = {2016},
   month = {8},
   day = {11},
   volume = {CPEM 2016 Conference Digest},
   number = {1},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1-2},
   keywords = {ac voltage measurement, signal synthesis, digital-to-analog converter, analog-to-digital converter, comparison, sampling, ac-dc transfer.},
   web_url = {http://ieeexplore.ieee.org/document/7540454/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {New York, USA},
   event_place = {Ottawa, Canada},
   event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   event_date = {July 10-15, 2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540454},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Nissila, J. and Lee, J. and Sira, M. and {\"O}zt{\"u}rk, T. and Arifovic, M. and Diaz de Aguilar, J. and Lapuh, R. and Behr, R.}
}

@Article { ,
   title = {Calibration systems for analogue non-conventional voltage and current transducers},
   journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   keywords = {Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measure-ment standards, High-Voltage techniques},
   web_url = {http://ieeexplore.ieee.org/document/7540488/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   ISSN = {978-1-4673-9134-4},
   DOI = {10.1109/CPEM.2016.7540488},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Houtzager, E and Mohns, E and Fricke, S and Ayhan, B and Cayci, H}
}

@Proceedings { ,
   title = {Accurate Phase Calibration of PMUs and PMU Calibrators},
   journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2016},
   year = {2016},
   month = {8},
   day = {11},
   volume = {2016},
   number = {1},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-2},
   keywords = {aperture delay, calibration, phasor measurement unit, phase measurement, PMU, synchrophasor.},
   web_url = {http://ieeexplore.ieee.org/document/7540461/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {Ottawa, Canada},
   event_name = {Conference on Precision Electromagnetic Measurements (CPEM)},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540461},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Acanski, M and Rietveld, G and Hoogenboom, D}
}

@Article { ,
   title = {Detector-device-independent QKD: security analysis and fast implementation},
   journal = {Journal of Applied Physics},
   year = {2016},
   month = {8},
   day = {9},
   volume = {120},
   number = {6},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {063101},
   note = {Copyright was too long instead of that we will ise the link. (see copyright statment below)
Subject to the rights herein granted to AIP Publishing, each Copyright Owner retains ownership of
copyright and all other proprietary rights such as patent rights in the Work.
Each Copyright Owner retains the following nonexclusive rights to use the Work, without obtaining
permission from AIP Publishing, in keeping with professional publication ethics, and provided clear
credit is given to its first publication in an AIP Publishing journal. Any reuse must include a full credit
line acknowledging AIP Publishing’s publication and a link to the VOR on AIP Publishing’s site.
Each Copyright Owner may:
1. Reprint portions of the Work (excerpts, figures, tables) in future works created by the
Author, in keeping with professional publication ethics.
2. Post the Accepted Manuscript (AM) to their personal web page or their employer’s
web page immediately after acceptance by AIP Publishing.
3. Deposit the AM in an institutional or funder-designated repository immediately after
acceptance by AIP Publishing.
4. Use the AM for posting within scientific collaboration networks (SCNs). For a detailed
description of our policy on posting to SCNs, please see our Web Posting Guidelines
(https://publishing.aip.org/authors/web-posting-guidelines).
5. Reprint the Version of Record (VOR) in print collections written by the Author, or in the
Author’s thesis or dissertation. It is understood and agreed that the thesis or
dissertation may be made available electronically on the university’s site or in its
repository and that copies may be offered for sale on demand.
6. Reproduce copies of the VOR for courses taught by the Author or offered at the
institution where the Author is employed, provided no fee is charged for access to the
Work.
7. Use the VOR for internal training and noncommercial business purposes by the
Author’s employer.
8. Use the VOR in oral presentations made by the Author, such as at conferences,
meetings, seminars, etc., provided those receiving copies are informed that they may
not further copy or distribute the Work.
9. Distribute the VOR to colleagues for noncommercial scholarly use, provided those
receiving copies are informed that they may not further copy or distribute the Work.
10. Post the VOR to their personal web page or their employer’s web page 12 months
after publication by AIP Publishing.
11. Deposit the VOR in an institutional or funder-designated repository 12 months after
publication by AIP Publishing.
12. Update a prior posting with the VOR on a noncommercial server such as arXiv, 12
months after publication by AIP Publishing.},
   keywords = {Quantum cryptography, Polarization, Qubits, Photons, Modulators},
   web_url = {http://scitation.aip.org/content/aip/journal/jap/120/6/10.1063/1.4960093},
   misc2 = {EMPIR 2014: Industry},
   publisher = {AIP Publishing},
   address = {Melville},
   language = {30},
   ISSN = {0021-8979},
   DOI = {10.1063/1.4960093},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-8-10},
   author = {Boaron, Alberto and Korzh, Boris and Houlmann, Raphael and Boso, Gianluca and Lim, Charles Ci Wen and Martin, Anthony and Zbinden, Hugo}
}

@Article { ,
   title = {Visual and instrumental correlation of sparkle by the magnitude estimation method},
   journal = {Applied Optics},
   year = {2016},
   month = {8},
   day = {9},
   volume = {55},
   number = {23},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {6458-6463},
   keywords = {sparkle, detection, perception psychology, psycophysics, industrial inspection,},
   web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-23-6458},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Optical Society of America (OSA)},
   address = {Washington, DC},
   language = {30},
   ISSN = {2155-3165},
   DOI = {10.1364/AO.55.006458},
   extern = {1},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {G{\'o}mez, O and Perales, E and Chorro, E and Viqueira, V and Mart{\'i}nez-Verd{\'u}, FM}
}

@Article { ,
   title = {Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites},
   journal = {International Journal of Remote Sensing},
   year = {2016},
   month = {8},
   day = {9},
   volume = {37},
   number = {19},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {4665-4682},
   keywords = {Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites},
   web_url = {http://www.tandfonline.com/doi/full/10.1080/01431161.2016.1220030},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Taylor and Francis},
   address = {Abingdon},
   language = {30},
   ISSN = {1366-5901},
   DOI = {10.1080/01431161.2016.1220030},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Gorrono, JG and Bialek, AB and Green, PDG and Harris, PH and Scanlon, TS and Fox, NPF and Underwood, CU}
}

@Proceedings { ,
   title = {Calibration of Si-SPAD detectors using the double attenuator technique and a low noise silicon photodiode},
   journal = {DGaO Proceedings 2016},
   year = {2016},
   month = {8},
   day = {8},
   volume = {117},
   number = {none},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {28-29},
   keywords = {Calibration, SPAD},
   web_url = {http://www.dgao-proceedings.de/download/117/117_p28.pdf},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {DGaO},
   address = {Erlangen},
   event_place = {Hannover},
   event_name = {DGaO - Deutschen Gesellschaft f{\"u}r angewandte Optik},
   event_date = {12-05-2016 to 17-05-2016},
   language = {30},
   ISSN = {1614-8436},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.dgao-proceedings.de/download/117/117_p28.pdf},
   author = {Lopez, M. and Porrovecchio, G. and Hofer, H. and Rodiek, B. and Šmid, M. and K{\"u}ck, S.}
}

@Article { ,
   title = {Characterisation of nitrogen-vacancy based single-photon sources},
   journal = {DGaO Proceedings 2016},
   year = {2016},
   month = {8},
   day = {8},
   volume = {117},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {117_p32},
   keywords = {single-photon source, nitrogen-vacancy in nanodiamonds, calibration, single-photon detectors, antibunching},
   web_url = {http://www.dgao-proceedings.de/download/117/117_p32.pdf},
   web_url2 = {http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Deutschen Gesellschaft f{\"u}r angewandte Optik e.V.},
   address = {Erlangen},
   language = {30},
   ISSN = {1614-8436},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6},
   author = {Rodiek, B. and L{\'o}pez, M. and Hofer, H. and Chu, X.-L. and G{\"o}tzinger, S. and K{\"u}ck, S.}
}

@Article { ,
   title = {The calibration of a prototype occluded ear simulator designed for neonatal hearing assessment applications},
   journal = {AIP Citation},
   year = {2016},
   month = {8},
   day = {5},
   volume = {140 (2016)},
   number = {2},
   number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound},
   pages = {806–813},
   keywords = {occluded ear simulator, prototype, neonatal hearing assessment applications, Microphones, Ears, Calibration, Acoustic impedance measurement, Sound pressure},
   web_url = {http://scitation.aip.org/content/asa/journal/jasa/140/2/10.1121/1.4960517},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {The Journal of the Acoustical Society of America},
   address = {Melville, NY},
   language = {30},
   DOI = {10.1121/1.4960517},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Barham, R. and Olsen, E.S. and Rodrigues, D. and Barrera-Figueroa, S. and Sadikoğlu, E. and Karab{\"o}ce, B.}
}

@Article { ,
   title = {Update on the status of metrology for metalloproteins},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2016},
   month = {8},
   day = {3},
   volume = {31},
   number = {9/2016},
   number2 = {HLT05: Metallomics: Metrology for metalloproteins},
   pages = {1756-1765},
   keywords = {Metalloproteins, Haemoglobin, transferrin, superoxide dismutase, ceruloplasmin, prenatal diagnostics},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00181E\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Royal Society of Chemistry},
   address = {Cambridge, United Kingdom},
   language = {30},
   ISSN = {0267-9477 (print) ; 1364-5544 (online)},
   DOI = {10.1039/c6ja00181e},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Swart, Claudia and Jakubowski, Norbert}
}

@Article { ,
   title = {SI traceable determination of the spring constant of a soft cantilever using a nanonewton force facility based on electrostatic methods},
   journal = {Metrologia},
   year = {2016},
   month = {8},
   day = {1},
   volume = {53 (2016)},
   number = {4},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   pages = {1031-1044},
   keywords = {Nanonewton force facility
Spring constant
Soft cantilever
Contact potential
SI-traceable determination},
   web_url = {http://www.ingentaconnect.com/content/iop/met/2016/00000053/00000004/art01031},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IOP Publishing Ltd.},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394 (print) ; 1681-7575 (online)},
   DOI = {10.1088/0026-1394/53/4/1031},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Nesterov, V. and Belai, O. and Nies, D. and Buetefisch, S. and Muelelr, M. and Ahbe, T. and Neparty, D. and Popadic, R. and Wolff, H.}
}

@Proceedings { ,
   title = {First ac measurements of the quantum Hall effect in epitaxial graphene},
   journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)},
   year = {2016},
   month = {8},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {38--39},
   keywords = {AC analysis technique,AC loss elimination,AC measurement,C,Electrical resistance measurement,Gallium arsenide,Graphene,Hall effect,Impedance,Noise,Resistance,electric current measurement,epitaxial graphene-based impedance standard,graphene,impedance,quantized Hall resistance,quantum Hall effect,spectral noise density},
   web_url = {http://ieeexplore.ieee.org/articleDetails.jsp?arnumber=6898247},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   language = {30},
   ISBN = {978-1-4799-2479-0},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898247},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Kalmbach, C. and Schurr, J. and Ahlers, F.J. and M{\"u}ller, A. and Novikov, S. and Lebedeva, N. and Satrapinsky, A.}
}

@Article { ,
   title = {Protection Against Common Mode Currents on Cables Exposed to HIRF or NEMP},
   journal = {IEEE Transactions on Electromagnetic Compatibility},
   year = {2016},
   month = {8},
   volume = {Submitted and accepted for publication in a future issue of this journal},
   number = {Not known yet},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {1-9},
   keywords = {Electromagnetic compatibility, electromagnetic coupling, electromagnetic fields, marine electrical equipment},
   web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=16},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {Piscataway, NJ},
   language = {30},
   ISSN = {not known yet},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {van Leersum, B.J.A.M. and van der Ven, C.C.J. and Bergsma, J.G. and Buesink, F.J.K. and Leferink, F.B.J.}
}

@Article { ,
   title = {On-Site Radiated Emissions Measurements in Semi-Reverberant Environments},
   journal = {IEEE Transactions on Electromagnetic Compatibility},
   year = {2016},
   month = {8},
   volume = {Not known yet},
   number = {Not known yet},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {1-8},
   keywords = {radiated emissions; in-situ testing; reverberation chambers;},
   web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=15},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {Piscataway, NJ},
   language = {30},
   ISSN = {not known yet},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Vogt-Ardatjew, R.A. and Lundgren, U. and Romero, S.F.}
}

@Article { ,
   title = {Characterization of a Multi-Element Clinical HIFU System Using Acoustic Holography and Nonlinear Modeling},
   journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control},
   year = {2016},
   month = {8},
   volume = {60},
   number = {8},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {1683-98},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Institute of Electrical and Electronics Engineers},
   language = {30},
   ISSN = {0885–3010},
   DOI = {10.1109/TUFFC.2013.2750},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Krieder, w and Yuldashev, P and Sapoznikov, OA and Farr, N and Partinen, A and Bailey, MR and Khokhlova, VA}
}

@Article { ,
   title = {The Feasibility of Thermal Imaging as a Future Portal Imaging Device for Therapeutic Ultrasound},
   journal = {Ultrasound in Medicine and Biology},
   year = {2016},
   month = {8},
   volume = {42},
   number = {8},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {2033–2038},
   keywords = {High intensity focused ultrasound dosimetry, Quality assurance, Thermal mapping, Acoustic field evaluation, Magnetic resonance–guided focused ultrasound surgery, Infrared camera},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0301562916300047},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Elsevier},
   language = {30},
   ISSN = {0301-5629},
   DOI = {10.1016/j.ultrasmedbio.2016.03.028},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-9-1},
   author = {Miloro, P and Civale, J and Rivens, I and Shaw, A}
}

@Article { ,
   title = {Assessment of uncertainty in structured surfaces using metrological characteristics},
   journal = {CIRP Annals Manufacturing Technology},
   year = {2016},
   month = {8},
   volume = {65/I},
   number = {2016},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   pages = {533-536},
   keywords = {Uncertainty, Surface analysis, Structured surfaces},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0007850616300683},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier},
   address = {Oxford},
   language = {30},
   ISSN = {0007-8506},
   DOI = {10.1016/j.cirp.2016.04.068},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {MacAulay, G. and Giusca, C.}
}

@Article { ,
   title = {Advances in Large Scale Metrology – Review and Future Trends},
   journal = {CIRP Annals Manufacturing Technology},
   year = {2016},
   month = {8},
   volume = {65/I},
   number = {2016},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   pages = {643-665},
   keywords = {Metrology, Measuring Instrument, Uncertainty, Simulation, Modelling, Information},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0007850616301895},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier},
   address = {Oxford},
   language = {30},
   DOI = {10.1016/j.cirp.2016.05.002},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Schmitt, R. and Peterek, M. and Morse, E. and Knapp, W. and Galetto, M. and H{\"a}rtig, F. and Goch, G. and Hughes, B. and Forbes, A. and Estler, W.T.}
}

@Article { ,
   title = {Long-term Stability of Al2O3 Passivated Black Silicon},
   journal = {Energy Procedia},
   year = {2016},
   month = {8},
   volume = {92},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {341-346},
   keywords = {Black silicon, Nano-texturing, Surface passivation, Lifetime, Atomic layer deposition, Al2O3, Solar cells},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1876610216305203},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier},
   language = {30},
   DOI = {10.1016/j.egypro.2016.07.093},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Calle, E. and Ortega, P. and von Gastrow, G. . and Martin, I and Savin, H. and Alcubilla, R.}
}

@Article { ,
   title = {Effect of different ALD Al2O3 oxidants on the surface passivation of black silicon},
   journal = {Energy Procedia},
   year = {2016},
   month = {8},
   volume = {92},
   number = {-},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {381-385},
   keywords = {black silicon; surface passivatoin; aluminum oxide},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1876610216305434},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier},
   address = {-},
   language = {30},
   DOI = {10.1016/j.egypro.2016.07.116},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Repo, P. and Savin, H.}
}

@Article { HerrmannPSHM2016,
   title = {Photovoltaic energy rating data sets for Europe},
   journal = {Solar Energy},
   year = {2016},
   month = {8},
   volume = {133},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {349-362},
   keywords = {Photovoltaics; Energy rating; Sensitivity analysis; Power matrix},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   address = {New York},
   language = {30},
   ISSN = {0038-092X},
   DOI = {10.1016/j.solener.2016.03.071},
   stag_bib_extends_levelofaccess = {NA},
   author = {Herrmann, W and Pozza, A and Salis, E and Huld, T and M{\"u}llejans, H}
}

@Article { SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016,
   subid = {135},
   title = {A clock network for geodesy and fundamental science},
   journal = {Nature Communications},
   year = {2016},
   month = {8},
   volume = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {12443},
   keywords = {Clock network; geodesy;},
   web_url = {https://www.nature.com/articles/ncomms12443},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   address = {New York},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/ncomms12443},
   stag_bib_extends_levelofaccess = {NA},
   author = {Santarelli, G. and Le Coq, Y. and Chardonnet, C. and Denker, H. and Sterr, U. and Legero, T. and Schnatz, H. and Lours, M. and Abgrall, M. and Camisard, E. and Meynadier, F. and Wiotte, F. and Kuhl, A. and Koke, S. and Koczwara, A. and Bilicki, S. and Bookjans, E. and Chiodo, N. and Robyr, J.-L. and Haefner, S. and Doerscher, S. and Al-Masoudi, A. and Stefani, F. and Grebing, C. and Nicolodi, D. and Raupach, S.M.F. and Shi, C. and Quintin, N. and Grosche, G. and Lisdat, C. and Amy-Klein, A. and Le Targat, R. and Lodewyck, J. and Lopez, O and Pottie, P.-E.}
}

@Article { SvecSSRPNMLKJGFFDMAHBTTVW2016_2,
   title = {60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy},
   journal = {Applied Radiation and Isotopes},
   year = {2016},
   month = {8},
   volume = {114},
   number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry},
   pages = {167-172},
   keywords = {Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2016.05.014},
   stag_bib_extends_levelofaccess = {NA},
   author = {Svec, A. and Solc, J. and Silva, L. and Reis, M. and Peyres, V. and Nečemer, M. and Moser, H. and Luca, A. and Klemola, S. and Javornik, A. and Garc{\'i}a-Tora{\~n}o, E. and Ferreux, L.. and Fazio, A. and Dry{\'a}k, P. and Marroyo, B.C. and Arnold, D. and Hult, M. and Burda, O. and Tzika, F. and Tyminski, Z. and Vodenik, B. and W{\"a}tjen, U.}
}

@Article { ShortisRKMB2016_2,
   title = {Optimised multi-camera systems for dimensional control in factory environments},
   journal = {Proceedings of the Institution of Mechanical Engineers, Part B: Journal of Engineering Manufacture},
   year = {2016},
   month = {8},
   volume = {232},
   number = {10},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {1707-1718},
   keywords = {Industrial photogrammetry, camera calibration, refraction correction, manufacturing, part assembly},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {SAGE Publications},
   language = {30},
   ISSN = {0954-4054, 2041-2975},
   DOI = {10.1177/0954405416654936},
   stag_bib_extends_levelofaccess = {NA},
   author = {Shortis, M. and Robson, S. and Kyle, S. and MacDonald, L. and Boehm, J.}
}

@Article { FisicaroPJPFRA2016,
   title = {Determination of tributyltin in whole water matrices under the European Water Framework Directive},
   journal = {Journal of Chromatography A},
   year = {2016},
   month = {8},
   volume = {1459},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {112-119},
   keywords = {Environmental quality standard (EQS), Humic acid, Isotope dilution, Surface water, Suspended particulate matter, Tributyltin (TBT)},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0021-9673},
   DOI = {10.1016/j.chroma.2016.06.068},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fisicaro, P. and Panne, U. and Jakubowski, N. and Philipp, R. and Fettig, I. and Richter, J. and Alasonati, E.}
}

@Article { ,
   title = {Experimental determination of the oxygen K-shell fluorescence yield using thin SiO2 and Al2O3 foils},
   journal = {Spectrochimica Acta Part B: Atomic Spectroscopy},
   year = {2016},
   month = {7},
   day = {28},
   volume = {124},
   number = {1 Oct 2016},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {94-98},
   keywords = {fundamental parameter, fluorescence yield, oxygen, XRS},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0584854716301732},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier B.V.},
   address = {Amsterdam},
   language = {30},
   ISSN = {0584-8547},
   DOI = {10.1016/j.sab.2016.08.024},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {H{\"o}nicke, P. and Kolbe, M. and Krumrey, M. and Unterumsberger, R. and Beckhoff, B.}
}

@Article { ,
   title = {Conception of a mobile climate simulation chamber for the investigation of the influences of harsh shop floor conditions on in-process measurement systems in machine tools},
   journal = {Measurement},
   year = {2016},
   month = {7},
   day = {26},
   volume = {74},
   number = {October 2015},
   number2 = {IND62: TIM: Traceable in-process dimensional measurement},
   pages = {233-237},
   keywords = {Traceable in-process measurement
Machine tools
Climate simulation
Computational fluid dynamics},
   web_url = {http://www.journals.elsevier.com/measurement},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2015.07.010},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S0263224115003450},
   author = {Berger, Dietrich and Brabandt, Daniel and Lanza, Gisela}
}

@Article { ,
   title = {Giant quantum Hall plateaus generated by charge transfer in epitaxial graphene},
   journal = {Nature: Scientific Reports},
   year = {2016},
   month = {7},
   day = {26},
   volume = {6},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {30296},
   keywords = {graphene, measurement, QHE,},
   web_url = {http://www.nature.com/articles/srep30296?WT.feed_name=subjects_physical-sciences},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Scientific reports},
   language = {30},
   DOI = {10.1038/srep30296},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Alexander-Webber, J.A. and Huang, J. and Maude, D.K. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.}
}

@Article { ,
   title = {Accurate quantification of selenoproteins in human plasma/serum by isotope dilution ICP-MS: focus on selenoprotein P},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2016},
   month = {7},
   day = {26},
   volume = {31},
   number = {09/2016},
   number2 = {HLT05: Metallomics: Metrology for metalloproteins},
   pages = {1904-1912},
   keywords = {selenoproteins, isotope dilution, ICP-MS,},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00122J\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {The Royal Society of Chemistry},
   address = {Cambridge, United Kingdom},
   language = {30},
   DOI = {10.1039/c6ja00122j},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {del Castillo Busto, M. Estela and Oster, Caroline and Cuello-Nunez, Susana and Deitrich, Christian L. and Raab, Andrea and Konopka, Anna and Lehmann, Wolf D. and Goenaga-Infante, Heidi and Fisicaro, Paola}
}

@Manual { ,
   title = {Coping with Thermal Expansion in Large Volume Metrology: Good Practice Guide},
   journal = {LUMINAR project website},
   year = {2016},
   month = {7},
   day = {25},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {1-23},
   keywords = {Large Volume Metrology, thermal compensation, CTE, good practice guide},
   web_url = {http://projects.npl.co.uk/luminar/publications/luminar-gpg-thermal-expansion-lvm.pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {LUMINAR website hosted by NPL},
   address = {NPL, Hampton Road, Teddington},
   institution = {University of Bath},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://projects.npl.co.uk/luminar/publications/luminar-gpg-thermal-expansion-lvm.pdf},
   author = {Ross-Pinnock, D and Mullineux, G and Muelaner, J}
}

@Article { WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016,
   title = {Five-year records of Total Mercury Deposition flux at GMOS sites in the Northern and Southern Hemispheres},
   journal = {Atmospheric Chemistry and Physics Discussions},
   year = {2016},
   month = {7},
   day = {20},
   number2 = {ENV51: MeTra: Traceability for mercury measurements},
   pages = {1-33},
   keywords = {mercury, wet deposition flux,},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1680-7375},
   DOI = {10.5194/acp-2016-517},
   stag_bib_extends_levelofaccess = {NA},
   author = {W{\"a}ngberg, I. and Walters, C. and Vard{\`e}, M. and Spandow, P. and Somerset, V. and Sena, F. and Islas, M.R. and Obolkin, V. and Munthe, J. and Mkololo, T. and Mashyanov, N. and Martin, L. and Magand, O. and Labuschagne, C. and Kotnik, J. and Horvat, M. and Hansson, K. and Hagestr{\"o}m, U. and Gawlik, B. and Garcia, P.E. and Fu, X. and Feng, X.B. and Ebinghaus, R. and Dommergue, A. and Di{\'e}guez, M.D.C. and Comero, S. and Cairns, W. and Arcega-Cabrera, F. and Brunke, E.G. and Barbante, C. and Angot, H. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Weigelt, A. and Yang, X. and Fisicaro, P.}
}

@Proceedings { ,
   title = {Close range calibration of long focal length lenses in a changing environment},
   journal = {The International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences},
   year = {2016},
   month = {7},
   day = {19},
   volume = {2016},
   number = {XLI-B5},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {115-122},
   keywords = {Camera, calibration, close range, physical parameter, correlation, temperature, wavelength},
   web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B5/115/2016/isprs-archives-XLI-B5-115-2016.pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {ISPRS},
   address = {Hannover},
   event_place = {Prague, Czech Republic},
   event_name = {XXIII International Socirty of Photogrammetry and Remote Sensing Congress},
   event_date = {12-19 July 2016},
   language = {30},
   DOI = {10.5194/isprs-archives-XLI-B5-115-2016},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Robson, S and MacDonald, L and Kyle, S and Shortis, M R}
}

@Proceedings { ,
   title = {Josephson-Based Characterization of Analog-to-Digital Converters Using an Equivalent Time Sampling Method},
   journal = {Proceedings CPEM 2016},
   year = {2016},
   month = {7},
   day = {18},
   volume = {54},
   number = {12},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1-2},
   keywords = {Analog to Digital Converter, Josephson Voltage
Standards, Sampling, Waveform},
   web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=4126881},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Unknown},
   address = {Unknown},
   event_place = {Ottawa},
   event_name = {Conference on Precision Elexctromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {0018-9456},
   ISSN = {0018-9456},
   DOI = {10.1109/TIM.2007.891162},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Blaise Jeanneret, Blaise Jeanneret and Fr´ed´eric Overney, Fr´ed´eric Overney and Christophe Scherly, Christophe Scherly and G´erald Schaller, G´erald Schaller}
}

@Proceedings { ,
   title = {Measurement and estimation of arbitrary signal power using a window technique},
   journal = {Proceedings CPEM 2016},
   year = {2016},
   month = {7},
   day = {18},
   volume = {54},
   number = {12},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1-2},
   keywords = {Power, signal windowing, sampling, noise, spectral
components.},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540739},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Unknown},
   event_place = {Ottawa},
   event_name = {Conference on Precision Elexctromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {0018-9456},
   ISSN = {0018-9456},
   DOI = {10.1109/CPEM.2016.7540739},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lapuh, Rado and Voljč, Boštjan and Lindič, Matjaž}
}

@Proceedings { ,
   title = {Quasi coherent overlapping procedure to improve harmonics suppression using single tone estimation algorithms},
   journal = {Proceedings CPEM 2016},
   year = {2016},
   month = {7},
   day = {18},
   volume = {54},
   number = {12},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1-2},
   keywords = {Measurement, sampling, estimation algorithms,
harmonic distortion, estimation error, uncertainty},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540596},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Unknown},
   event_place = {Ottawa},
   event_name = {Conference on Precision Elexctromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {0018-9456},
   ISSN = {0018-9456},
   DOI = {10.1109/CPEM.2016.7540596},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lapuh, Rado and Voljč, Boštjan and Kokalj, Miha and Lindič, Matjaž and Svetik, Zoran}
}

@Proceedings { ,
   title = {Uncertainty of the Signal Parameter Estimation from Sampled Data},
   journal = {Proceedings CPEM 2016},
   year = {2016},
   month = {7},
   day = {18},
   volume = {54},
   number = {12},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1-2},
   keywords = {Measurement, sampling, estimation algorithms,
harmonic distortion, estimation error, uncertainty},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540770},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Unknown},
   event_place = {Ottawa},
   event_name = {Conference on Precision Elexctromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {0018-9456},
   ISSN = {0018-9456},
   DOI = {10.1109/CPEM.2016.7540770},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lapuh, Rado and Šira, Martin and Lindič, Matjaž and Voljč, Boštjan}
}

@Proceedings { ,
   title = {Keysight 3458A Noise Performance},
   journal = {Proceedings CPEM 2016},
   year = {2016},
   month = {7},
   day = {18},
   volume = {54},
   number = {12},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1-2},
   keywords = {Measurement, sampling, quantization noise, 1/f
noise, interferences, measurement uncertainty},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540597},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Unknown},
   event_place = {Ottawa},
   event_name = {Conference on Precision Elexctromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {0018-9456},
   ISSN = {0018-9456},
   DOI = {10.1109/CPEM.2016.7540597},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lapuh, Rado and Voljč, Boštjan and Lindič, Matjaž}
}

@Proceedings { ,
   title = {Receiver Algorithm for Decoding Constellation Modulation},
   journal = {Advanced Photonics 2016 SPPCom},
   year = {2016},
   month = {7},
   day = {18},
   number = {2016},
   number2 = {IND51: MORSE: Metrology for optical and RF communication systems},
   pages = {SpTu1F.3},
   keywords = {Coherent communications
Fiber optics communications
Modulation},
   web_url = {https://www.osapublishing.org/abstract.cfm?uri=SPPCom-2016-SpTu1F.3},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Optical Society of America},
   address = {Washington, D.C.},
   event_place = {Vancouver, Canada},
   event_name = {Advanced Photonics},
   event_date = {18-07-2016},
   language = {30},
   ISBN = {978-1-943580-14-9},
   ISSN = {N/A},
   DOI = {10.1364/SPPCOM.2016.SpTu1F.3},
   extern = {1},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Dash, S. S. and Pythoud, F and B, B and Josten, A and Leuchtmann, P and Hillerkuss, D and Leuthold, J}
}

@Proceedings { ,
   title = {QWTB – Software Tool Box for Sampling Measurements},
   journal = {Conference on Precision Electromagnetic Measurements Digest},
   year = {2016},
   month = {7},
   day = {15},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {2},
   keywords = {Algorithms, measurement, open source software,
signal sampling, software tools, uncertainty.},
   web_url = {http://ieeexplore.ieee.org/document/7540599/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Ontario, Canada},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {10-07-16 to 15-07-16},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540599},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Š{\'i}ra, MŠ and Mašl{\'a}ň, SM and Nov{\'a}kov{\'a} Zachovalov{\'a}, VNZ}
}

@Proceedings { ,
   title = {Traceable DC - 18 GHz Characterization of Coaxial 50 ohm Impedance Standards},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   day = {15},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   keywords = {Impedance, calibration, vector network analyzers, impedance analyzers, precision measurements.},
   web_url = {http://ieeexplore.ieee.org/document/7540479/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {NA},
   language = {30},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540479},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mubarak, F.A. and Dierikx, E. and Rietveld, G.}
}

@Proceedings { ,
   title = {Effects of Connectors and Improper Mounting of Air Lines in TRL Calibration},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   day = {15},
   volume = {NA},
   number = {NA},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {NA},
   keywords = {connector effects, precision air line, TRL calibration, vector network analyzer.},
   web_url = {http://ieeexplore.ieee.org/document/7540506/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {NA},
   language = {30},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540506},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mubarak, F. and Hoffmann, J.}
}

@Proceedings { ,
   title = {Verification concepts in S-parameter measurements},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   day = {15},
   volume = {NA},
   number = {NA},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {NA},
   keywords = {Verification, scattering parameter, vector network analyzer.},
   web_url = {http://ieeexplore.ieee.org/document/7540508/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {NA},
   language = {30},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540508},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mubarak, F. and Zeier, M. and Hoffmann, J. and Ridler, N.M. and Salter, M.J. and Kuhlmann, K.}
}

@Article { MottonenTLG2016,
   title = {Detection of Zeptojoule Microwave Pulses Using Electrothermal Feedback in Proximity-Induced Josephson Junctions},
   journal = {Physical Review Letters},
   year = {2016},
   month = {7},
   day = {15},
   volume = {117},
   number = {3},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   pages = {030802},
   keywords = {microwave detector},
   web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.030802},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.117.030802},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\"o}tt{\"o}nen, M. and Tan, K. Y. and Lake, R. E. and Govenius, J.}
}

@Article { ,
   title = {[Sec-to-Cys]selenoprotein – a novel type of recombinant, full-length selenoprotein standard for quantitative proteomics},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2016},
   month = {7},
   day = {14},
   volume = {31},
   number = {9/2016},
   number2 = {HLT05: Metallomics: Metrology for metalloproteins},
   pages = {1929-1938},
   keywords = {selenoproteins, glutathione peroxidase 3 (GPx3), (SEPP1), selenocysteine, cysteine codons},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00123H\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {The Royal Society of Chemistry},
   address = {Cambridge, United Kingdom},
   language = {30},
   DOI = {10.1039/c6ja00123h},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Konopka, Anna and Winter, Dominic and Konopka, Witold and del Castillo Busto, M. Estela and Goenaga-Infante, Heidi and Nunez, Susana and Fisicaro, Paola and Lehmann, Wolf D.}
}

@Article { ,
   title = {High resolution kilometric range optical telemetry in air by radio frequency phase measurement},
   journal = {Review of Scientific Instruments},
   year = {2016},
   month = {7},
   day = {12},
   volume = {87},
   number = {2016},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {075101},
   keywords = {telemeter,  ADM, laser tracker},
   web_url = {http://scitation.aip.org/content/aip/journal/rsi/87/7/10.1063/1.4954180},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   DOI = {10.1063/1.4954180},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No option selected},
   author = {Guillory, J. and Šm{\'i}d, R. and Garcia-M{\'a}rquez, J. and Truong, D. and Alexandre, C. and Wallerand, J.-P.}
}

@Proceedings { ,
   title = {Comparison of Calibration Methods for Multiport VNAs up to 67 GHz},
   journal = {Conference on Precision Electromagnetic Measurements, Ottawa, Canada, 10 – 15 July 2016 (CPEM 2016)},
   year = {2016},
   month = {7},
   day = {10},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {N/A},
   keywords = {VNA characterization, multiport measurements, calibration methods, error correction models},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7540728},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   event_place = {Ottawa, Canada},
   event_name = {Conference on Precision Electromagnetic Measurements 2016  (CPEM 2016)},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   DOI = {10.1109/CPEM.2016.7540728},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Zinal, S. and Allal, D. and Salter, M.}
}

@Proceedings { ,
   title = {Uncertainty Evaluation of Balanced S-Parameter Measurements},
   journal = {Conference on Precision Electromagnetic Measurements, Ottawa, Canada, 10 – 15 July 2016},
   year = {2016},
   month = {7},
   day = {10},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {N/A},
   keywords = {Balanced devices, electromagnetic simulation, Monte Carlo method, scattering parameters, uncertainty analysis, signal integrity, vector network analyzer.},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7540616},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   event_place = {Ottawa, Canada},
   event_name = {Conference on Precision Electromagnetic Measurements 2016  (CPEM 2016)},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   DOI = {10.1109/CPEM.2016.7540616},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ziade, F. and Hudlicka, M. and Salter, M. and Pavlicek, T. and Allal, D.}
}

@Proceedings { ,
   title = {A Nonlinear Verification Device for Nonlinear Vector Network Analyzers},
   journal = {Proceedings Conference on Precision Electromagnetic Measurements 2016},
   year = {2016},
   month = {7},
   day = {10},
   volume = {1},
   number = {1},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-2},
   keywords = {Impedance matching, electromagnetic modeling, measurement uncertainty, microwave integrated circuits, nonlinear network analysis, semiconductor diodes.},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7540467\&isnumber=7539723},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {Westin Hotel, Ottawa, Ontario, Canada},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {10-07-2016 to 16-07-2016},
   language = {30},
   ISBN = {N/A},
   ISSN = {05891485},
   DOI = {10.1109/CPEM.2016.7540467},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Humphreys, D. A. and Rajabi, M. and Schreur, D. and Nielsen, T.}
}

@Proceedings { ,
   title = {An AC Power Amplifier for Testing Instrument Transformer Test Equipment},
   journal = {Conference on Precision Electromagnetic Measurements 2016 (Digest)},
   year = {2016},
   month = {7},
   day = {10},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   keywords = {Analogue power amplifier, voltage gain, transconductance, test equipment, instrument transformers},
   web_url = {http://ieeexplore.ieee.org/document/7540559/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   event_place = {Ottawa},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540559},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Enrico, Mohns and Soeren, Fricke and Florian, Pauling}
}

@Proceedings { BeckhoffPMHK2016,
   title = {Fundamental parameter determination to improve spectroscopical methods},
   journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on},
   year = {2016},
   month = {7},
   day = {10},
   number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells},
   keywords = {X-ray fluorescence, atomic fundamental parameters, fluorescence yields,  optical constants, spectroscopy},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   event_place = {Ottawa},
   event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   DOI = {10.1109/CPEM.2016.7540520},
   stag_bib_extends_levelofaccess = {NA},
   author = {Beckhoff, B. and Pollakowski, B. and Muller, M. and Honicke, P. and Kolbe, M.}
}

@Article { ,
   title = {Comparison at the sub-100 fW optical power level of calibrating a single-photon detector using a high-sensitive, low-noise silicon photodiode and the double attenuator technique},
   journal = {Metrologia},
   year = {2016},
   month = {7},
   day = {8},
   volume = {53},
   number = {4},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {1115-1122},
   keywords = {detection efficiency, Si-SPAD, calibration, comparison},
   web_url = {http://iopscience.iop.org/journal/0026-1394},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Oxford},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/53/4/1115},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Porrovecchio, G. and Šmid, M. and Lopez, M. and Hofer, H. and Rodiek, B. and K{\"u}ck, S.}
}

@Article { ,
   title = {Optical to microwave clock frequency ratios with a nearly continuous strontium optical lattice clock},
   journal = {Metrologia},
   year = {2016},
   month = {7},
   day = {8},
   volume = {53},
   number = {4},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {1123},
   keywords = {atomic clocks, high precision spectrocopy, frequency ratios, optical lattice clocks},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1123/meta},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/53/4/1123},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Lodewyck, J and Bilicki, S and Bookjans, E and Robyr, J-L and Shi, C and Vallet, G and Le Targat, R and Nicolodi, D and Le Coq, Y and Gu{\'e}na, J and Abgrall, M and Rosenbusch, P and Bize, S}
}

@Proceedings { ,
   title = {On-board compact system for full time-domain electromagnetic interference measurements},
   journal = {Aerospace EMC (Aerospace EMC), 2016 ESA Workshop on},
   year = {2016},
   month = {7},
   day = {7},
   volume = {1},
   number = {1},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {-},
   keywords = {Electromagnetic interference, Antenna measurements, Voltage measurement, Current measurement, Frequency measurement, Time-domain analysis, Lightning},
   web_url = {http://ieeexplore.ieee.org/document/7504579/},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {-},
   event_place = {Valencia (Spain)},
   event_name = {Aerospace EMC (Aerospace EMC), 2016 ESA Workshop on},
   event_date = {23-05-2016 to 25-05-2016},
   language = {30},
   ISBN = {978-9-2922-1303-9},
   DOI = {10.1109/AeroEMC.2016.7504579},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {16138551},
   author = {Azp{\'u}rua, Marco and Pous, Marc and Silva, Ferran}
}

@Article { ,
   title = {Reference data sets for testing metrology software},
   journal = {Metrologia},
   year = {2016},
   month = {7},
   day = {6},
   volume = {53},
   number = {4},
   number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology},
   pages = {1091-1100},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1091},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IOP Publishing},
   address = {London},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/53/4/1091},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Kok, GJPK and Harris, PMH and Smith, IMS and Forbes, ABF}
}

@Article { ,
   title = {A second generation of low thermal noise cryogenic silicon  resonators},
   journal = {Journal of Physics: Conference Series},
   year = {2016},
   month = {7},
   day = {4},
   volume = {723},
   number = {1},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {012031},
   keywords = {ultrastable laser, thermal noise, coating, silicon resonator},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012031/meta},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {1742-6596},
   DOI = {10.1088/1742-6596/723/1/012031},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Matei, D and Legero, T and Grebing, C and H{\"a}fner, S and Lisdat, C and Weyrich, R and Zhang, W and Sonderhouse, L and Robinson, J M and Riehle, F and Ye, J and Sterr, U}
}

@Proceedings { ,
   title = {A Calibration Setup for IEC 61850-9-2 Test Sets},
   journal = {Not applicable},
   year = {2016},
   month = {7},
   day = {1},
   volume = {Not applicable},
   number = {Not applicable},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {Not applicable},
   keywords = {IEC 61850-9-2, IEEE 1588, Sample Values, Test, Set, Merging Unit},
   web_url = {http://cpem2016.com},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {Ottawa},
   event_name = {2016 Conference on Precision Electromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-7-30},
   author = {Agustoni, M. and Mortara, A.}
}

@Article { ,
   title = {Irradiation-induced degradation of PTB7 investigated by valence band and S 2p photoelectron spectroscopy},
   journal = {Nanotechnology},
   year = {2016},
   month = {7},
   day = {1},
   volume = {27},
   number = {32},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {324005},
   keywords = {organic photo voltaics, XPS, UPS},
   web_url = {http://iopscience.iop.org/article/10.1088/0957-4484/27/32/324005},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0957-4484},
   DOI = {10.1088/0957-4484/27/32/324005},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Darlatt, E and Muhsin, B and Roesch, R and Lupulescu, C and Roth, F and Kolbe, M and Gottwald, A and Hoppe, H and Richter, M}
}

@Article { ,
   title = {A study on ITS-90 type 3 non-uniqueness between freezing points of Al and Ag},
   journal = {Measurement},
   year = {2016},
   month = {7},
   volume = {89},
   number = {July 2016},
   number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination},
   pages = {109-113},
   keywords = {metrology, non-uniqueness, temperature, ITS-90, HTSPRTs},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116300719},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Elsevier},
   address = {London},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2016.04.014},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://ac.els-cdn.com/S0263224116300719/1-s2.0-S0263224116300719-main.pdf?_tid=2e04a3c4-0578-11e6-a14a-00000aacb361\&acdnat=1460992620_67e1c65fd6ee11dc21807238014d192f},
   author = {Coppa, G and Merlone, A}
}

@Proceedings { ,
   title = {Realization of Quantum Hall Effect in Closed Cycle Refrigerators},
   journal = {Conference Digest},
   year = {2016},
   month = {7},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {2},
   keywords = {Cryogen-free, measurement standards, quantum Hall effect, graphene, resistance},
   web_url = {http://cpem2016.com/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Danvers},
   event_place = {Ottawa},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9133-7},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No option selected},
   author = {Kučera, J. and Š{\'i}ra, M. and Svoboda, P. and Kaštil, J.}
}

@Proceedings { ,
   title = {Characterization and Optimization of Ultrasonic Tests for Inspection of Fiber-Reinforced Plastic Composites in Energy Related Applications, 19th World Conference on Non-Destructive Testing 13-17 June 2016, Munich},
   journal = {19th World Conference on Non-Destructive Testing 2016},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {Energy Generation},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   pages = {1-8},
   web_url = {http://www.ndt.net/article/wcndt2016/papers/we4d5.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {NDT.net},
   address = {Bad Breisig, Germany},
   event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany},
   event_name = {19th World Conference on Non-Destructive Testing 2016},
   event_date = {13-06-2016 to 17-06-2016},
   language = {30},
   ISBN = {978-3-940283-78-8},
   ISSN = {1435-4934},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hosseini, SH and Segur, DS and Boehm, RB and Gohlke, DG and Heckel, TH and Riemer, SR and Brackrock, DB and Gaal, MG}
}

@Proceedings { ,
   title = {Characterisation of Artificial and Natural Defects in Fibre Reinforced Plastics Designed for Energy Applications Using Active Thermography},
   journal = {19th World Conference on Non-Destructive Testing 2016},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {Composite Materials},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   pages = {1-9},
   web_url = {http://www.ndt.net/article/wcndt2016/papers/we2i4.pdf},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {NDT.net},
   address = {Bad Breisig, Germany},
   event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany},
   event_name = {19th World Conference on Non-Destructive Testing 2016},
   event_date = {13-06-2016 to 17-06-2016},
   language = {30},
   ISBN = {978-3-940283-78-8},
   ISSN = {1435-4934},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Maierhofer, CM and Krankenhagen, RK and R{\"o}llig, MR and Riemer, SR and Gower, MG and Baker, GB and Lodeiro, ML and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Adibekyan, AA and Gutschwager, BG}
}

@Proceedings { ,
   title = {Simulation of ultrasonic inspections of composite structures in the CIVA software platform},
   journal = {19th World Conference on Non-Destructive Testing 2016},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {Modelling and Data Processing},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   pages = {1-8},
   keywords = {Ultrasonic Testing (UT), Modelling and Data Processing},
   web_url = {http://www.ndt.net/article/wcndt2016/papers/fr1h5.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {NDT.net},
   address = {Bad Breisig, Germany},
   event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany},
   event_name = {19th World Conference on Non-Destructive Testing 2016},
   event_date = {13-06-2016 to 17-06-2016},
   language = {30},
   ISBN = {978-3-940283-78-8},
   ISSN = {1435-4934},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Jezzine, KJ and Segur, DS and Ecault, RE and Dominguez, ND}
}

@Proceedings { ,
   title = {Design and manufacture of reference and natural defect artefacts for the evaluation of NDE techniques for fibre reinforced plastic (FRP) composites in energy applications},
   journal = {19th World Conference on Non-Destructive Testing 2016},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {Composite Materials},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   pages = {1-10},
   keywords = {Infrared Testing (IRT), Ultrasonic Testing (UT), Visual and Optical Testing (VT/OT), Other Methods, delamination, validation, carbon fiber reinforced plastic (CFRP), Glass Fiber Reinforced Plastic (GFRP), tensile load, flat bottom hole},
   web_url = {http://www.ndt.net/article/wcndt2016/papers/we1e4.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {NDT.net},
   address = {Bad Breisig, Germany},
   event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany},
   event_name = {19th World Conference on Non-Destructive Testing 2016},
   event_date = {13-06-2016 to 17-06-2016},
   language = {30},
   ISBN = {978-3-940283-78-8},
   ISSN = {1435-4934},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Gower, MG and Lodeiro, ML and Aktas, AA and Shaw, RS and Maierhofer, CM and Krankenhagen, RK and Augustin, SA and R{\"o}llig, MR and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Judaschke, RJ and Segur, DS}
}

@Proceedings { ,
   title = {A Calibration Method of the Linearity of Lock In Amplifiers},
   journal = {CPEM 2016 Digest},
   year = {2016},
   month = {7},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {549-550},
   keywords = {Impedance bridge, lock in amplifier, linearity, phase sensitive detector, resistive divider},
   web_url = {http://ieeexplore.ieee.org/document/7540691/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {CPEM 2016},
   address = {Ottawa},
   event_place = {The Westin Ottawa. Ottawa, Ontario (Canada).},
   event_name = {Conference on Precision Electromagnetics Measurements 2016},
   event_date = {10-07-2016 50 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540691},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Raso Alonso, F{\'e}lix isidro and Hortelano0 Garc{\'i}a, Alexandra and Izquierdo Garc{\'i}a, Mª Mar}
}

@Proceedings { ,
   title = {Determination of the Verdet Constant of Low Birefringence Single-Mode Optical Fiber},
   journal = {Conference on Precision Electromagnetic Measurements},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {1},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {ID127212},
   keywords = {Optical fiber, Faraday efect, Verdet constant, birefringence, current sensor},
   web_url = {http://ieeexplore.ieee.org/document/7540523/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {Danvers},
   language = {30},
   DOI = {10.1109/CPEM.2016.7540523},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://www.cpem2016.com/welcome_e.shtml},
   author = {Istrate, D. and Etienne, R. and Dubard, J. and Litwin, A. and Enouf, O.}
}

@Article { GiuscaSPZCMSK2016,
   title = {Effects of humidity on the electronic properties of graphene prepared by chemical vapour deposition},
   journal = {Carbon},
   year = {2016},
   month = {7},
   volume = {103},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {273-280},
   keywords = {Chemical vapour deposition, Graphene, Kelvin probe force microscopy, Raman spectroscopy},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Elsevier},
   address = {New York, USA},
   language = {30},
   DOI = {10.1016/j.carbon.2016.03.018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Giusca, Christina E. and Spencer, Steve and Panchal, Vishal and Zurutuza, Amaia and Centeno, Alba and Melios, Christos and Silva, S. Ravi P. and Kazakova, Olga}
}

@Article { LarsonDCWLP2016,
   title = {Power quality propagation measurements in smart grids},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {-},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-2},
   keywords = {Sea measurements, Current measurement, Power quality, Global Positioning System, Integrated circuit modeling, Smart grids, Instruments},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {New Jersey},
   language = {30},
   ISSN = {-},
   DOI = {10.1109/CPEM.2016.7540458},
   stag_bib_extends_levelofaccess = {NA},
   author = {Larson, B. and Davis, P. N. and Christensen, A. E. and Wright, P. S. and Lippert, T. and Patel, P.}
}

@Article { Pogliano2016,
   title = {Dynamic algorithms for PMUs — Methods for improving the signal processing effectiveness},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {-},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-2},
   keywords = {Signal processing algorithms, Heuristic algorithms, Phasor measurement units, Harmonic analysis, Power harmonic filters, Synchronization},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {New Jersey},
   language = {30},
   DOI = {10.1109/CPEM.2016.7540743},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pogliano, Umberto}
}

@Proceedings { ManninenKML2016,
   title = {Methods for characterization and minimization of microwave background in cryogenic environment},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   keywords = {Cryogenics, microwave filters, metrology, single electron transistors},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   DOI = {10.1109/CPEM.2016.7540789},
   stag_bib_extends_levelofaccess = {NA},
   author = {Manninen, A. and Kemppinen, A. and Mykk{\"a}nen, E. and Lehtinen, J. S.}
}

@Article { LuisoLGGCM2016,
   title = {Frequency calibration of MV voltage transformer under actual waveforms},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   keywords = {Frequency measurement, Calibration, Voltage measurement, Harmonic analysis, Capacitors, Power measurement, Distortion measurement},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/CPEM.2016.7540709},
   stag_bib_extends_levelofaccess = {NA},
   author = {Luiso, M. and Landi, C. and Giordano, D. and Gallo, D. and Crotti, G. and Modarres, M.}
}

@Article { EkinsDaukesA2016,
   title = {Photoluminescence-Based Current–Voltage Characterization of Individual Subcells in Multijunction Devices},
   journal = {IEEE Journal of Photovoltaics},
   year = {2016},
   month = {7},
   volume = {6},
   number = {4},
   number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells},
   pages = {1004-1011},
   keywords = {III-V multijunction solar cell measurement, Photoluminescence, Characterization of PV},
   web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=7452344},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2156-3381, 2156-3403},
   DOI = {10.1109/JPHOTOV.2016.2547583},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ekins-Daukes, N. and Alonso-Alvarez, D.}
}

@Article { vandenBromRWCB2016,
   title = {Smart grid power quality and stability measurements in Europe},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   keywords = {instrument transformers, smart grids, metrology, phasor measurement units, synchrophasors, power quality,impedance measurement},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/CPEM.2016.7540462},
   stag_bib_extends_levelofaccess = {NA},
   author = {van den Brom, H. E. and Rietveld, G. and Wright, P. S. and Crotti, G. and Braun, J. P.}
}

@Proceedings { StyblikovaKHPD2016,
   title = {Use of a nanocrystalline core for a precise non-invasive AC current measurement},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   keywords = {AC current sensor, nanocrystalline material, non-invasive measurement, phase displacement, ratio error.},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   event_place = {Ottawa, ON, Canada},
   event_name = {2016 Conference on Precision Electromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540492},
   stag_bib_extends_levelofaccess = {NA},
   author = {Styblikova, R. and Knenicky, M and Hlavacek, J. and Prochazka, R. and Draxler, K.}
}

@Article { EbertWPN2016,
   title = {Tunable Diode Laser Absorption Spectroscopy Sensor for Calibration Free Humidity Measurements in Pure Methane and Low CO2 Natural Gas},
   journal = {Applied Spectroscopy},
   year = {2016},
   month = {7},
   volume = {71},
   number = {5},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {888-900},
   keywords = {laser absorption spectroscopy},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {SAGE Publications},
   language = {30},
   ISSN = {0003-7028, 1943-3530},
   DOI = {10.1177/0003702816658672},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ebert, V. and Werhahn, O. and Pratzler, S. and Nwaboh, J.A.}
}

@Article { MerimaaWWMJGKNTLHLGP2016,
   title = {Frequency Comparison of171Yb+Ion Optical Clocks at PTB and NPL via GPS PPP},
   journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control},
   year = {2016},
   month = {7},
   volume = {63},
   number = {7},
   number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions},
   pages = {981-985},
   keywords = {Frequency transfer,  GPS precise point positioning (PPP),  optical clock},
   web_url = {https://ieeexplore.ieee.org/document/7398135/keywords},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0885-3010},
   DOI = {10.1109/TUFFC.2016.2524988},
   stag_bib_extends_levelofaccess = {NA},
   author = {Merimaa, M. and Wallin, A. and Whibberley, P. B. and Margolis, H. S. and Jones, J. M. and Godun, R. M. and King, S. A. and Nisbet-Jones, P. B. R. and Tamm, C. and Lipphardt, B. and Huntemann, N. and Leute, J. and Gill, P. and Peik, E.}
}

@Article { KielerMNBO2016,
   title = {Packaging of fiber-coupled module for Josephson junction array voltage standards},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   keywords = {Optical fibers, Photodiodes, Silicon, Cryogenics, Bonding, Stress, Flip-chip devices},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/CPEM.2016.7540561},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kieler, O. and Malmbekk, H. and Nguyen, T.A.T. and Bardalen, E. and Ohlckers, P.}
}

@Proceedings { ,
   title = {RF wafer probing with improved contact repeatability using nanometer positioning},
   journal = {Microwave Measurement Conference (ARFTG), 2016 87th ARFTG},
   year = {2016},
   month = {6},
   day = {30},
   number = {N/A},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {N/A},
   keywords = {Probes, Standards, Frequency measurement, Radio frequency, Calibration, Microwave measurement,},
   web_url = {https://hal.archives-ouvertes.fr/hal-02083251/document},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {San Francisco CA USA},
   event_name = {Microwave Measurement Conference (ARFTG), 2016 87th ARFTG},
   event_date = {27-05-2016 to 27-05-2016},
   language = {30},
   ISBN = {978-1-5090-1308-1},
   DOI = {10.1109/ARFTG.2016.7501967},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Daff{\'e}, K. and Dambrine, G. and von Kleist-Retzow, F. and Haddadi, K.}
}

@Article { GiazottoE2016,
   title = {Superconducting Quantum Interference Single-Electron Transistor},
   journal = {Physical Review Applied},
   year = {2016},
   month = {6},
   day = {30},
   volume = {5},
   number = {6},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   pages = {064020},
   keywords = {coulomb blockade, mesoscopics, proximity effect},
   web_url = {https://journals.aps.org/prapplied/abstract/10.1103/PhysRevApplied.5.064020},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.5.064020},
   stag_bib_extends_levelofaccess = {NA},
   author = {Giazotto, Francesco and Enrico, Emanuele}
}

@Article { PottieALB2016,
   subid = {133},
   title = {Ultrastable optical frequency dissemination on a multi-access fibre network},
   journal = {Applied Physics B},
   year = {2016},
   month = {6},
   day = {25},
   volume = {122},
   number = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   web_url = {https://link.springer.com/article/10.1007/s00340-016-6463-3},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   address = {New York},
   language = {30},
   ISSN = {0946-2171, 1432-0649},
   DOI = {10.1007/s00340-016-6463-3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pottie, P.E. and Amy-Klein, A. and Lopez, O. and Bercy, A.}
}

@Article { ,
   title = {Precise measurement of the performance of thermoelectric modules},
   journal = {Measurement Science and Technology},
   year = {2016},
   month = {6},
   day = {23},
   volume = {27},
   number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells},
   pages = {085002},
   keywords = {thermoelectric generator, metrology, accuracy, precision, reproducibility},
   web_url = {http://iopscience.iop.org/article/10.1088/0957-0233/27/8/085002/meta},
   web_url2 = {http://pubs.rsc.org/en/content/ebook/978-1-78262-323-6\#!divbookcontent},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Physics},
   address = {London},
   language = {30},
   DOI = {10.1088/0957-0233/27/8/085002},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-6-23},
   stag_bib_extends_persistent_identifier = {http://pubs.rsc.org/en/content/chapter/bk9781782623236-00109/978-1-78262-323-6\#!divabstract},
   author = {DIAZ-CHAO, P and MUNIZ-PINIELLA, A and SELEZNEVA, E and Cuenat, A}
}

@Thesis { ,
   title = {Reducing surface recombination in black silicon photovoltaic devices using atomic layer deposition},
   year = {2016},
   month = {6},
   day = {20},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   keywords = {black silicon, atomic layer deposition, surface passivation, photovoltaic devices},
   web_url = {http://urn.fi/URN:ISBN:978-952-60-6919-7},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Unigrafia Oy},
   address = {Helsinki},
   school = {Aalto University},
   language = {30},
   ISBN = {978-952-60-6919-7},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://urn.fi/URN:ISBN:978-952-60-6919-7},
   author = {Repo, P.R.}
}

@Article { ,
   title = {Decoy-state quantum key distribution with a leaky source},
   journal = {New Journal of Physics},
   year = {2016},
   month = {6},
   day = {20},
   volume = {18},
   number = {June 2016},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {065008},
   keywords = {quantum key distribution, device-independent quantum key distribution, quantum communication, security analysis,
information leakage, Trojan horse attacks},
   web_url = {http://iopscience.iop.org/journal/1367-2630},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   address = {Bristol (UK)},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/18/6/065008},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Tamaki, K. and Curty, M. and Lucamarini, M. and Gramegna, Marco}
}

@Article { ,
   title = {Novel multi-feature bar design for machine tools geometric errors identification},
   journal = {Precision Engineering},
   year = {2016},
   month = {6},
   day = {18},
   volume = {46},
   number = {--},
   number2 = {IND62: TIM: Traceable in-process dimensional measurement},
   pages = {323–338},
   keywords = {New material standard, Reversal technique, Calibration, Geometric errors, Machine tools},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier Inc.},
   address = {Elsevier Inc.},
   language = {30},
   ISSN = {0141-6359},
   DOI = {10.1016/j.precisioneng.2016.06.002},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Viprey, FB and Nouira, HN and Lavernhe, SL and Tournier, CT}
}

@Proceedings { OliveiraNKRVNHHT2016,
   title = {Geometric and Reflectance Signature Characterization of Complex Canopies using Hyperspectral Stereoscopic Images from UAV and Terrestrial Platforms},
   journal = {ISPRS - International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences},
   year = {2016},
   month = {6},
   day = {17},
   volume = {XLI-B7},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {77-82},
   keywords = {Hyperspectral, Radiometry, Photogrammetry, Geometry, Matching, Uncertainty},
   web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B7/77/2016/isprs-archives-XLI-B7-77-2016.pdf},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   address = {Gottingen},
   event_place = {Prague, Czech Republic},
   event_name = {XXIII ISPRS Congress},
   event_date = {12-07-2016 to 19-07-2016},
   language = {30},
   ISSN = {2194-9034},
   DOI = {10.5194/isprsarchives-XLI-B7-77-2016},
   stag_bib_extends_levelofaccess = {NA},
   author = {Oliveira, R. and N{\"a}si, R. and Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Nevalainen, O. and Hakala, T. and Honkavaara, E. and Tommaselli, A.}
}

@Proceedings { CalmonDESJ2016,
   title = {Hybrid ray-FDTD model for the simulation of the ultrasonic inspection of CFRP parts},
   journal = {QNDE16},
   year = {2016},
   month = {6},
   day = {16},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   keywords = {Hybrid ray-FDTD  simulation ultrasonic inspection  CFRP},
   web_url = {http://aip.scitation.org/doi/pdf/10.1063/1.4974660},
   misc2 = {EMRP A169: Call 2013 Energy II},
   event_place = {Atlanta},
   event_name = {QNDE16},
   event_date = {17-07-2016 to 22-07-2016},
   language = {30},
   DOI = {10.1063/1.4974660},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calmon, P. and Dominguez, N. and Ecault, R. and S{\'e}gur, D. and Jezzine, K.}
}

@Article { ,
   title = {Consistency analysis of multidimensional gonio-spectrophotometric measurements in interlaboratory comparisons},
   journal = {Metrologia},
   year = {2016},
   month = {6},
   day = {14},
   volume = {53},
   number = {4},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {1024-1030},
   keywords = {BRDF, goniospectrophotometry, interlaboratory comparison},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1024/meta},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {Online ISSN: 1681-7575, Print ISSN: 0026-1394},
   DOI = {10.1088/0026-1394/53/4/1024},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ferrero, A and Campos, J and Bernad, B and Pons, A and Hernanz, M L and Mart{\'i}nez-Verd{\'u}, F M and H{\"o}pe, A}
}

@Article { ,
   title = {High-speed atomic force microscopy for materials science},
   journal = {International Materials Reviews},
   year = {2016},
   month = {6},
   day = {14},
   volume = {61},
   number = {8},
   number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom},
   pages = {473-494},
   keywords = {Atomic force microscopy, AFM, High-speed AFM, Nanoscale analysis},
   web_url = {http://www.tandfonline.com/doi/abs/10.1080/09506608.2016.1156301?journalCode=yimr20},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Taylor \& Francis},
   address = {London},
   language = {30},
   DOI = {10.1080/09506608.2016.1156301},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Payton, O.D. and Picco, L. and Scott, T.B.}
}

@Article { ,
   title = {High-performance near- and mid-infrared crystalline coatings},
   journal = {Optica},
   year = {2016},
   month = {6},
   day = {13},
   volume = {3},
   number = {6},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {647},
   keywords = {(300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings;
(310.1860) Deposition and fabrication; (140.4780) Optical resonators.},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Optical Society of America},
   address = {Washington, D.C. 20036-1012 USA},
   language = {30},
   ISSN = {2334-2536},
   DOI = {10.1364/OPTICA.3.000647},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {COLE, G D and ZHANG, W and BJORK, B J and FOLLMAN, D and HEU, P and DEUTSCH, C and SONDERHOUSE, L and ROBINSON, J and FRANZ, C and ALEXANDROVSKI, A and NOTCUTT, M and HECKL, O H and YE, J and ASPELMEYER, M}
}

@Article { DauresRODB2016,
   title = {Accuracy of a dose-area product compared to an absorbed dose to water at a point in a 2 cm diameter field},
   journal = {Medical Physics},
   year = {2016},
   month = {6},
   day = {10},
   volume = {43},
   number = {7},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {4085-4092},
   keywords = {small fields, dose-area product, EBT3, dosimetric references},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {0094-2405},
   DOI = {10.1118/1.4953207},
   stag_bib_extends_levelofaccess = {NA},
   author = {Daures, J. and Rapp, B. and Ostrowsky, A. and Dufreneix, S. and Bordy, J. M.}
}

@Article { ,
   title = {Uncertainty propagation in computationally expensive models: A survey of sampling methods and application to scatterometry},
   journal = {Measurement},
   year = {2016},
   month = {6},
   day = {8},
   volume = {in press, corrected proof},
   number = {in press, corrected proof},
   number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation},
   pages = {-},
   keywords = {smart sampling, statistical inverse problem, scatterometry},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116302901},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {-},
   DOI = {10.1016/j.measurement.2016.06.009},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Heidenreich, S and Gross, H and B{\"a}r, M and Wright, L}
}

@Proceedings { ,
   title = {Development of a novel high precision Large Range Small Angle Generator},
   journal = {Proceedings of the 16th International Conference of the European Society for Precision Engineering and Nanotechnology},
   year = {2016},
   month = {6},
   day = {3},
   volume = {1},
   number = {1},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-2},
   keywords = {Angle, angle metrology, small angle generator, SAG, autocollimator, calibration, Robert´s mechanism},
   web_url = {http://www.euspen.eu/events/16th-international-conference-exhibition/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {euspen},
   address = {Cranfield, Bedfordshire, MK43 0AL, United Kingdom},
   event_place = {Nottingham, UK.},
   event_name = {Cranfield, Bedfordshire, MK43 0AL, United Kingdom},
   event_date = {30 May – 3 June 2016},
   language = {30},
   ISBN = {9780956679086},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://www.euspen.eu/events/16th-international-conference-exhibition/},
   author = {Olarra, A and Delgado, A and Zubieta, M and Kortaberria, G and Prieto, E and Perez, MM and Morlanes, T}
}

@Proceedings { ,
   title = {REAC: The new INRIM rotating encoder angle comparator},
   journal = {Proceedings of the 16th International Conference of the European Society for Precision Engineering and Nanotechnology},
   year = {2016},
   month = {6},
   day = {3},
   volume = {1},
   number = {1},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-2},
   keywords = {Angle metrology, angle encoder,  nanoradians},
   web_url = {http://www.euspen.eu/events/16th-international-conference-exhibition/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {euspen},
   address = {Cranfield, Bedfordshire, MK43 0AL, United Kingdom},
   event_place = {Nottingham, UK},
   event_name = {Cranfield, Bedfordshire, MK43 0AL, United Kingdom},
   event_date = {30 May – 3 June 2016},
   language = {30},
   ISBN = {9780956679086},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://www.euspen.eu/events/16th-international-conference-exhibition/},
   author = {Pisani, M and Astrua, M}
}

@Article { ,
   title = {Atomic fountains and optical clocks at SYRTE: Status and perspectives},
   journal = {Comptes Rendus Physique},
   year = {2016},
   month = {6},
   day = {1},
   volume = {16},
   number = {5},
   number2 = {SIB55: ITOC: International timescales with optical clocks},
   pages = {461 - 470},
   keywords = {Atomic fountain clocks, Optical lattice clocks, Optical frequency combs, Stability of natural constants, Timekeeping},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1631070515000614},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1016/j.crhy.2015.03.010},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-6-1},
   author = {Abgrall, M and Chupin, B and De Sarlo, L and Guena, J and Laurent, P and Le Coq, Y and Le Targat, R and Lodewyck, J and Lours, M and Rosenbuch, P and Rovera, G. D. and Bize, S}
}

@Article { ,
   title = {XPS depth profiling of an ultrathin bioorganic film with an argon gas cluster ion beam},
   journal = {Biointerphases},
   year = {2016},
   month = {6},
   day = {1},
   volume = {11},
   number = {2},
   number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices},
   pages = {029603},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {American Vacuum Society},
   address = {New Yokk},
   language = {30},
   ISSN = {1934-8630},
   DOI = {10.1116/1.4948341},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-6-1},
   author = {Dietrich, P.M and Nietzold, C and Weise,, M and Unger,, W.E.S and Alnabulsi,, S and Moulder, J}
}

@Article { SterrAKGHVL2016,
   title = {A transportable optical lattice clock},
   journal = {Journal of Physics: Conference Series},
   year = {2016},
   month = {6},
   volume = {723},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {012020},
   keywords = {time and frequency metrology, transportable optical lattice clock, chronometric geodesy},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012020/meta},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/723/1/012020},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sterr, U. and Al-Masoudi, A. and Koller, S. and Grotti, J. and H{\"a}fner, S. and Vogt, S. and Lisdat, C.}
}

@Article { ,
   title = {Dual-frequency comb generation with differing GHz repetition rates by parallel Fabry–Perot cavity filtering of a single broadband frequency comb source},
   journal = {Measurement Science and Technology},
   year = {2016},
   month = {5},
   day = {31},
   volume = {27},
   number = {7},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {074011},
   keywords = {femtosecond frequency comb, cavity mode filtering, free spectral range measurement, length metrology, multi-wavelength interferometry},
   web_url = {http://iopscience.iop.org/article/10.1088/0957-0233/27/7/074011/meta},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing Ltd.},
   language = {30},
   DOI = {10.1088/0957-0233/27/7/074011},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mildner, J. and Meiners-Hagen, K. and Pollinger, F.}
}

@Article { ,
   title = {Alternative radiated emission measurements at close distance in industry},
   journal = {International Journal of RF and Microwave Computer-Aided Engineering},
   year = {2016},
   month = {5},
   day = {31},
   volume = {26},
   number = {4},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {294-303},
   keywords = {Alternative; close distance; emission; on-site; radiated},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/mmce.20977/epdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Wiley Online Library},
   address = {USA},
   language = {30},
   ISSN = {-},
   DOI = {10.1002/mmce.20977},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Şen, Osman and TEKTAŞ, Bahadır and \c{C}akır, Soydan and \c{C}etintaş, Mustafa}
}

@Proceedings { ,
   title = {Calibration and correction of a 6 degree of freedom piezo driven stage},
   journal = {Proceedings of the 16th international conference of the european society for precision engineering and nanotechnology (euspen)},
   year = {2016},
   month = {5},
   day = {30},
   volume = {1},
   number = {P1.59},
   number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom},
   pages = {2},
   keywords = {6 degrees of freedom stage, calibration, parallel cinematics, nano-positioning, multi-axis correction model},
   web_url = {http://www.euspen.eu/Library/ProceedingsPresentations.aspx},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {euspen},
   address = {Bedford},
   event_place = {Nottingham, UK},
   event_name = {16th international conference of the european society for precision engineering and nanotechnology (euspen)},
   event_date = {May 30th – 3rd June 2016},
   language = {30},
   ISBN = {978-0-9566790-8-6},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {K{\"u}ng, A. and Nicolet, A. and Meli, F.}
}

@Proceedings { ,
   title = {Assessing fringe projector volumetric error sources},
   journal = {Proceedings of the 16th international conference of the european society for precision engineering and nanotechnology},
   year = {2016},
   month = {5},
   day = {30},
   number2 = {IND62: TIM: Traceable in-process dimensional measurement},
   keywords = {3D optical scanner, characterisation, verification, tetrahedron},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Euspen},
   address = {Cranfield},
   event_place = {Nottingham},
   event_name = {16th international conference of the european society for precision engineering and nanotechnology},
   event_date = {30-05-2016 to 05-06-2016},
   language = {30},
   ISBN = {978-0-9566790-8-6},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Dury, M R and Brown, S B and McCarthy, M B and Woodward, S D}
}

@Proceedings { ,
   title = {Maximizing the Benefit of Existing Equipment for Nonlinear and Communication Measurements},
   journal = {N/A},
   year = {2016},
   month = {5},
   day = {27},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Nonlinear measurements, oscilloscope, sampling, analogue to digital conversion},
   web_url = {http://www.arftg.org/},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {San Francisco, CA, USA},
   event_name = {87th ARFTG Microwave Measurement Conference},
   event_date = {27-05-2016},
   language = {30},
   ISBN = {978-1-5090-1308-1},
   ISSN = {N/A},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-9-30},
   stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART},
   author = {Humphreys, D.  A. and Raffo, A. and Bosi, G. and Vannini, G. and Schreurs, D. and Gebremicael, K. N. and Morris, K.}
}

@Proceedings { ,
   title = {Impact of Microwave Measurement Uncertainty on the Nonlinear Embedding Procedure},
   journal = {N/A},
   year = {2016},
   month = {5},
   day = {27},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Microwave measurements uncertainty, microwave transistors, nonlinear embedding, power amplifiers, vector-calibrated nonlinear measurements.},
   web_url = {http://www.arftg.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {San Francisco, CA, USA},
   event_name = {87th ARFTG Microwave Measurement Conference},
   event_date = {27-05-2016},
   language = {30},
   ISBN = {978-1-5090-1308-1},
   ISSN = {N/A},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-9-30},
   stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART},
   author = {Bosi, G. and Raffo, A. and Avolio, G. and Schreurs, D. and Humphreys, D. A.}
}

@Proceedings { ,
   title = {Traceable High Impedance Calibration Standards},
   journal = {87th ARFTG Microwave Measurement Conference (ARFTG)},
   year = {2016},
   month = {5},
   day = {27},
   volume = {n/a},
   number = {n/a},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Calibration standards, characterization, electromagnetic simulation, microwave measurement, scattering parameters},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7501942\&isnumber=7501936},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {San Francisco, CA, USA},
   event_name = {87th ARFTG Microwave Measurement Conference (ARFTG)},
   event_date = {27 May 2016},
   language = {30},
   ISBN = {n/a},
   ISSN = {n/a},
   DOI = {10.1109/ARFTG.2016.7501942},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Haase, Martin and Hoffmann, Karel and Hudlička, Martin}
}

@Proceedings { ,
   title = {A study of the reference impedance influence on a TRL calibration},
   journal = {Proceedings 87th ARFTG Microwave Measurement Conference},
   year = {2016},
   month = {5},
   day = {27},
   volume = {n.a.},
   number = {n.a.},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Network analysis, calibration, impedance, metrology.},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Danvers,},
   event_place = {San Francisco},
   event_name = {87th ARFTG Microwave Measurement Conference},
   event_date = {27-05-2016},
   language = {30},
   ISBN = {978-1-5090-1308-1},
   ISSN = {n.a.},
   DOI = {10.1109/ARFTG.2016.7501969},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-1-1},
   author = {Kuhlmann, K.}
}

@Proceedings { ,
   title = {Investigating correlations in frequency-domain S-parameter measurements},
   journal = {Proceedings 87th ARFTG Microwave Measurement Conference},
   year = {2016},
   month = {5},
   day = {27},
   volume = {n.a.},
   number = {n.a.},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {S-parameters, uncertainty of measurement, uncertainty matrices, measurement covariance matrix, correlation},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Danvers},
   event_place = {San Francisco},
   event_name = {87th ARFTG Microwave Measurement Conference},
   event_date = {27-05-2016},
   language = {30},
   ISBN = {978-1-5090-1308-1},
   ISSN = {n.a.},
   DOI = {10.1109/ARFTG.2016.7501951},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-1-1},
   author = {Arz, U.}
}

@Article { ,
   title = {Fundamentals of multiplexing with digital PCR},
   journal = {Biomolecular Detection and Quantification},
   year = {2016},
   month = {5},
   day = {27},
   volume = {10},
   number = {Special issue on dPCR},
   number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules},
   pages = {15-23},
   keywords = {dPCR, Digital PCR, Duplex, Higher order multiplexing, Multiplexing},
   web_url = {http://www.sciencedirect.com/science/article/pii/S2214753516300092},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {2214-7535},
   DOI = {10.1016/j.bdq.2016.05.002},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S2214753516300092},
   author = {Whale, AS and Huggett, JF and Tzonev, S}
}

@Article { ,
   title = {Realization of a timescale with an accurate optical lattice clock},
   journal = {Optica},
   year = {2016},
   month = {5},
   day = {25},
   volume = {3},
   number = {6},
   number2 = {SIB55: ITOC: International timescales with optical clocks},
   pages = {563-569},
   keywords = {optical clocks, SI units, caesium fountain clocks, metrology, atom optics, spectroscopy, high resolution},
   web_url = {http://arxiv.org/abs/1511.03888},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Optical Society of America},
   address = {Washington DC},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1364/OPTICA.3.000563},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-5-25},
   author = {Grebing, C and Al-Masoudi, A and D{\"o}rscher, S and H{\"a}fner, S and Gerginov, V and Weyers, S and Lipphardt, B and Sterr, U and Lisdat, C}
}

@Article { ,
   title = {Aperture alignment in autocollimator-based deflectometric profilometers},
   journal = {REVIEW OF SCIENTIFIC INSTRUMENTS},
   year = {2016},
   month = {5},
   day = {24},
   volume = {87},
   number = {051906 (2016)},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-9},
   keywords = {Apertures, Calibration Charge coupled devices, Ray tracing, Optical aberrations},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4950734},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Institute of Physics},
   address = {Melville, NY 11747-4300 USA},
   language = {30},
   ISSN = {Print: 0034-6748, Online: 1089-7623},
   DOI = {10.1063/1.4950734},
   extern = {1},
   stag_bib_extends_fe_group = {55,59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Geckeler, R. D. and Artemiev, N. A. and Barber, S. K. and Just, A and Lacey, I. and Kranz, O and Smith, B. V. and Yaschckuk, V. V.}
}

@Article { ,
   title = {Linear chirped slope profile for spatial calibration in slope measuring deflectometry},
   journal = {REVIEW OF SCIENTIFIC INSTRUMENTS},
   year = {2016},
   month = {5},
   day = {24},
   volume = {87},
   number = {051907 (2016)},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-9},
   keywords = {Spatial resolution, Modulation transfer functions, Topography, Calibration, Spatial dimensions},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4950737},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Institute of Physics},
   address = {Melville, NY 11747-4300 USA},
   language = {30},
   ISSN = {ISSN: Print: 0034-6748, Online: 1089-7623},
   DOI = {10.1063/1.4950737},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Siewert, F and Zeschke, T and Arnold, T and Paetzelt, H and Yashchuk, VV}
}

@Proceedings { ,
   title = {Comparison of an NMR-based Bioenergy Moisture Measurement Instrument against the Loss-on-Drying Method},
   journal = {Proceedngs of the 11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances, Florence, ITALY, 2016},
   year = {2016},
   month = {5},
   day = {23},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {285-296},
   keywords = {moisture measurement, bioenergy, NMR, oven drying, LoD},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Edifir-Edizione},
   address = {Florence},
   event_place = {Florence, Italy},
   event_name = {International Conference on Electromagnetic Wave Interaction with Water and Moist Substances, ISEMA 2016},
   event_date = {May 23 - 27, 2016},
   language = {30},
   ISBN = {978-88-7970-800-5},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Osterberg, P and Heinonen, M and Ojanen-Saloranta, M and M{\"a}kynen, A}
}

@Proceedings { ,
   title = {Influence of dielectric support on military radiated emission tests above 30 MHz},
   journal = {2016 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)},
   year = {2016},
   month = {5},
   day = {21},
   volume = {01},
   number = {-},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {709-711},
   keywords = {Radiated Emission, REI 02, Support, MIL-STD- 46IF},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7522843\&newsearch=true\&queryText=RE102\%20support},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {USA},
   event_place = {Shenzhen},
   event_name = {2016 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)},
   event_date = {17-05-2016 to 21-05-2016},
   language = {30},
   ISBN = {-},
   ISSN = {-},
   DOI = {10.1109/APEMC.2016.7522843},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Şen, Osman and \c{C}akır, Soydan and CELEP, Murat and \c{C}ınar, Mehmet and HAMID, Ramiz and \c{C}etintaş, Mustafa}
}

@Article { ,
   title = {High precision tilt stage as a key element to a universal test mirror for characterization and calibration of slope measuring instruments},
   journal = {REVIEW OF SCIENTIFIC INSTRUMENTS},
   year = {2016},
   month = {5},
   day = {20},
   volume = {87},
   number = {051904 (2016)},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-12},
   keywords = {Calibration, Mirrors, X-ray optics, Apertures, Comparators},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4950729},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Institute of Physics},
   address = {Melville, NY 11747-4300 USA},
   language = {30},
   ISSN = {Print: 0034-6748, Online: 1089-7623},
   DOI = {10.1063/1.4950729},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yashchuk, VV and Artemiev, NA and Centers, G and Chaubard, A and Geckeler, RD and Lacey, I and Marth, H and McKinney, WR and Noll, T and Siewert, F and Winter, M and Zeschke, T}
}

@Article { ,
   title = {Application of advanced shearing techniques to the calibration of autocollimators with small angle generators and investigation of error source},
   journal = {REVIEW OF SCIENTIFIC INSTRUMENTS},
   year = {2016},
   month = {5},
   day = {20},
   volume = {87},
   number = {051903 (2016)},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-14},
   keywords = {Calibration, Error analysis, Data sets, Data analysis, Time measurement},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4950720},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Institute of Physics},
   address = {Melville, NY 11747-4300 USA},
   language = {30},
   ISSN = {Print: 0034-6748, Online: 1089-7623},
   DOI = {10.1063/1.4950720},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yandayan, T and Geckeler, RD and Aksulu, M and Akgoz, SA and Ozgur, B}
}

@Article { WangBRdBBRBH2016,
   title = {Cross sections for ionization of tetrahydrofuran by protons at energies between 300 and 3000 keV},
   journal = {Physical Review A},
   year = {2016},
   month = {5},
   day = {20},
   volume = {93},
   number = {5},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {DNA cross sections, proton impact, tetrahydrofuran, Bragg peak},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {American Physical Society (APS)},
   address = {1 Research Road,Ridge, NY 11961-2701, (631) 591-4000, United States},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.93.052711},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wang, Mingjie and Bennett, Daniel and Rudek, Benedikt and de Vera, Pablo and Bug, Marion and Buhr, Ticia and Rabus, Hans and Baek, Woon Yong and Hilgers, Gerhard}
}

@Proceedings { ,
   title = {Radiation of the coaxial-microstrip transition in precise microwave measurements},
   journal = {43rd meeting of the Czech elektrotechnical society},
   year = {2016},
   month = {5},
   day = {19},
   volume = {n/a},
   number = {n/a},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {microwave measurement, microstrip, radiation, canyon},
   web_url = {web.cvut.cz/ces/mt/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Czech electrotechnical society},
   address = {Prague},
   event_place = {Prague, Czech Republic},
   event_name = {43rd meeting of the Czech elektrotechnical society},
   event_date = {19 May 2016},
   language = {27},
   ISBN = {978-80-02-02654-9},
   ISSN = {n/a},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hoffmann, Karel}
}

@Article { ,
   title = {Nonequilibrium thermodynamics of the spin Seebeck and spin Peltier effects},
   journal = {Physical Review B},
   year = {2016},
   month = {5},
   day = {18},
   volume = {93},
   number = {184421},
   number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems},
   pages = {184421-1-11},
   keywords = {spincaloritronics, Spin-Seebeck, Spin-Peltier},
   web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.93.184421},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {American Physical Society},
   address = {College Park, MD},
   language = {30},
   ISSN = {2469-9969 (online), 2469-9950 (print)},
   DOI = {10.1103/PhysRevB.93.184421},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Basso, V. and Ferraro, E. and Magni, A. and Sola, A. and Kuepferling, M. and Pasquale, M.}
}

@Article { MaturilliVVMM2016,
   title = {Towards a calibration laboratory in Ny-{\AA}lesund},
   journal = {Rendiconti Lincei},
   year = {2016},
   month = {5},
   day = {17},
   volume = {27},
   number = {S1},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {243-249},
   keywords = {Metrology, Ny-{\AA}lesund, Arctic Climate, Calibration},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2037-4631, 1720-0776},
   DOI = {10.1007/s12210-016-0531-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Maturilli, Marion and Vitale, Vito and Viola, Angelo and Merlone, Andrea and Musacchio, Chiara}
}

@Article { ,
   title = {State of the Art of Tactile Micro Coordinate Metrology},
   journal = {Appied Sciences},
   year = {2016},
   month = {5},
   day = {16},
   volume = {6},
   number = {150},
   number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products},
   pages = {1-13},
   keywords = {micro coordinate metrology, tactile probe, calibration, performance verification},
   web_url = {http://www.mdpi.com/2076-3417/6/5/150},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {MDPI AG},
   address = {Basel},
   language = {30},
   ISSN = {ISSN 2076-3417},
   DOI = {10.3390/app6050150},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Thalmann, R. and Meli, F. and K{\"u}ng, A.}
}

@Article { KarkiWW2016,
   title = {Arts of electrical impedance tomographic sensing},
   journal = {Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences},
   year = {2016},
   month = {5},
   day = {16},
   volume = {374},
   number = {2070},
   number2 = {ENG58: MultiFlowMet: Multiphase flow metrology in oil and gas production},
   pages = {20150329},
   keywords = {electrical impedance tomography, sensitivity, resolution matrix, regional imaging with limited measurements},
   web_url = {http://rsta.royalsocietypublishing.org/content/374/2070/20150329},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {The Royal Society},
   address = {London},
   language = {30},
   ISSN = {1364-503X, 1471-2962},
   DOI = {10.1098/rsta.2015.0329},
   stag_bib_extends_levelofaccess = {NA},
   author = {Karki, B. and Wang, Q. and Wang, M.}
}

@Proceedings { NeuschaeferRubeRI2016,
   title = {Dreidimensionale Form- und Gr{\"o}{\ss}encharaketrisierung von Erosionspartikeln mittels R{\"o}ntgen-Computertomographie},
   journal = {Sensoren und Messsysteme 2016},
   year = {2016},
   month = {5},
   day = {16},
   volume = {5},
   number = {4},
   number2 = {IND61: Metrosion: Metrology to enable high temperature erosion testing},
   pages = {391-396},
   keywords = {R{\"o}ntgen-Computertomographie (CT), abrasive Mikropartikel, Form und Gr{\"o}{\ss}e von Partikeln, 3-dimensionelle Messtechnik, Charakterisierung von Erosionspartikeln},
   web_url = {https://www.ama-science.org/proceedings/details/2380},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {AMA},
   address = {Wunstorf},
   event_place = {N{\"u}rnberg, Germany},
   event_name = {18. GMA/ITG-Fachtagung Sensoren und Messsysteme 2016},
   event_date = {10-05-2016 to 11-05-2016},
   language = {43},
   ISBN = {978-3-9816876-0-6},
   DOI = {10.5162/sensoren2016/5.4.2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Neuschaefer-Rube, U and Rothleitner, Ch and Illmann, J}
}

@Proceedings { ,
   title = {Characterization of high-frequency interconnects: Comparison between time- and frequency-domain methods},
   journal = {2016 IEEE 20th Workshop on Signal and Power Integrity (SPI) Conference Proceedings},
   year = {2016},
   month = {5},
   day = {12},
   volume = {N/A},
   number = {N/A},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {1-4},
   keywords = {coplanar waveguides, frequency-domain analysis, microwave measurement, time-domain analysis},
   web_url = {http://dx.doi.org/10.1109/SaPIW.2016.7496271},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Torino, Italy},
   event_name = {2016 IEEE 20th Workshop on Signal and Power Integrity},
   event_date = {08-05-2016 to 11-05-2016},
   language = {30},
   ISBN = {978-1-5090-0349-5},
   DOI = {10.7795/EMPIR.14IND02.CA.20190403D},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Bieler, M. and Arz, U.}
}

@Article { ,
   title = {Toward flexible Spintronics: perpendicularly magnetized synthetic antiferromagnetic thin films and nanowires on polyimide substrates},
   journal = {Advanced Functional Materials},
   year = {2016},
   month = {5},
   day = {11},
   volume = {Volume 26},
   number = {Issue 26},
   number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems},
   pages = {Pages 4704–4711},
   keywords = {Spintronics, Perpendicular magnetic anisotropy, CoFeB thin films},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/adfm.201505138/abstract},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   language = {30},
   DOI = {10.1002/adfm.201505138},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Vemulkar, T. and Mansell, R. and Fern{\'a}ndez-Pacheco, A. and Cowburn, R.P.}
}

@Proceedings { ,
   title = {Impact of measurement uncertainty on modelling},
   journal = {Proc. of 21st International Conference on Microwave, Radar and Wireless Communications (MIKON)},
   year = {2016},
   month = {5},
   day = {9},
   volume = {n/a},
   number = {n/a},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Calibration, Measurement uncertainty, Microwave measurement, nonlinear modelling},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7492056\&isnumber=7491934},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {Krakow, Poland},
   event_name = {21st International Conference on Microwave, Radar and Wireless Communications (MIKON)},
   event_date = {9-11 May 2016},
   language = {30},
   ISBN = {n/a},
   ISSN = {n/a},
   DOI = {10.1109/MIKON.2016.7492056},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Schreurs, D. and Liu, S. and Avolio, G. and Ocket, I.}
}

@Thesis { ,
   title = {Development of a Primary Method for the Calibration of Torque Transducers using Dynamic Excitations},
   year = {2016},
   month = {5},
   day = {3},
   number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities},
   keywords = {dynamic torque, model parameter identification, dynamic calibration},
   web_url = {https://public.ptb.de/resource/110.20160714},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Physikalisch-Technische Bundesanstalt},
   address = {Braunschweig},
   school = {Faculty of Mechanical Engineering of Gottfried Wilhelm Leibniz Universit{\"a}t Hannover},
   language = {43},
   ISBN = {978-3-95606-263-6},
   ISSN = {0179-0595},
   DOI = {10.7795/110.20160714},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Klaus, L.}
}

@Article { ,
   title = {The Focus Variation Microscope: Linear Theory and Surface Tilt Sensitivity},
   journal = {Applied Optic},
   year = {2016},
   month = {5},
   day = {1},
   volume = {55},
   number = {13},
   number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products},
   pages = {3555-3565},
   keywords = {Microscopy;  Optical transfer functions; Focus Variation Microscopy},
   web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-13-3555},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {The Optical society of America},
   address = {Washington, USA},
   language = {30},
   ISSN = {1559-128X (print); 2155-3165 (online)},
   DOI = {10.1364/AO.55.003555},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-1},
   author = {NIKOLAEV, N I and PETZING, J and COUPLAND, J M}
}

@Article { ,
   title = {Mini array of quantum Hall devices based on epitaxial graphene},
   journal = {Journal of Applied Physics},
   year = {2016},
   month = {5},
   volume = {119},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {174504},
   keywords = {QHE, Graphene, measurement,},
   web_url = {http://arxiv.org/abs/1512.03163},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   DOI = {10.1063/1.4948675},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Novikov, S. and Lebedeva, N. and H{\"a}m{\"a}l{\"a}inen, J. and Iisakka, I. and Immonen, P. and Manninen, A.J. and Satrapinski, A.}
}

@Proceedings { ,
   title = {Traceable Calibration with 1.0mm Coaxial Standards},
   journal = {2016 87th ARFTG Microwave Measurement Conference (ARFTG)},
   year = {2016},
   month = {5},
   volume = {May 2016},
   number = {1},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Coaxial, S-parameters, transmission, reflection, vector network analyzer},
   web_url = {http://ieeexplore.ieee.org/document/7501943/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {New York},
   event_place = {San Francisco},
   event_name = {87th ARFTG Microwave Measurement Conference},
   event_date = {27.5.2016},
   language = {30},
   ISBN = {n/a},
   ISSN = {n/a},
   DOI = {10.1109/ARFTG.2016.7501943},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hoffmann, J and Wollensack, M and Ruefenacht, J and Stalder, D and Zeier, M}
}

@Article { ,
   title = {Four-wave dark-field electron holography for imaging strain fields},
   journal = {Journal of Physics D: Applied Physics},
   year = {2016},
   month = {5},
   volume = {J. Phys. D: Appl. Phys. 49 (2016) 244003 (8pp)},
   number = {J. Phys. D: Appl. Phys. 49 (2016) 244003 (8pp)},
   number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale},
   pages = {J. Phys. D: Appl. Phys. 49 (2016) 244003 (8pp)},
   keywords = {Four-wave dark-field electron holography
strain fields},
   web_url = {http://iopscience.iop.org/article/10.1088/0022-3727/49/24/244003/meta},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   address = {IOP Publishing},
   language = {30},
   ISSN = {J. Phys. D: Appl. Phys. 49 (2016) 244003 (8pp)},
   DOI = {10.1088/0022-3727/49/24/244003},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Denneulin, T and H{\"y}tch, M}
}

@Article { CortellessaCMM2016,
   subid = {108},
   title = {New benchmark solutions for transient natural convection in partially porous annuli},
   journal = {International Journal of Numerical Methods for Heat \& Fluid Flow},
   year = {2016},
   month = {5},
   volume = {26},
   number = {3/4},
   number2 = {14IND11: HIT: Metrology for humidity at high temperatures and transient conditions},
   pages = {1187-1225},
   keywords = {Benchmark, Artificial compressibility, Characteristic-based split, Cylindrical,Numerical heat transfer, Porous media},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Emerald},
   address = {West Yorkshire},
   language = {30},
   ISSN = {0961-5539},
   DOI = {10.1108/HFF-11-2015-0464},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cortellessa, G. and Ciccolella, M. and Massarotti, N. and Mauro, A.}
}

@Article { ZappaTVLLAPGBDG2016,
   subid = {232},
   title = {Experiment Investigating the Connection between Weak Values and Contextuality},
   journal = {Physical Review Letters},
   year = {2016},
   month = {5},
   volume = {116},
   number = {18},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {180401},
   keywords = {Quantum Foundations, Quantum Nonlocality, Weak Values, Weak Measurements},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.116.180401},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zappa, F. and Tosi, A. and Villla, F. and Lussana, R. and Levi, M. P. and Avella, A. and Piacentini, F. and Gramegna, M. and Brida, G. and Degiovanni, I. P. and Genovese, M.}
}

@Article { StyblikovaD2016,
   title = {Calibration of AC Clamp Meters},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2016},
   month = {5},
   volume = {65},
   number = {5},
   number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids},
   pages = {1156-1162},
   keywords = {Resistors, Standards, Current measurement, Voltage measurement, Frequency measurement, Calibration, Measurement uncertainty},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2015.2507413},
   stag_bib_extends_levelofaccess = {NA},
   author = {Styblikova, R. and Draxler, K.}
}

@Article { ProfrockGBBNGEPGSG2016,
   title = {Potential reference measurement procedures for PBDE in surface water at levels required by the EU Water Frame Directive},
   journal = {Talanta},
   year = {2016},
   month = {5},
   volume = {152},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {251-258},
   keywords = {IDMS, Method Validation, PBDE, Water, Water Framework Directive},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0039-9140},
   DOI = {10.1016/j.talanta.2016.01.066},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pr{\"o}frock, D. and Gonz{\'a}lez-Gago, A. and Binici, B. and B{\'i}lsel, M. and Nousiainen, M. and Goenaga-Infante, H. and Entwisle, J. and Petrov, P. and Gantois, F. and Swart, C. and Goren, A.C.}
}

@Proceedings { ,
   title = {High-accuracy absolute distance measurement with a mode-resolved optical frequency comb},
   journal = {Proceedings of SPIE},
   year = {2016},
   month = {4},
   day = {29},
   volume = {9899},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {989906},
   keywords = {Distance measurement, frequency combs, homodyne detection, intererometry},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {SPIE},
   address = {Bellingham},
   event_place = {Brussels, Belgium},
   event_name = {SPIE Photonics Europe 2016, Optical Sensing and Detection IV},
   event_date = {04-04-2016 to 07-04-2016},
   language = {30},
   ISSN = {1996-756X},
   DOI = {10.1117/12.2227360},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Voigt, D. and van den Berg, S.A. and Lešund{\'a}k, A. and van Eldik, S. and Bhattacharya, N.}
}

@Article { ZorinJL2016,
   title = {Photon-activated electron hopping in a single-electron trap enhanced by Josephson radiation},
   journal = {Applied Physics Letters},
   year = {2016},
   month = {4},
   day = {25},
   volume = {108},
   number = {17},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   pages = {172603},
   keywords = {microwave detection, single-electron tunneling},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/1.4948258},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zorin, A. B. and Jalali-Jafari, B. and Lotkhov, S. V.}
}

@Article { CoutinR2016,
   title = {Caract{\'e}risation et validation d’un nouveau radiom{\`e}tre cryog{\'e}nique au LNE-LCM},
   journal = {Revue fran\c{c}aise de m{\'e}trologie},
   year = {2016},
   month = {4},
   day = {25},
   number = {41},
   number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry},
   pages = {11-20},
   keywords = {Caract{\'e}risation et validation d’un nouveau radiom{\`e}tre cryog{\'e}nique au LNE-LCM},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {EDP Sciences},
   language = {30},
   ISSN = {1772-1792, 1776-3215},
   DOI = {10.1051/rfm/2016002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Coutin, J.-M. and Rougi{\'e}, B.}
}

@Inbook { OsterleO2016,
   title = {Reference Nanomaterials},
   year = {2016},
   month = {4},
   day = {22},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   pages = {49-62},
   keywords = {adhesion, elastcity, materials science, reference nanomaterial},
   web_url = {https://onlinelibrary.wiley.com/doi/abs/10.1002/9781118753460.ch3},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {John Wiley \& Sons, Inc},
   booktitle = {Nanomaterial Characterization: An Introduction},
   language = {30},
   ISBN = {9781118753460},
   DOI = {10.1002/9781118753460.ch3},
   stag_bib_extends_levelofaccess = {NA},
   author = {{\"O}sterle, W. and Orts-Gil, G.}
}

@Article { ,
   title = {Estimation of BER from Error Vector Magnitude for Optical Coherent Systems},
   journal = {MDPI Photonics — Open Access Journal},
   year = {2016},
   month = {4},
   day = {21},
   volume = {3},
   number = {2},
   number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {21},
   keywords = {Error vector magnitude (EVM); quadrature amplitude modulation (QAM); carrier phase recovery.},
   web_url = {http://www.mdpi.com/journal/photonics},
   misc2 = {EMPIR 2014: Industry},
   publisher = {MDPI AG Photonics Editorial Office},
   address = {Klybeckstrasse 64, 4057 Basel, Switzerland},
   language = {30},
   ISSN = {ISSN 2304-6732},
   DOI = {10.3390/photonics3020021},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.mdpi.com/2304-6732/3/2/21},
   author = {Fatadin, I}
}

@Article { ,
   title = {A Planar Near Field Setup for Millimeter-Wave System-Embedded Antenna Testing},
   journal = {IEEE Antennas and Wireless Propagation Letters},
   year = {2016},
   month = {4},
   day = {21},
   volume = {PP (pre pubblicaiton)},
   number = {99},
   number2 = {IND51: MORSE: Metrology for optical and RF communication systems},
   pages = {1-4},
   keywords = {Embedded antenna, on-module antenna, near field measurement.},
   web_url = {http://ieeexplore.ieee.org/document/7457638/},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {Piscataway},
   language = {30},
   ISSN = {Print ISSN: 1536-1225 Online ISSN: 1548-5757},
   DOI = {10.1109/LAWP.2016.2557239},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-1},
   stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7457638/},
   author = {Alonso del Pino, M. and Di Rosa, M. and Simeoni, M. and Spella, M. and de Martino, C. and Spirito, M.}
}

@Article { ,
   title = {Towards joint reconstruction of noise and losses in quantum channels},
   journal = {Quantum Measurements and Quantum Metrology},
   year = {2016},
   month = {4},
   day = {21},
   volume = {3},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {27–31},
   keywords = {Quantum Communication, Quantum Metrology, Calibration},
   web_url = {https://www.degruyter.com/view/j/qmetro},
   misc2 = {EMPIR 2014: Industry},
   publisher = {DE GRUYTER OPEN},
   address = {Warsaw (Poland)},
   language = {30},
   ISSN = {2299-114X},
   DOI = {10.1515/qmetro-2016-0005},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {https://www.degruyter.com/downloadpdf/j/qmetro.2016.3.issue-1/qmetro-2016-0005/qmetro-2016-0005.pdf},
   author = {Piacentini, F. and Avella, A. and Traina, P. and Lolli, L. and Taralli, E. and Monticone, E. and Rajteri, M. and Fukuda, D. and Degiovanni, I. P. and G. Brida}
}

@Article { DesogusMGPB2016,
   title = {Design and metrological evaluation of the new 5 MN hexapod-shaped multicomponent build-up system},
   journal = {Metrologia},
   year = {2016},
   month = {4},
   day = {15},
   volume = {53},
   number = {3},
   number2 = {SIB63: Force: Force traceability within the meganewton range},
   pages = {956-964},
   keywords = {hexapod, load simulation, build-up system, force transducer, uncertainty budget},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/0026-1394/53/3/956},
   stag_bib_extends_levelofaccess = {NA},
   author = {Desogus, S. and Mazzoleni, F. and Germak, A. and Palumbo, S. and Barbato, G.}
}

@Article { ,
   title = {Absolute calibration of an EMCCD camera by quantum correlation, linking photon counting to the analog regime},
   journal = {Optics Letters},
   year = {2016},
   month = {4},
   day = {14},
   volume = {41},
   number = {8},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {1841-1844},
   keywords = {CCD, charge-coupled device; Quantum detectors; Calibration.},
   web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-8-1841},
   misc2 = {EMPIR 2014: Industry},
   publisher = {OSA Publishing},
   address = {Washington, D.C. 20036-1012 USA},
   language = {30},
   ISSN = {0146-9592/16/081841-04},
   DOI = {10.1364/OL.41.001841},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-4-14},
   author = {Avella, A. and Ruo-Berchera, I. and Degiovanni, I. P. and Brida, G. and Genovese, M.}
}

@Article { ,
   title = {Inertial quantum sensors using light and matter},
   journal = {Physica Scripta},
   year = {2016},
   month = {4},
   day = {13},
   volume = {91},
   number = {5},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {053006},
   keywords = {quantum sensors, atom interferometry, cold atoms},
   web_url = {http://iopscience.iop.org/article/10.1088/0031-8949/91/5/053006/meta},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {0031-8949},
   DOI = {10.1088/0031-8949/91/5/053006},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Barrett, B and Bertoldi, A and Bouyer, P}
}

@Article { SchraderKSGKS2016,
   title = {Near and Far Field Characterization of Planar mm-Wave Antenna Arrays with Waveguide-to-Microstrip Transition},
   journal = {Journal of Infrared, Millimeter, and Terahertz Waves},
   year = {2016},
   month = {4},
   day = {12},
   volume = {37},
   number = {9},
   number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications},
   pages = {857-873},
   keywords = {Phased patch antenna arrays, Radiation pattern measurements, Millimeter wave antenna design and characterization, Spherical far-field and planar near-field scanner, Near to far field transformation,},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Springer Nature},
   address = {233 Spring St. Attn: Joerg Schreiber New York NY 10013 United States},
   language = {30},
   ISSN = {1866-6892, 1866-6906},
   DOI = {10.1007/s10762-016-0273-x},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schrader, T. and Kleine-Ostmann, T. and Spirito, M. and Gentille, G. and Kazemipour, A. and Salhi, M.A.}
}

@Article { ,
   title = {Broadband fully automated digitally assisted coaxial bridge for high accuracy impedance ratio measurements},
   journal = {Metrologia},
   year = {2016},
   month = {4},
   day = {11},
   volume = {53},
   number = {3},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {918},
   keywords = {Keywords: metrology, ac bridges, impedance measurements, quantum Hall effect, digitally assisted
(Some},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/3/918/meta},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP},
   language = {30},
   DOI = {10.1088/0026-1394/53/3/918},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Overney, Federic and L{\"u}{\"o}nd, Felix and Jeanneret, Blaise and Jeanneret, Blaise}
}

@Article { ,
   title = {Diffusion-induced grain boundary migration as mechanism for grain growth and defect annihilation in chalcopyrite thin films},
   journal = {Acta Materialia},
   year = {2016},
   month = {4},
   day = {10},
   volume = {111},
   number = {-},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {377-384},
   keywords = {X-ray diffraction, Physical vapor deposition (PVD), Stacking faults, Grain boundary migration, CuInSe2},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier Ltd.},
   address = {Amsterdam},
   language = {30},
   ISSN = {1359-6454},
   DOI = {10.1016/j.actamat.2016.03.073},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Stange, H. and Brunken, S. and Greiner, D. and Heinemann, M. D. and Kaufmann, C. A. and Schmidt, S. S. and B{\"a}cker, J.-P. and Klaus, M. and Genzel, C. and Mainz, R.}
}

@Article { ,
   title = {Investigation of the beam quality of a terahertz emitting vertical-external-cavity surface-emitting laser},
   journal = {Journal of Infrared, Millimeter and Terahertz Waves},
   year = {2016},
   month = {4},
   day = {4},
   volume = {37},
   number = {6},
   number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security},
   pages = {536-539},
   keywords = {beam quality, Vertical-External-Cavity Surface-Emitting Laser},
   web_url = {http://link.springer.com/article/10.1007\%2Fs10762-016-0274-9},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Springer},
   address = {Cham, Switzerland},
   language = {30},
   ISSN = {1866-6892},
   DOI = {10.1007/s10762-016-0274-9},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Zhang, Fan and Wang, Siming and Rehn, Arno and Wichmann, Matthias and Urbasch, Gunter and Rahimi-Iman, Arash and Koch, Stephan W. and Koch, Martin}
}

@Article { ,
   title = {Guide to the Storage of Primary Mass Standards},
   journal = {NPL Good Practice Guide},
   year = {2016},
   month = {4},
   day = {1},
   volume = {Version 1.0},
   number = {139},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {1-27},
   keywords = {Good Practice Guide},
   web_url = {http://www.npl.co.uk/content/ConPublication/6960},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {EMRP},
   address = {Teddington},
   language = {30},
   ISSN = {1368–6550},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {PDB: 7882 | DDB: 7718},
   author = {Perkin, M and Davidson, S}
}

@Article { ,
   title = {Guide to Weighing in Vacuum},
   journal = {NPL Good Practice Guide},
   year = {2016},
   month = {4},
   day = {1},
   volume = {Version 1.0},
   number = {140},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {1-28},
   keywords = {Good Practice Guide},
   web_url = {http://www.npl.co.uk/content/ConPublication/6961},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {EMRP},
   address = {Teddington},
   language = {30},
   ISSN = {1368–6550},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {PDB: 7883 | DDB: 7719},
   author = {Perkin, M and Davidson, S}
}

@Article { ,
   title = {The Impact of the Redefinition of the Kilogram for End Users},
   journal = {NPL Good Practice Guide},
   year = {2016},
   month = {4},
   day = {1},
   volume = {1},
   number = {1},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {1-4},
   keywords = {Impact, Redefinition, Kilogram},
   web_url = {http://www.npl.co.uk/upload/pdf/impact-kg-redefinition-end-users.pdf},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {NPL},
   address = {Teddington},
   language = {30},
   ISSN = {NA},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Davidson, S}
}

@Techreport { ,
   title = {Conformance assessment of electrical energy meters investigated by risk analysis – a case study},
   journal = {OIML BULLETIN},
   year = {2016},
   month = {4},
   day = {1},
   volume = {LVII},
   number = {2},
   number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation},
   keywords = {-},
   web_url = {www.oiml.org/en/publications/bulletin/pdf/oiml_bulletin_april_2016.pdf},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Organisation Internationale de M{\'e}trologie L{\'e}gale},
   address = {Paris},
   language = {30},
   ISBN = {-},
   ISSN = {-},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {https://www.oiml.org/en/publications/bulletin/pdf/oiml_bulletin_april_2016.pdf},
   author = {Karlsson, H. and Olsen, A.A.F. and Pendrill, L.R.}
}

@Proceedings { ,
   title = {JRP  SIB60  “Metrology  for  Long  Distance Surveying”-a  concise  survey  on  major  project results},
   journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring},
   year = {2016},
   month = {4},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   keywords = {Length    metrology,    EDM,    GNSS, traceability, EMRP JRP SIB60 Surveying},
   web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Vienna, Austria},
   event_name = {Joint International Symposium on Deformation Monitoring},
   event_date = {March 30-April 1, 2016},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Pollinger, F. and Bauch, A. and Leute, J. and Meiners-Hagen, K. and Mildner, J. and Guillory, J. and Wallerand, J.-P. and Jokela, J. and Kallio, U. and Koivula, H. and Lahtinen, S. and Poutanen, M. and Astrua, M. and Francese, C. and Zucco, M. and Eusebio, L. and Marques, F. and Pires, C. and Saraiva, F. and Pelligrino, O. and Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M. and Kupko, V. and Neyezhmakov, P. and Bergstrand, S. and van den Berg, S.A. and Kersten, T. and Krawinkel, T.}
}

@Proceedings { ,
   title = {SI-Traceable High-Accuracy EDM based on Multi-Wavelength Interferometry},
   journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring},
   year = {2016},
   month = {4},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {Submission 15},
   keywords = {EDM,  multi-wavelength  interferometry, index of refraction, EMRP JRP SIB60 Surveying},
   web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Vienna, Austria},
   event_name = {Joint International Symposium on Deformation Monitoring},
   event_date = {30-03-2016 to 01-04-2016},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf},
   author = {Pollinger, F. and Mildner, J. and K{\"o}chert, P. and Yang, R. and Bosnjakovic, A. and Meyer, T. and Wedde, M. and Meiners-Hagen, K.}
}

@Proceedings { ,
   title = {Towards Kilometric Distance Measurements with Air Refractive Index Compensation},
   journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring},
   year = {2016},
   month = {4},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {Submission 27},
   keywords = {Kilometric distance, optical telemetry, two-wavelength telemetry, absolute distance meter.},
   web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {FIG},
   event_place = {Vienna, Austria},
   event_name = {Joint International Symposium on Deformation Monitoring},
   event_date = {30-03-2016 to 01-04-2016},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf},
   author = {Guillory, J. and Wallerand, J.-P. and Truong, D. and Šm{\'i}d, R. and Alexandre, C.}
}

@Proceedings { ,
   title = {Spectroscopic Inline Thermometry},
   journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring},
   year = {2016},
   month = {4},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {Submission 69},
   keywords = {EMRP JRP SIB60 Surveying, refractive index of air, air temperature, laser spectroscopy},
   web_url = {www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_69.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {FIG},
   event_place = {Vienna, Austria},
   event_name = {Joint International Symposium on Deformation Monitoring},
   event_date = {30-03-2016 to 01-04-2016},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_69.pdf},
   author = {Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M.}
}

@Article { HansenM2016,
   subid = {346},
   title = {Scatterometry - Fast and Robust Measurements of Nano-textured Surfaces},
   journal = {Surface Topography: Metrology and Properties},
   year = {2016},
   month = {4},
   volume = {4},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {023003},
   keywords = {scatterometry, diffraction and gratings, inverse modeling, scattering measurements, optical design of instruments, in-line metrology},
   web_url = {http://iopscience.iop.org/article/10.1088/2051-672X/4/2/023003/pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   DOI = {10.1088/2051-672X/4/2/023003},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hansen, P. E. and Madsen, M. H.}
}

@Article { ,
   title = {A determination of Planck’s constant using the NRC watt balance},
   journal = {Metrologia},
   year = {2016},
   month = {3},
   day = {31},
   volume = {51},
   number = {21/06/2016},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {S5-S14},
   keywords = {watt balance, Planck’s constant, kilogram},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/51/2/S5/meta},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Metrologia},
   address = {Bristol},
   language = {30},
   ISSN = {NA},
   DOI = {10.1088/0026-1394/51/2/S5},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Sanchez, C A and Wood, B M and Green, R G and Liard, J O and Inglis, D}
}

@Article { ,
   title = {Potential of GPS Common Clock Single-differences for Deformation Monitoring},
   journal = {Journal of Applied Geodesy},
   year = {2016},
   month = {3},
   day = {31},
   volume = {10},
   number = {1},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {pages 45.52},
   keywords = {GPS; Monitoring; Clock Modeling; Common Clock; EMRP JRP SIB60},
   web_url = {https://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/reviewed/JISDM_2016_submission_101.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {De Gruyter},
   language = {30},
   ISSN = {(Online) 1862-9024, (Print) 1862-9016},
   DOI = {10.1515/jag-2015-0029},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Sch{\"o}n, S. and Pham, H.K. and Kersten, T. and Leute, J. and Bauch, A.}
}

@Article { ,
   title = {Investigations on the Influence of Antenna Near-field Effects and Satellite Obstruction on the Uncertainty of GNSS-based Distance Measurements},
   journal = {Journal of Applied Geodesy},
   year = {2016},
   month = {3},
   day = {31},
   volume = {10},
   number = {1},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {53-60},
   keywords = {GNSS; Antenna Near-field Effects; Satellite Obstruction; EMRP JRP SIB60},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {De Gruyter},
   language = {30},
   ISSN = {(Online) 1862-9024, (Print) 1862-9016},
   DOI = {10.1515/jag-2015-0026},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Zimmermann, F. and Eling, C. and Kuhlmann, H.}
}

@Article { ,
   title = {Progress towards the determination of thermodynamic temperature with ultra-low uncertainty},
   journal = {Philosophical Transactions of the Royal Society A},
   year = {2016},
   month = {3},
   day = {28},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {20150046},
   keywords = {Boltzmann constant, thermodynamic temperature, International Temperature Scale},
   web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150046},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society Publishing},
   address = {London},
   language = {30},
   ISSN = {1364-503X},
   DOI = {10.1098/rsta.2015.0046},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-3-28},
   stag_bib_extends_persistent_identifier = {http://rsta.royalsocietypublishing.org/content/374/2064/20150046},
   author = {Gavioso, R M and Madonna Ripa, D and Steur, P P M and Gaiser, C and Zandt, T and Fellmuth, B and de Podesta, M and Underwood, R and Sutton, G and Pitre, L and Sparasci, F and Risegari, L and Gianfrani, L and Castrillo, A and Machin, G}
}

@Article { ,
   title = {A SQUID-based primary noise thermometer for low-temperature metrology},
   journal = {Philos Trans A Math Phys Eng Sci},
   year = {2016},
   month = {3},
   day = {28},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {1-16},
   keywords = {PLTS-2000; SQUIDs; noise; primary thermometry; temperature scales},
   web_url = {http://www.ncbi.nlm.nih.gov/pubmed/26903105},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {National Center for Biotechnology Information},
   address = {Bethesda},
   language = {30},
   ISSN = {NA},
   DOI = {10.1098/rsta.2015.0050.},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Kirste, A and Engert, J}
}

@Article { ,
   title = {Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points},
   journal = {Philosophical Transactions of the Royal Society A},
   year = {2016},
   month = {3},
   day = {28},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {20150044},
   keywords = {high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics},
   web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150044},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society},
   address = {London},
   language = {30},
   DOI = {10.1098/rsta.2015.0044},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Wooliams, E.R and Anhalt, K and Ballico, M and Bloembergen, P and Bourson, F and Briaudeau, S and Campos, J and Cox, M.G and del Campo, D and Dong, W and Dury, M.R and Gavrilov, V and Grigoryeva, I and Hernanz, M.L and Jahan, F and Khlevnoy, B and Khromchenko, V and Lowe, D.H and Lu, X and Machin, G and Mantilla, J.M and Martin, M.J and McEvoy, H.C and Rougie, B and Saldi, M and Salim, S.G.R and Sasajima, N and Taubert, D.R and Todd, A.D.W and Van den Bossche, R}
}

@Article { ,
   title = {Thermodynamic temperature by primary radiometry},
   journal = {Philosophical Transactions of the Royal Society A},
   year = {2016},
   month = {3},
   day = {28},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {20150041},
   keywords = {primary thermometry, radiation thermometry, radiometry},
   web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150041},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Royal Society},
   address = {London},
   language = {30},
   DOI = {10.1098/rsta.2015.0041},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Anhalt, K and Machin, G}
}

@Article { ,
   title = {Accurate Coulomb Blockade Thermometry up to 60 Kelvin},
   journal = {Philosophical Transactions of the Royal Society A},
   year = {2016},
   month = {3},
   day = {28},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {1-7},
   keywords = {primary thermometry, nano-fabrication, low temperature},
   web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150052},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society},
   address = {London},
   language = {30},
   ISSN = {NA},
   DOI = {10.1098/rsta.2015.0052},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Meschke, M and Kemppinen, A and Pekola, J P}
}

@Article { ,
   title = {Fast antenna array diagnosis from a small number of far field measurements},
   journal = {IEEE Transactions on Antennas and Propagation},
   year = {2016},
   month = {3},
   day = {25},
   volume = {64},
   number = {6},
   number2 = {IND51: MORSE: Metrology for optical and RF communication systems},
   pages = {2227 - 2235},
   keywords = {Antenna measurements,  Apertures,  Arrays,  Standards,  Phased arrays},
   web_url = {http://ieeexplore.ieee.org/document/7442121/},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {Melville},
   language = {30},
   ISSN = {0018-926X},
   DOI = {10.1109/TAP.2016.2547023},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-3-25},
   author = {Fuchs, B and Le Coq, L and Migliore, M. D.}
}

@Article { ,
   title = {DABAM: an open-source database of x-ray mirrors metrology},
   journal = {Journal of Synchrotron Radiation},
   year = {2016},
   month = {3},
   day = {24},
   volume = {23},
   number = {23},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {665-678},
   keywords = {X-ray mirror; metrology; database; Python; statistics.},
   web_url = {http://scripts.iucr.org/cgi-bin/paper?S1600577516005014},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IUCr Journals},
   address = {Chester CH1 2HU, England},
   language = {30},
   ISSN = {1600-5775},
   DOI = {10.1107/S1600577516005014},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Sanchez del Rio, M and Bianchi, D and Cocco, D and Glass, M and Idir, M and Metz, J and Raimondi, L and Rebuffi, L and Reininger, R and Shi, X and Siewert, F and Spielmann-Jaeggi, S and Takacs, P and Tomasset, M and Tonnessen, T and Tonnessenivo, A and Yashchuk, VV}
}

@Article { HainsworthKHJ2016_2,
   subid = {380},
   title = {The existence of a lateral size effect and the relationship between indentation and scratch hardness in copper},
   journal = {Philosophical Magazine},
   year = {2016},
   month = {3},
   day = {24},
   volume = {96},
   number = {32-34},
   number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials},
   pages = {3396-3413},
   keywords = {Nano-scratch testing, nano-scratch hardness, lateral size effects},
   web_url = {https://pure.coventry.ac.uk/ws/portalfiles/portal/10344470/Nigel_Jennett_Manuscript_revised.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {1478-6435, 1478-6443},
   DOI = {10.1080/14786435.2016.1146828},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hainsworth, S.V. and Kareer, A. and Hou, X.D. and Jennett, N.M.}
}

@Article { ,
   title = {GUM2DFT - A software tool for uncertainty evaluation of transient signals in the frequency domain},
   journal = {Measurement Science and Technology},
   year = {2016},
   month = {3},
   day = {22},
   volume = {27},
   number = {5},
   number2 = {14SIP08: Dynamic: Standards and software to maximise end user uptake of NMI calibrations of dynamic force, torque and pressure sensors},
   pages = {055001},
   keywords = {Fourier transform, measurement uncertainty, dynamic measurement, hydrophone, GUM, deconvolution},
   misc2 = {EMPIR 2014: Support for Impact},
   publisher = {IOP Publishing},
   language = {30},
   DOI = {10.1088/0957-0233/27/5/055001},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-3-22},
   author = {Eichst{\"a}dt, S and Wilkens, V}
}

@Thesis { Gruber2016,
   title = {Development of a large scale bearing element thickness variation measurement device},
   year = {2016},
   month = {3},
   day = {21},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   keywords = {large scale bearing elements, bearing element thickness, thickness measurement, differential measurement, differential thickness measurement, measurement machine design, rotating measurement machine, rotating bearing measurement machine, moving measurement machine, runout measurement, thickness variation measurement},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Aalto University},
   address = {Espoo},
   school = {Aalto University},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://urn.fi/URN:NBN:fi:aalto-201606282805},
   author = {Gruber, G.}
}

@Proceedings { ,
   title = {Approaching the Shannon Limit Through Constellation Modulation},
   journal = {Optical Fiber Communication Conference},
   year = {2016},
   month = {3},
   day = {20},
   volume = {N/A},
   number = {2016},
   number2 = {IND51: MORSE: Metrology for optical and RF communication systems},
   pages = {Th2A.46},
   keywords = {Coherent communications
Fiber optics communications
Modulation},
   web_url = {https://www.osapublishing.org/abstract.cfm?uri=OFC-2016-Th2A.46},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Optical Society of America},
   address = {Washington, D.C.},
   event_place = {Anaheim, California},
   event_name = {Optical Fiber Communication Conference},
   event_date = {20-03-2016},
   language = {30},
   ISBN = {978-1-943580-07-1},
   ISSN = {N/A},
   DOI = {10.1364/OFC.2016.Th2A.46},
   extern = {1},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Dash, S. S. and Pythoud, F and Baeuerle, B and Josten, A and Hillerkuss, D and Leuchtmann, P and Leuthold, J}
}

@Article { ,
   title = {Performance evaluation of a cheap, open source, digital environmental monitor based on the Raspberry Pi},
   journal = {Measurement},
   year = {2016},
   month = {3},
   day = {17},
   volume = {87},
   number = {June 2016},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {228–235},
   keywords = {environment, calibration, metrology, air sensor, open source, data logging},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116001871},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2016.03.023},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2018-3-18},
   author = {Lewis, A J and Campbell, M and Stavroulakis, P}
}

@Article { ,
   title = {Accurate and precise quantification of Cu,Zn-SOD in human red blood cells using species-specific double and triple IDMS},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2016},
   month = {3},
   day = {17},
   volume = {9 / 2016},
   number = {31},
   number2 = {HLT05: Metallomics: Metrology for metalloproteins},
   pages = {1922-1928},
   keywords = {Clinical/biomedical analysis, Metalloproteins, Reference materials,  Reference measurement procedures},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/c5ja00459d\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {The Royal Society of Chemistry},
   address = {Cambridge, United Kingdom},
   language = {30},
   ISSN = {0267-9477 (print) ; 1364-5544 (online)},
   DOI = {10.1039/c5ja00459d},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Gleitzmann, Julia and Raab, Andrea and Schulze, Dirk and Waetzig, Hermann and Feldmann, Joerg and Swart, Claudia}
}

@Article { ,
   title = {What are the correct L-subshell photoionization cross sections for quantitative X-ray spectroscopy?},
   journal = {X-ray Spectrometry},
   year = {2016},
   month = {3},
   day = {16},
   volume = {45},
   number = {4},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {207–211},
   keywords = {photoionization cross sections, xrs, fundamental parameters},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/xrs.2691/full},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {John Wiley \& Sons, Ltd},
   language = {30},
   ISSN = {1097-4539},
   DOI = {10.1002/xrs.2691},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {H{\"o}nicke, P and Kolbe, M and Beckhoff, B}
}

@Article { NadvornikNSNNOJTKWJ2016,
   title = {Long-range and high-speed electronic spin-transport at a GaAs/AlGaAs semiconductor interface},
   journal = {Scientific Reports},
   year = {2016},
   month = {3},
   day = {16},
   volume = {6},
   number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems},
   pages = {22901},
   keywords = {Long-range and high-speed electronic spin-transport at a GaAs/AlGaAs semiconductor interface},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Springer Nature},
   address = {233 Spring St., New York NY 10013, USA},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/srep22901},
   stag_bib_extends_levelofaccess = {NA},
   author = {N{\'a}dvorn{\'i}k, L. and Němec, P. and Skoromets, V. and Němec, H. and Nov{\'a}k, V. and Olejn{\'i}k, K. and Janda, T. and Troj{\'a}nek, F. and Kužel, P. and Wunderlich, J. and Jungwirth, T.}
}

@Article { DryakKS2016,
   title = {Validation of Monte Carlo model of HPGe detector for field-station measurement of airborne radioactivity},
   journal = {Journal of Instrumentation},
   year = {2016},
   month = {3},
   day = {15},
   volume = {11},
   number = {03},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {P03015-P03015},
   keywords = {Models and simulations; Dosimetry concepts and apparatus},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/11/03/P03015},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dry{\'a}k, P. and Kov{\'a}ř, P. and Solc, J.}
}

@Proceedings { ,
   title = {BER Estimation from EVM for QPSK and 16-QAM Coherent Optical Systems},
   journal = {2016 IEEE 6th International Conference on Photonics (ICP)},
   year = {2016},
   month = {3},
   day = {14},
   volume = {n/a},
   number = {n/a},
   number2 = {IND51: MORSE: Metrology for optical and RF communication systems},
   pages = {1-3},
   keywords = {coherent optical system, error vector magnitude, bit error rate, metrology},
   web_url = {http://ieeexplore.ieee.org.ezproxy.techlib.cz/stamp/stamp.jsp?tp=\&arnumber=7510025},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {Kuching, Sarawak, Malaysia},
   event_name = {2016 IEEE 6th International Conference on Photonics (ICP)},
   event_date = {14-16 March 2016},
   language = {30},
   ISBN = {n/a},
   ISSN = {n/a},
   DOI = {10.1109/ICP.2016.7510025},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hudlička, Martin and Lundstr{\"o}m, Carl and Humphreys, David and Fatadin, Irshaad}
}

@Article { ,
   title = {Preparation and characterisation of an 57Fe enriched haemoglobin spike material for speciesspecific isotope dilution mass spectrometry},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2016},
   month = {3},
   day = {10},
   volume = {31},
   number = {9},
   number2 = {HLT05: Metallomics: Metrology for metalloproteins},
   pages = {1846 - 1857},
   keywords = {isotope dilution mass spectrometry (IDMS), MonoQ® ion exchange chromatography, size exclusion column (SEC),high-performance liquid chromatography (HPLC) system},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00028B\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Royal Society of Chemistry},
   address = {London},
   language = {30},
   ISSN = {0267-9477 (print) ; 1364-5544 (online)},
   DOI = {10.1039/c6ja00028b},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Brauckmann, C. and Frank, C. and Schulze, D. and Kaiser, P. and Stosch, R. and Swart, C.}
}

@Article { ,
   title = {Coherent cancellation of photothermal noise in GaAs/Al0.92Ga0.08As Bragg mirrors},
   journal = {Metrologia},
   year = {2016},
   month = {3},
   day = {9},
   volume = {53},
   number = {2},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {860},
   keywords = {photothermal noise, AlGaAs, laser frequency stabilization, Fabry-P{\'e}rot cavities, 
gravitational wa