This file was created by the TYPO3 extension bib --- Timezone: CEST Creation date: 2022-08-11 Creation time: 19-18-18 --- Number of references 553 article IrwinHSBSBSV2022 2623 Journal of Aerosol Science 2022 6 163 19ENV09: MetroPEMS: Improved vehicle exhaust quantification by portable emission measurement systems metrology 105978 silver particle generator, calibration, reference aerosol, CPC calibration, DMA calibration https://www.sciencedirect.com/science/article/pii/S002185022200026X?via%3Dihub EMPIR 2019: Environment Elsevier BV 30 0021-8502 10.1016/j.jaerosci.2022.105978 NA M.Irwin T.Hammer J.Swanson V.Berger U.Sonkamble A.Boies H.Schulz K.Vasilatou article RubenVogtRGDKMKKSBBMPFCRVSH2022 2751 IEEE Journal of Photovoltaics 2022 5 12 3 19ENG01: Metro-PV: Metrology for emerging PV applications 844-852 Standards, Meteorology, IEC Standards, Temperature measurement, Power measurement, Photovoltaic systems, Mathematical models https://www.techrxiv.org/articles/preprint/PV_module_energy_rating_standard_IEC_61853-3_intercomparison_and_best_practice_guidelines_for_implementation_and_validation/19635333/1 EMPIR 2019: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 2156-3381, 2156-3403 10.1109/JPHOTOV.2021.3135258 NA M.Ruben Vogt S.Riechelmann A.M.Gracia-Amillo A.Driesse A.Kokka K.Maham P.Kärhä R.Kenny C.Schinke K.Bothe J.Blakesley E.Music F.Plag G.Friesen G.Corbellini N.Riedel-Lyngskar R.Valckenborg M.Schweiger W.Herrmann article VolkovaHTBCMARERBPN2022 2712 Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 color centers, optical quantum technology EMPIR 2020: Fundamental MDPI 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov article VolkovaHTBCMARERBPN2022_2 2721 Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time EMPIR 2020: Fundamental MDPI AG 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov article vanHeerenSPB2022 2698 CMM Magazine 2022 4 13 15 2 20NRM02: MFMET: Establishing metrology standards in microfluidic devices 20-25 Microfluidics, metrology, fabrication, testing http://www.cmmmagazine.com/cmm-articles/metrology-challenges-for-microfluidics/ EMPIR 2020: Pre-Co-Normative MST Global Ltd 30 2634-9167 NA ISSN 2634-9167 H.van Heeren V.Silverio C.Pecnik E.Batista article RabagoQVSRICCRCFFRG2022 2671 International Journal of Environmental Research and Public Health 2022 4 19 7 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level 4213 exhalation; traceRadon; proficiency test; interlaboratory comparison EMPIR 2019: Environment MDPI AG 30 1660-4601 10.3390/ijerph19074213 NA D.Rabago L.Quindos A.Vargas C.Sainz I.Radulescu M-R.Ioan F.Cardellini M.Capogni A.Rizzo S.Celaya I.Fuente M.Fuente M.Rodriguez C.Grossi article LivreriEFGRVFMG2022 2789 2022 IEEE Radar Conference (RadarConf22) 2022 3 21 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology Microwave quantum radar, Josephson traveling parametric amplifier, quantum microwave illumination, two-mode squeezing, non-classical light source, entanglement https://arxiv.org/abs/2111.03409 EMPIR 2017: Fundamental IEEE 30 10.1109/RadarConf2248738.2022.9764353 NA P.Livreri E.Enrico L.Fasolo A.Greco A.Rettaroli D.Vitali A.Farina Com. F.Marchetti A. Sq. D.Giacomin article RottgerRGVKCCKRMR2022 2625 Advances in Geosciences 2022 3 10 57 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level 37-47 Radon, climate observation, radon monitor, radiation protection, radon tracer method (RTM), radon emanation source, activity concentration, traceability EMPIR 2019: Environment Copernicus GmbH 30 1680-7359 10.5194/adgeo-57-37-2022 NA S.Röttger A.Röttger C.Grossi A.Vargas U.Karstens G.Cinelli E.Chung D.Kikaj C.Rennick F.Mertes I.Radulescu article KlenovskyVKVKF2022 2689 Electronic Structure 2022 3 4 1 20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology 015006 quantum dots https://iopscience.iop.org/article/10.1088/2516-1075/ac5b7e EMPIR 2020: Industry IOP Publishing 30 2516-1075 10.1088/2516-1075/ac5b7e NA P.Klenovský J.Valdhans L.Krejčí M.Valtr P.Klapetek O.Fedotova article KlenovskyVKVKF20220 2689 Electronic Structure 2022 3 4 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 015006 quantum dots https://iopscience.iop.org/article/10.1088/2516-1075/ac5b7e EMPIR 2017: Fundamental IOP Publishing 30 2516-1075 10.1088/2516-1075/ac5b7e NA P.Klenovský J.Valdhans L.Krejčí M.Valtr P.Klapetek O.Fedotova article KlenovskyVKVKF20221 2689 Electronic Structure 2022 3 4 1 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 015006 quantum dots https://iopscience.iop.org/article/10.1088/2516-1075/ac5b7e EMPIR 2020: Fundamental IOP Publishing 30 2516-1075 10.1088/2516-1075/ac5b7e NA P.Klenovský J.Valdhans L.Krejčí M.Valtr P.Klapetek O.Fedotova article KlenovskyVKVKF20222 2689 Electronic Structure 2022 3 4 1 20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light 015006 quantum dots https://iopscience.iop.org/article/10.1088/2516-1075/ac5b7e EMPIR 2020: Fundamental IOP Publishing 30 2516-1075 10.1088/2516-1075/ac5b7e NA P.Klenovský J.Valdhans L.Krejčí M.Valtr P.Klapetek O.Fedotova article MarlettoVKPBRAGDG2022 2679 Physical Review Letters 2022 2 23 128 8 20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology 080401 Quantum Foundations, Quantum Measurements, Quantum thermodynamics https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401 EMPIR 2020: Industry American Physical Society (APS)

Ridge, NY, United States

30 0031-9007, 1079-7114 10.1103/PhysRevLett.128.080401 NA C.Marletto V.Vedral L.T.Knoll F.Piacentini E.Bernardi E.Rebufello A.Avella M.Gramegna I.P.Degiovanni M.Genovese article MarlettoVKPBRAGDG20220 2679 Physical Review Letters 2022 2 23 128 8 17FUN06: SIQUST: Single-photon sources as new quantum standards 080401 Quantum Foundations, Quantum Measurements, Quantum thermodynamics https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401 EMPIR 2017: Fundamental American Physical Society (APS)

Ridge, NY, United States

30 0031-9007, 1079-7114 10.1103/PhysRevLett.128.080401 NA C.Marletto V.Vedral L.T.Knoll F.Piacentini E.Bernardi E.Rebufello A.Avella M.Gramegna I.P.Degiovanni M.Genovese article MarlettoVKPBRAGDG20221 2679 Physical Review Letters 2022 2 23 128 8 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 080401 Quantum Foundations, Quantum Measurements, Quantum thermodynamics https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401 EMPIR 2020: Fundamental American Physical Society (APS)

Ridge, NY, United States

30 0031-9007, 1079-7114 10.1103/PhysRevLett.128.080401 NA C.Marletto V.Vedral L.T.Knoll F.Piacentini E.Bernardi E.Rebufello A.Avella M.Gramegna I.P.Degiovanni M.Genovese article WeingartnerHVVROKMD2022 2519 Atmospheric Measurement Techniques 2022 2 18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants soot , black carbon, absorption photometer, photo-thermal interferometer, calibration EMPIR 2018: Health 30 10.5194/amt-15-561-2022 NA E.Weingartner A-P.Hyvärinen K.Vasilatou B.Visser J.Rörhbein M.Oscity D.Kalbermatter G.Močnik L.Drinovec article JuradoCLLVdM2022 2544 Journal of the Association for Research in Otolaryngology 2022 2 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources loudness, DPOAE, infrasound EMPIR 2015: Health Springer Science and Business Media LLC 30 1525-3961, 1438-7573 10.1007/s10162-021-00830-2 NA C.Jurado M.Y.P.Chow K.M.L.Leung M.Larrea J.Vizuete A.de Cheveigné T.Marquardt proceedings SinghRathoreLBSV2022 2587 Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022, 2022 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry reconstruction, tomography, iterative, Analytical https://www.ndt.net/search/docs.php3?id=26640 EMPIR 2017: Industry Wels, Austria 11th Conference on Industrial Computed Tomography (iCT) 2022 08-02-2022 to 11-02-2022 30 NA https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id244.pdf J.Singh Rathore R.Laquai A.Biguri M.Soleimani C. Vienne article MarinelliFGGGHPPVVVV2022 2659 Medical Physics 2022 1 31 49 3 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 1902-1910 diamond detector, dosimetry, FLASH radiotherapy EMPIR 2018: Health Wiley 30 0094-2405, 2473-4209 10.1002/mp.15473 NA M.Marinelli G.Felici F.Galante A.Gasparini L.Giuliano S.Heinrich M.Pacitti G.Prestopino V.Vanreusel D.Verellen C.Verona G.Verona Rinati article MilanoBVR2022 2556 Semiconductor Science and Technology 2022 1 28 37 3 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 034002 nanowires, ZnO, chemical vapor deposition (CVD), resistive switching,memristive devices, neuromorphic devices https://iopscience.iop.org/article/10.1088/1361-6641/ac4b8a EMPIR 2020: Fundamental IOP Publishing 30 0268-1242, 1361-6641 10.1088/1361-6641/ac4b8a NA G.Milano L.Boarino I.Valov C.Ricciardi article VillegasQUTL2022 2535 Photonics 2022 1 28 9 2 20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light 74 Particle characterization; Laser diffraction; Machine learning; Neural networks https://www.mdpi.com/2304-6732/9/2/74 EMPIR 2020: Fundamental MDPI AG 30 2304-6732 10.3390/photonics9020074 NA A.Villegas M.A.Quiroz-Juárez A.B.U’Ren J.P.Torres R. de J.León-Montiel article KellerSKFCVCOBHMMNORBCNCDDGLVWZK2022 2778 PLOS ONE 2022 1 20 17 1 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis e0262656 SARS-CoV-2, RNA, PCR EMPIR 2018: Health Public Library of Science (PLoS) 30 1932-6203 NA https://zenodo.org/record/6637818 T.Keller I.Schellenberg A.Kummrow S.Falak M.H.Cleveland P.M.Vallone S.Cowen D.O’Sullivan E.Busby J.Huggett M.Mielke J.Michel A.Nitsche M.Obermeier H.F.Rabenau A.Berger S.Ciesek D.Niemeyer V.Corman U.Duehring C.Drosten H-P.Grunert V.Lindig L.Vierbaum N.Wojtalewicz H.Zeichhardt M.Kammel article ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022 2567 Neuromorphic Computing and Engineering 2022 1 12 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology neuromorphic computing, neuromorphic engineering https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83 EMPIR 2020: Fundamental IOP Publishing 30 2634-4386 10.1088/2634-4386/ac4a83 NA D.V.Christensen R.Dittmann B.Linares-Barranco A.Sebastian M.Le Gallo A.Redaelli S.Slesazeck T.Mikolajick S.Spiga S.Menzel I.Valov G.Milano C.Ricciardi S-J.Liang F.Miao M.Lanza T.J.Quill S.T.Keene A.Salleo J.Grollier D.Markovic A.Mizrahi P.Yao J.J.Yang G.Indiveri J.P.Strachan S.Datta E.Vianello A.Valentian J.Feldmann X.Li W.H.P.Pernice H.Bhaskaran S.Furber E.Neftci F.Scherr W.Maass S.Ramaswamy J.Tapson P.Panda Y.Kim G.Tanaka S.Thorpe C.Bartolozzi T.A.Cleland C.Posch S-C.Liu G.Panuccio M.Mahmud A.N.Mazumder M.Hosseini T.Mohsenin E.Donati S.Tolu R.Galeazzi M.E.Christensen S.Holm D.Ielmini N.Pryds article ClivatiMDVGLMPYSLDC2022 2524 Nature Communications 2022 1 10 13 1 19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware s41467-021-27808-1 QKD, Single photons and quantum effects, Optical metrology, Fibre optics and optical communications, Optoelectronic devices and components, Quantum information EMPIR 2019: Pre-Co-Normative Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-021-27808-1 NA C.Clivati A.Meda S.Donadello S.Virzì M.Genovese F.Levi A.Mura M.Pittaluga Z.Yuan A.J.Shields M.Lucamarini I.P.Degiovanni D.Calonico article CelikovicPVNiCGBQR2022 2428 International Journal of Environmental Research and Public Health 2022 1 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level outdoor radon concentrations; literature overview; radiation risk; indoor radonconcentrations; radon priority areas EMPIR 2019: Environment 30 NA https://doi.org/10.3390/ijerph19020662 I.Čeliković G.Pantelić I.Vukanac J.K.Nikolić M.Živanović G.Cinelli V.Gruber S.Baumann L.S.Quindos Poncela D.Rabago article Villajos2022 2472 C-Journal of Carbon Research 2022 1 8 1 19ENG03: MefHySto: Metrology for Advanced Hydrogen Storage Solutions 5 hydrogen adsorption, commercial metal-organic frameworks, hydrogen uptake reproducibility, volumetric uptake, packing density EMPIR 2019: Energy MDPI AG 30 2311-5629 10.3390/c8010005 NA J.A.Villajos article FasoloBBCCCCCDEFFFFGGGGKLLLMMMMMMMNOPPPRRRSUV2022 2612 IEEE Transactions on Applied Superconductivity 2022 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology Physics, Gain, Microwave amplifiers, Noise figure, Superconducting microwave devices, Microwave photonics, Bandwidth EMPIR 2017: Fundamental Institute of Electrical and Electronics Engineers (IEEE) 30 1051-8223, 1558-2515, 2378-707 10.1109/TASC.2022.3148692 NA L.Fasolo C.Barone M.Borghesi G.Carapella A.P.Caricato I.Carusotto W.Chung A.Cian D.Di Gioacchino E.Enrico P.Falferi M.Faverzani E.Ferri G.Filatrella C.Gatti A.Giachero D.Giubertoni A.Greco C.Kutlu A.Leo C.Ligi P.Livreri G.Maccarone B.Margesin G.Maruccio A.Matlashov C.Mauro R.Mezzena A.G.Monteduro A.Nucciotti L.Oberto S.Pagano V.Pierro L.Piersanti M.Rajteri A.Rettaroli S.Rizzato Y.K.Semertzidis S.V.Uchaikin A.Vinante article MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022 2764 Nanoscale 2022 14 12 18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration 4690-4704 nanoparticle, concentration, standardization, VAMAS, interlaboratory EMPIR 2018: Support for Impact Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/D1NR07775A NA C.Minelli M.Wywijas D.Bartczak S.Cuello-Nuñez H.G.Infante J.Deumer C.Gollwitzer M.Krumrey K.E.Murphy M.E.Johnson A.R.Montoro Bustos I.H.Strenge B.Faure P.Høghøj V.Tong L.Burr K.Norling F.Höök M.Roesslein J.Kocic L.Hendriks V.Kestens Y.Ramaye M.C.Contreras Lopez G.Auclair D.Mehn D.Gilliland A.Potthoff K.Oelschlägel J.Tentschert H.Jungnickel B.C.Krause Y.U.Hachenberger P.Reichardt A.Luch T.E.Whittaker M.M.Stevens S.Gupta A.Singh F-h.Lin Y-H.Liu A.L.Costa C.Baldisserri R.Jawad S.E.L.Andaloussi M.N.Holme T.G.Lee M.Kwak J.Kim J.Ziebel C.Guignard S.Cambier S.Contal A.C.Gutleb J.“Kuba” Tatarkiewicz B.J.Jankiewicz B.Bartosewicz X.Wu J.A.Fagan E.Elje E.Rundén-Pran M.Dusinska I.P.Kaur D.Price I.Nesbitt S.O′ Reilly R.J.B.Peters G.Bucher D.Coleman A.J.Harrison A.Ghanem A.Gering E.McCarron N.Fitzgerald G.Cornelis J.Tuoriniemi M.Sakai H.Tsuchida C.Maguire A.Prina-Mello A.J.Lawlor J.Adams C.L.Schultz D.Constantin N.T.K.Thanh L.D.Tung L.Panariello S.Damilos A.Gavriilidis I.Lynch B.Fryer A.Carrazco Quevedo E.Guggenheim S.Briffa E.Valsami-Jones Y.Huang A.A.Keller V-T.Kinnunen S.Perämäki Z.Krpetic M.Greenwood A.G.Shard article XieDv2021 2478 IEEE TechRxiv 2021 12 10 17IND14: WRITE: Precision Time for Industry White Rabbit; time and frequency transfer; frequency distribution; frequency stability measurement EMPIR 2017: Industry Institute of Electrical and Electronics Engineers (IEEE) 30 10.36227/techrxiv.17122154.v1 NA Y.Xie E.Dierikx M.van Veghel article LieberherrACCCGKMMMOSSTV2021 2368 Atmospheric Measurement Techniques 2021 12 14 12 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 7693-7706 bioaerosol monitors, calibration, counting efficiency, fluorescence https://amt.copernicus.org/articles/14/7693/2021/ EMPIR 2019: Environment Copernicus GmbH 30 1867-8548 10.5194/amt-14-7693-2021 NA G. Lieberherr K.Auderset B.Calpini B.Clot B.Crouzy M.Gysel-Beer T.Konzelmann J.Manzano A.Mihajlovic A.Moallemi D.O'Connor B.Sikoparija E.Sauvageat F.Tummon K.Vasilatou article OlbrichHLvBOS2021 2175 Measurement: Sensors 2021 12 18 16ENG07: MultiFlowMet II: Multiphase flow reference metrology 100222 slug flow, interface dynamics, tomography, video observation https://www.sciencedirect.com/science/article/pii/S2665917421001859 EMPIR 2016: Energy Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100222 NA M.Olbrich A.Hunt T.Leonard D.S.van Putten M.Bär K.Oberleithner S.Schmelter article FasoloGEILVL2021 2582 Measurement: Sensors 2021 12 18 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology 100349 Microwave quantum illumination, Josephson traveling wave parametric amplifiers, Entangled quantum states, Detection probability improvement EMPIR 2017: Fundamental Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100349 NA L.Fasolo A.Greco E.Enrico F.Illuminati R.Lo Franco D.Vitali P.Livreri article DizdarAV2021 2673 Measurement: Sensors 2021 12 18 18SIB08: ComTraForce: Comprehensive traceability for force metrology services 100216 Piezoelectric force sensor; Continuous force calibration https://www.sciencedirect.com/science/article/pii/S2665917421001793 EMPIR 2018: SI Broader Scope Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100216 NA H.Dizdar B.Aydemir C.Vatan article ChenV2021 2452 Advanced Materials 2021 11 21 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 2105022 capping layers, electrode materials, redox reactions, resistive switching, thicknesses https://onlinelibrary.wiley.com/doi/full/10.1002/adma.202105022 EMPIR 2020: Fundamental Wiley 30 0935-9648, 1521-4095 10.1002/adma.202105022 NA S.Chen I.Valov article RottgerVSPDISBAGGBWPiN2021 2317 Advances in Geosciences 2021 11 17 57 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation 1-7 supportBSS, EMN for Radiation Protection, metrology, regulation, EURAMET, EURATOM EMPIR 2019: Support for Networks Copernicus GmbH 30 1680-7359 10.5194/adgeo-57-1-2021 NA A.Röttger A.Veres V.Sochor M.Pinto M.Derlacinski M-R.Ioan A.Sabeta R.Bernat C.Adam-Guillermin J.H.Gracia Alves D.Glavič-Cindro S.Bell B.Wens L.Persson M.Živanović R.Nylund article HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021 2336 NeuroImage 2021 11 241 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 118430 Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site EMPIR 2018: Health Elsevier BV 30 1053-8119 10.1016/j.neuroimage.2021.118430 NA S.C.N.Hui M.Mikkelsen H.J.Zöllner V.Ahluwalia S.Alcauter L.Baltusis D.A.Barany L.R.Barlow R.Becker J.I.Berman A.Berrington P.K.Bhattacharyya J.U.Blicher W.Bogner M.S.Brown V.D.Calhoun R.Castillo K.M.Cecil Y.B.Choi W.C.W.Chu W.T.Clarke A.R.Craven K.Cuypers M.Dacko C.de la Fuente-Sandoval P.Desmond A.Domagalik J.Dumont N.W.Duncan U.Dydak K.Dyke D.A.Edmondson G.Ende L.Ersland C.J.Evans A.S.R.Fermin A.Ferretti A.Fillmer T.Gong I.Greenhouse J.T.Grist M.Gu A.D.Harris K.Hat S.Heba E.Heckova J.P.Hegarty K-F.Heise S.Honda A.Jacobson J.F.A.Jansen C.W.Jenkins S.J.Johnston C.Juchem A.Kangarlu A.B.Kerr K.Landheer T.Lange P.Lee S.R.Levendovszky C.Limperopoulos F.Liu W.Lloyd D.J.Lythgoe M.G.Machizawa E.L.MacMillan R.J.Maddock A.V.Manzhurtsev M.L.Martinez-Gudino J.J.Miller H.Mirzakhanian M.Moreno-Ortega P.G.Mullins S.Nakajima J.Near R.Noeske W.Nordhøy G.Oeltzschner R.Osorio-Duran M.C.G.Otaduy E.H.Pasaye R.Peeters S.J.Peltier U.Pilatus N.Polomac E.C.Porges S.Pradhan J.J.Prisciandaro N.A.Puts C.D.Rae F.Reyes-Madrigal T.P.L.Roberts C.E.Robertson J.T.Rosenberg D-G.Rotaru R.L.O'Gorman Tuura M.G.Saleh K.Sandberg R.Sangill K.Schembri A.Schrantee N.A.Semenova D.Singel R.Sitnikov J.Smith Y.Song C.Stark D.Stoffers S.P.Swinnen R.Tain C.Tanase S.Tapper M.Tegenthoff T.Thiel M.Thioux P.Truong P.van Dijk N.Vella R.Vidyasagar A.Vovk G.Wang L.T.Westlye T.K.Wilbur W.R.Willoughby M.Wilson H-J.Wittsack A.J.Woods Y-C.Wu J.Xu M.Y.Lopez D.K.W.Yeung Q.Zhao X.Zhou G.Zupan R.A.E.Edden article ZeichhardtFDBHSHIVHVMCGSOEBHK2021 2777 Clinical Chemistry 2021 10 22 68 1 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis 153-162 SARS-CoV-2, RT-qPC, EQA https://academic.oup.com/clinchem/article/68/1/153/6385233#325300656
https://zenodo.org/record/6637873/files/18HLT03%20Septimet%20Supplementary%20Funding%20Acknowledgement%20CLIN%20CHEM.pdf?download=1 EMPIR 2018: Health Oxford University Press (OUP) 30 0009-9147, 1530-8561 NA https://zenodo.org/record/6637873 H.Zeichhardt C.A.Foy U.Dühring Y-K.Bae S.Hingley-Wilson N.Storey K.H.Hong J.In J.Vandesompele K.Harris J.Verwilt J.Moran-Gilad S.Cowen H-P.Grunert G.Stewart D.M.O’Sullivan D.Evans J.Braybrook Ji.F.Huggett M.Kammel article RefinoYSNHSKIVSPW2021 2474 Scientific Reports 2021 10 11 1 19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices high-aspect-ratio silicon (Si), nanowire array, lithium ion batteries, ICP-RIE https://www.nature.com/articles/s41598-021-99173-4 EMPIR 2019: Energy Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-021-99173-4 NA A.D.Refino N.Yulianto I.Syamsu A.P.Nugroho N.H.Hawari A.Syring E.Kartini F.Iskandar T.Voss A.Sumboja E.Peiner H.S.Wasisto article CorderoVALPP2021 2259 Phys. Rev. A 2021 10 104 4 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 042401 Quantum Optics, non-classical correlations, quantum metrology EMPIR 2017: Fundamental American Physical Society 30 2469-9934 NA https://arxiv.org/abs/2107.14265 O.Cordero A.Villegas J.R.Alvarez R. de J.Leon Montiel M.H.M. Passos JuanP. Torres article VidakoviKochMiCKP2021 2305 Current Opinion in Electrochemistry 2021 10 17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications 100851 Harmonic analysis, Diagnosis, Kinetics, MModel discrimination, Battery EMPIR 2017: Industry Elsevier BV 30 2451-9103 10.1016/j.coelec.2021.100851 NA T.Vidaković-Koch T.Miličić L.A.Živković H.S.Chan U.Krewer M.Petkovska proceedings vandenBromMLLLCD2021 2565 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 2021 9 29 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements Instrument Transformer, Power Quality, Power System Measurements, Calibration, Uncertainty, Standard EMPIR 2019: Pre-Co-Normative IEEE Virtual Conference 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 NA https://zenodo.org/record/6093507 H.van den Brom F.Munoz M.Luiso P.S.Letizia C.Landi G.Crotti G.D'Avanzo proceedings ManzinVFV2021 2197 Biomedical Science and Engineering 2021 9 29 4 s1 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 117-118 magnetic hyperthermia, magnetic nanoparticles, computational animal models, bio-heat model https://www.pagepress.org/technology/index.php/bse/article/view/199 EMPIR 2018: Health PAGEPress virtual meeting Third Centro 3R Annual Meeting 30-09-2021 to 01-10-2021 30 eISSN 2531-9892 10.4081/bse.2021.199 NA A.Manzin M.Vassallo R.Ferrero M.Vicentini article RottgerRGVCOHCCBIRKCAYFMM2021 2224 Measurement Science and Technology 2021 9 23 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level radon, metrology, tracer, environmental measurements EMPIR 2019: Environment IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac298d NA A.Röttger S.Röttger C.Grossi A.Vargas R.Curcoll P.Otáhal M.Á.Hernández-Ceballos G.Cinelli S.Chambers S.A.Barbosa M-R.Ioan I.Radulescu D.Kikaj E.Chung T.Arnold C.Yver Kwok M.Fuente F.Mertes V.Morosh article VasilatouWKHISSSWA2021 2082 Journal of Aerosol Science 2021 9 157 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 105818 calibration, aerosol spectrometers, PSL particles, primary standard, particle number concentration EMPIR 2019: Environment Elsevier BV 30 0021-8502 10.1016/j.jaerosci.2021.105818 NA K.Vasilatou C.Wälchli S.Koust S.Horender K.Iida H.Sakurai F.Schneider J.Spielvogel T.Y.Wu K.Auderset article EssBKGV2021 2081 Journal of Aerosol Science 2021 9 157 18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants 105820 soot, aerosol, secondary organic matter, calibration, black carbon, absorption photometers EMPIR 2018: Health Elsevier BV 30 0021-8502 10.1016/j.jaerosci.2021.105820 NA M.N.Ess M.Bertò A.Keller M.Gysel-Beer K.Vasilatou article MierEscurraRV2021 2366 IEEE Sensors Journal 2021 9 21 17 19ENG02: FutureEnergy: Metrology for future energy transmission 18618-18625 Magnetic loop antenna, partial discharges, transfer function, electric circuit, GIS, broadband antenna, VHF, high voltage SEG EMPIR 2019: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 1530-437X, 1558-1748, 2379-915 10.1109/JSEN.2021.3089084 NA C.Mier Escurra A.Rodrigo Mor P.Vaessen article DollemanCLvSS2021 2244 Nano Letters 2021 8 30 21 18 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 7617-7624 graphene, nanoelectromechanical systems (NEMS), pressure sensor, gas damping EMPIR 2017: Fundamental American Chemical Society (ACS) 30 1530-6984, 1530-6992 10.1021/acs.nanolett.1c02237 NA R.J.Dolleman D.Chakraborty D.R.Ladiges H.S.J.van der Zant J.E.Sader P.G.Steeneken article FerreroBCVHYACMT2021 2146 Nanomaterials 2021 8 25 11 9 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 2179 nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations EMPIR 2018: Health MDPI 30 2079-4991 10.3390/nano11092179 NA R.Ferrero G.Barrera F.Celegato M.Vicentini H.Hüseyin N.Yıldız C.Atila Dinçer M.Coïsson A.Manzin P.Tiberto article SteenekenDDAv2021 2239 2D Materials 2021 8 12 8 4 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 042001 2D material, dynamics, mechanics, graphene, NEMS https://arxiv.org/ct?url=https%3A%2F%2Fdx.doi.org%2F10.1088%2F2053-1583%2Fac152c&v=8246bcbf EMPIR 2017: Fundamental IOP Publishing 30 2053-1583 10.1088/2053-1583/ac152c NA P.G.Steeneken R.J.Dolleman D.Davidovikj F.Alijani H.S.J.van der Zant article ViereckKNP2021 2418 Chemosensors 2021 2021 8 9 207 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements cantilever, resonant frequency, mass, magnetic moment, magnetic force gradient, magneticparticles https://www.mdpi.com/2227-9040/9/8/207 EMPIR 2017: Industry MDPI 30 10.3390/chemosensors9080207 NA T.Viereck T.Kahmann W.O.Nyang’au E.Peiner article RadtkeCKLSDAHNVRQLDBUL2021 2285 Pure and Applied Chemistry 2021 7 30 93 9 17FUN09: UnipHied: Realisation of a Unified pH Scale 1049-1060 Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability EMPIR 2017: Fundamental Walter de Gruyter GmbH 30 0033-4545, 1365-3075 10.1515/pac-2019-0504 NA V.Radtke F.Camões I.Krossing I.Leito D.Stoica L.Deleebeeck B.Anes A.Heering T.Näykki S.Veltzé M.Roziková R.Quendera L.Liv N.Dániel F.Bastkowski E.Uysal N.Lawrence article MilanoLLBRV2021 2236 Advanced Materials Interfaces 2021 7 28 8 16 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 2100915 effect of moisture on electroforming, electrical conductivity, memristors, nanostructures, resistive switching https://onlinelibrary.wiley.com/doi/10.1002/admi.202100915 EMPIR 2020: Fundamental Wiley 30 2196-7350, 2196-7350 10.1002/admi.202100915 NA G.Milano M.Luebben M.Laurenti L.Boarino C.Ricciardi I.Valov article TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021 2260 EJNMMI Physics 2021 7 23 8 1 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom EMPIR 2015: Health Springer Science and Business Media LLC 30 2197-7364 10.1186/s40658-021-00397-0 NA J.Tran-Gia A.M.Denis-Bacelar K.M.Ferreira A.P.Robinson N.Calvert A.J.Fenwick D.Finocchiaro F.Fioroni E.Grassi W.Heetun S.J.Jewitt M.Kotzassarlidou M.Ljungberg D.R.McGowan N.Scott J.Scuffham K.S.Gleisner J.Tipping J.Wevrett M.Bardiès S.Berenato I.Bilas C.Bobin M.Capogni M.Chauvin S.COLLINS M.Cox J.Dabin M.D’Arienzo J.Gustafsson A.Hallam T.Kalathas G.Kayal G.Lorusso F-J.Maringer D.Morgan V.Smyth J.Solc L.Štemberková L.Struelens A.Vergara-Gil H.Wiedner M.Lassmann article VargasCMRPLNSL2021 2114 Radiation Measurements 2021 7 145 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 106595 Airborne radiological detectorUnmanned aerial systemEnvironmental radioactivity mappingSource localization EMPIR 2016: Environment Elsevier BV 30 1350-4487 10.1016/j.radmeas.2021.106595 NA A.Vargas D.Costa M.Macias P.Royo E.Pastor M.Luchkov S.Neumaier U.Stöhlker R.Luff article DeleebeeckSNSRVHBLQCS2021 2183 Sensors 2021 6 21 11 17FUN09: UnipHied: Realisation of a Unified pH Scale 3935 pHabs; ionic liquid salt bridge; commercial glass electrodes; water–alcohol mixture;non-aqueous pH EMPIR 2017: Fundamental MDPI AG 30 1424-8220 10.3390/s21113935 NA L.Deleebeeck A.Snedden D.Nagy Z.Szilágyi Nagyné M.Roziková M.Vičarová A.Heering F.Bastkowski I.Leito R.Quendera V.Cabral D.Stoica article VeenC2021 2070 Accreditation and Quality Assurance 2021 6 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards measurement uncertainty, Monte Carlo method, GUM, propagation of distributions, law of propagation of uncertainty, sensitivity coefficient EMPIR 2017: Pre-Co-Normative Springer Science and Business Media LLC 30 0949-1775, 1432-0517 10.1007/s00769-021-01469-5 NA A.M.H. van derVeen M.G.Cox article RebufelloPASGDCVDG2021 2446 Light: Science & Applications 2021 5 25 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Quantum Measurement, Weak Values, Single Photons, Quantum Metrology EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2047-7538 10.1038/s41377-021-00539-0 NA E.Rebufello F.Piacentini A.Avella M.A. deSouza M.Gramegna J.Dziewior E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article RebufelloPALVTGBCVDG2021 2447 Applied Sciences 2021 5 11 9 17FUN06: SIQUST: Single-photon sources as new quantum standards 4260 Quantum Measurement, Weak Measurement, Quantum Metrology, Single Photons EMPIR 2017: Fundamental MDPI AG 30 2076-3417 10.3390/app11094260 NA E.Rebufello F.Piacentini A.Avella R.Lussana F.Villa A.Tosi M.Gramegna G.Brida E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article KlapetekGNVSN2021 2318 Computer Physics Communications 2021 5 265 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 108025 FDTD, Plasmonics, Optics, Roughness EMPIR 2017: Fundamental Elsevier BV 30 0010-4655 10.1016/j.cpc.2021.108025 NA P.Klapetek P.Grolich D.Nezval M.Valtr R.Šlesinger D.Nečas article ManzinFV2021 1996 Advanced Theory and Simulations 2021 3 26 4 3 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 2100013 Magnetic hyperthermia, Magnetic nanoparticles, Micromagnetic modeling, In silico modeling, Bioheat transfer equation https://onlinelibrary.wiley.com/doi/full/10.1002/adts.202100013 EMPIR 2018: Health Wiley-VCH 30 10.1002/adts.202100013 NA A.Manzin R.Ferrero M.Vicentini article SchmidtGNBvZMBSHWR2021 2616 Physical Review Research 2021 3 19 3 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 013263 microlaser, transition-edge sensor, photon statistics, photon counting, nanophotonics https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.3.013263 EMPIR 2017: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.3.013263 NA M.Schmidt I.H.Grothe S.Neumeier L.Bremer M.von Helversen W.Zent B.Melcher J.Beyer C.Schneider S.Höfling J.Wiersig S.Reitzenstein article EssBIMGV2021 2011 Aerosol Science and Technology 2021 3 15 16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols 1-25 soot, miniCAST, morphology, optical properties, calibration aerosol, combustion generator https://www.tandfonline.com/doi/full/10.1080/02786826.2021.1901847 EMPIR 2016: Environment Informa UK Limited

London, United Kingdom

30 0278-6826, 1521-7388 10.1080/02786826.2021.1901847 NA M.N.Ess M.Bertò M.Irwin R.L.Modini M.Gysel-Beer K.Vasilatou article EichstadtGVSBK2021 2301 Sensors 2021 3 12 21 6 17IND12: Met4FoF: Metrology for the Factory of the Future 2019 Internet of Things, calibration, measurement uncertainty, traceability, semantics, ontology, sensor network, digital sensors, redundancy EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s21062019 NA S.Eichstädt M.Gruber A.P.Vedurmudi B.Seeger T.Bruns G.Kok article IurlaroBCBFKMMMNNSVWi2021 2018 Radiation Measurements 2021 3 142 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 106543 Passive dosimetry systems, Uncertainty budget, Decision threshold, Detection limitEnvironmental radiation monitoring, Emergency preparedness EMPIR 2016: Environment Elsevier BV 30 1350-4487 10.1016/j.radmeas.2021.106543 NA G.Iurlaro Z.Baranowska L.Campani O.C.Bjelac P.Ferrari Ž.Knežević M.Majer F.Mariotti B.Morelli S.Neumaier M.Nodilo L.Sperandio F.A.Vittoria K.Wołoszczuk M.Živanović article vandenBergDOPD2021 2217 Applied Optics 2021 2 26 60 7 16ENV03: MetEOC-3: Further metrology for earth observation and climate 1995 CubeSat, Calibration, Spectroradiometer EMPIR 2016: Environment The Optical Society 30 1559-128X, 2155-3165 10.1364/AO.417467 NA S.van den Berg P.Dekker G.Otter M.P.Páscoa N.Dijkhuizen article DiCapuaMSDVCFFV2021 1927 Sustainability 2021 2 26 13 5 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 2556 behavioral modeling; inductive coupling; mutual inductance; wireless power transfer https://www.mdpi.com/2071-1050/13/5/2556 EMPIR 2016: Energy MDPI AG 30 2071-1050 10.3390/su13052556 NA G.Di Capua A.Maffucci K.Stoyka G.Di Mambro S.Ventre V.Cirimele F.Freschi N.Femia F.Villone article HorenderAQSNDSWAKGV2021 1901 Atmospheric Measurement Techniques 2021 2 16 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality ambient-like aerosols, particulate matter, calibration , PM monitors https://amt.copernicus.org/articles/14/1225/2021/amt-14-1225-2021.html EMPIR 2016: Environment 30 10.5194/amt-14-1225-2021 NA S.Horender K.Auderset P.Quincey S.Seeger S.Nielsen Skov K.Dirscherl T.O.M.Smith K.Williams C.C. Aegerter D.M. Kalbermatter F.Gaie-Levrel K.Vasilatou article LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021 2093 Nanotechnology 2021 2 32 16 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 162003 Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap EMPIR 2017: Fundamental IOP Publishing 30 0957-4484, 1361-6528 10.1088/1361-6528/abb333 NA A.Laucht F.Hohls N.Ubbelohde M.Fernando Gonzalez-Zalba D.J.Reilly S.Stobbe T.Schröder P.Scarlino J.V.Koski A.Dzurak C-H.Yang J.Yoneda F.Kuemmeth H.Bluhm J.Pla C.Hill J.Salfi A.Oiwa J.T.Muhonen E.Verhagen M.D.LaHaye H.H.Kim A.W.Tsen D.Culcer A.Geresdi J.A.Mol V.Mohan P.K.Jain J.Baugh article PreetzmannEVLR2021 2667 AIChE Journal 2021 1 11 67 4 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 1-12 composition analysis, liquefaction, liquefied natural gas, optical spectroscopy, vapor–liquid-equilibrium https://aiche.onlinelibrary.wiley.com/doi/epdf/10.1002/aic.17128 EMPIR 2016: Energy Wiley 30 0001-1541, 1547-5905 10.1002/aic.17128 NA N.Preetzmann P.Eckmann A.M.H.Veen J.Li M.Richter inbook BELLGAABSIDPSVRIWPNKSD2021 2552 2021 1 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation radiation protection, metrology, national regulation, European regulation, supportBSS, ENM for Radiation Protection https://vinar.vin.bg.ac.rs/bitstream/handle/123456789/10125/309-314.pdf EMPIR 2019: Support for Networks RADIATION PROTECTION SOCIETY OF SERBIA AND MONTENEGRO, PROCEEDINGS, XXXI SYMPOSIUM RPSSM, 2021 30 78-86-7306-161-0 NA S.Bell D.Glavič-Cindro J.ALVES C.Adam-Guillermin R.Bernat A.Sabeta M-R.Ioan M.DERLACINSKI M.Pinto V.Sochor A.Veres .A.RÖTTGER M.Živanović B.Wens L.Persson R.Nylund N.Kržanović S.STANKOVIĆ S.DIMOVIĆ article MinutoliCCDPV2021 2344 Notiziario dell'Istituto Superiore di Sanità 2021 1 34 1 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 13-16 biomedical research, open science, hyperthermia, radiotherapy, Zenodo https://www.iss.it/documents/20126/0/Open+Science+Progetto+europeo+RaCHy.pdf/bebb34b6-0b8e-d0e0-c23b-5a3227bd9b7e?t=1613031471672 EMPIR 2018: Health Istituto Superiore di Sanità 59 1827-6296 NA https://doi.org/10.5281/zenodo.5728941 D.Minutoli B.CACCIA A.Campa G.Durando S.Pozzi S.Valentini proceedings CrottiMVMCTL2021 2572 CIRED 2021 - The 26th International Conference and Exhibition on Electricity Distribution 2021 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements Instrument Transformers, Power Quality Measurements, Calibration, Measurement Technique, Measurement Uncertainty EMPIR 2019: Pre-Co-Normative Institution of Engineering and Technology Virtual Conference CIRED 2021 20-09-2021 to 23-09-2021 30 NA https://zenodo.org/record/6136940 G.Crotti J.Meyer H.van den Brom E.Mohns Y.Chen R.Tinarelli M.Luiso article VicarJJIBJBBST2021 2647 VACUUM 2021 189 2021 20SIP01: ISO Gauge: Developing an ISO Technical Specification "Characteristics for a stable ionisation vacuum gauge" 110239 Ionisation vacuum gaugeHot cathodeSensitivitySecondary electronsIon induced secondary electron yield https://arxiv.org/abs/2103.03566 EMPIR 2020: Support for Impact Elsevier Ltd 30 0042-207X 10.1016/j.vacuum.2021.110239 NA M.Vicar G.Jönnson B.Jenninger C.Illgen N.Bundaleski K.Jousten F.Boineau M.Bernien J.Šetina O.Teodoro article TiainenVHH2021 2075 Measurement 2021 179 109422 19ENG07: Met4Wind: Metrology for enhanced reliability and efficiency of wind energy systems 109422 Relative shaft displacement,Runout, Roundness, Shaft geometry, Electrical runout,Mechanical runout, Multi-probe roundness https://www.sciencedirect.com/science/article/pii/S0263224121004115 EMPIR 2019: Energy Elsevier 30 0263-2241 10.1016/j.measurement.2021.109422 NA T.Tiainen R.Viitala T.P.Holopainen B.Hemming article VentonHSSA2021 2249 Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences 2021 379 2212 18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management - electrocardiogram, physiological noise, robustness, deep learning, convolutional neural network, symmetric projection attractor reconstruction https://royalsocietypublishing.org/doi/10.1098/rsta.2020.0262 EMPIR 2018: Health Royal Society Publishing 30 - NA https://doi.org/10.1098/rsta.2020.0262 J.Venton P.M.Harris A.Sundar N.A.S.Smith P.J. Aston article VisserRSDMW2020 2009 Atmospheric Measurement Techniques 2020 12 23 13 12 16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols 7097-7111 single-beam photothermal interferometer; measurement; aerosol light absorption; standard dual-beam photothermal interferometers; light-absorbing gases; NO2; black carbon; concentration; detection limits EMPIR 2016: Environment Copernicus GmbH 30 1867-8548 10.5194/amt-13-7097-2020 NA B.Visser J.Röhrbein P.Steigmeier L.Drinovec G.Močnik E.Weingartner article DrAmatoVMBMBM2020 1874 Sensors 2020 12 21 20 24 16ENV08: IMPRESS 2: Metrology for air pollutant emissions 7349 laser flow meter; Pitot tube; flow speed; time of flight; dilution method; flow simulation; flow turbulence; gas sensing applications EMPIR 2016: Environment MDPI AG 30 1424-8220 10.3390/s20247349 NA F.D’Amato S.Viciani A.Montori M.Barucci C.Morreale S.Bertagna G.Migliavacca article BowdenVHSH2020 2729 Physical Review X 2020 12 15 10 4 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems Atomic and Molecular Physics EMPIR 2017: Fundamental American Physical Society (APS) 30 2160-3308 10.1103/PhysRevX.10.041052 NA W.Bowden A.Vianello I.R.Hill M.Schioppo R.Hobson article GiordanoSGvS2020 1931 Sensors 2020 12 20 23 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems 6935 power measurement; braking rheostat; regenerative braking; current transducer; frequency characterization; chopped current; railway system; DC locomotive EMPIR 2016: Energy MDPI AG 30 1424-8220 10.3390/s20236935 NA D.Giordano D.Signorino D.Gallo H.E.van den Brom M.Šíra article SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020 1841 Physica Medica 2020 12 80 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 134-150 Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project EMPIR 2018: Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2020.09.020 NA A.Schüller S.Heinrich C.Fouillade A.Subiel L.De Marzi F.Romano P.Peier M.Trachsel C.Fleta R.Kranzer M.Caresana S.Salvador S.Busold A.Schönfeld M. McEwen F.Gomez J.Solc C.Bailat V.Linhart J.Jakubek J.Pawelke M.Borghesi R-P.Kapsch A.Knyziak A.Boso V.Olsovcova C.Kottler D.Poppinga I.Ambrozova C-S.Schmitzer S.Rossomme M-C.Vozenin proceedings ElgGAMMHHLMPMSV2020 2062 VDE High Voltage Technology 2020; ETG-Symposium 2020 12 N/A N/A 19ENG02: FutureEnergy: Metrology for future energy transmission N/A UHVDC, traceability, Lightning Impulse, linearity, voltage dependence, HVAC, DC partial discharge, GIS Partial discharge SEG https://ieeexplore.ieee.org/servlet/opac?punumber=9275417 EMPIR 2019: Energy VDE Berlin, Germany VDE High Voltage Technology 2020; ETG-Symposium 09-11-2020 to 11-11-2020 30 978-3-8007-5353-6 NA https://zenodo.org/record/4769653 A-P.Elg F.Garnacho M.Agazar J.Meisner A.Merev E.Houtzager J.Hällström K.Lahti C.Mier Escurra C.Platinero T.Micand T.Steiner A.Voss article MaraisvKv2020 2080 IEEE Transactions on Instrumentation and Measurement 2020 11 20 70 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters 1-11 Energy measurement; electromagnetic compatibility; electromagnetic interference; immunity testing; measurement errors; standards; watthour meters; SEG EMPIR 2017: Pre-Co-Normative Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2020.3039631 NA Z.Marais H.E.van den Brom G.Kok M.G.A.van Veghel article SachsePVSRBBHKSKH2020 1704 ACS Catalysis 2020 11 20 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 14210-14223 spectroscopic ellipsometry, electrocatalysis, oxygen evolution reaction, mesoporous iridium oxidefilms, non-destructive ambient analysis, intrinsic OER activity, complementary methodology and metrology EMPIR 2016: Energy American Chemical Society (ACS) 30 2155-5435, 2155-5435 10.1021/acscatal.0c03800 NA R.Sachse M.Pflüger J-J.Velasco-Vélez M.Sahre J.Radnik M.Bernicke D.Bernsmeier V-D.Hodoroaba M.Krumrey P.Strasser R.Kraehnert A.Hertwig article FerreroBCPPPSSVM2020 1740 Metrologia 2020 11 11 57 6 16NRM08: BiRD: Bidirectional reflectance definitions 065029 sparkle, texture, reflectance, contrast threshold, gonio-spectrophotometry EMPIR 2016: Pre-Co-Normative IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/abb0a3 NA A.Ferrero N.Basic J.Campos M.Pastuschek E.Perales G.Porrovecchio M.Smid A.Schirmacher J.L. Velázquez F.Martínez-Verdú article HuggettBBGHKKMMNPSSVVWZ2020 1862 Clinical Chemistry 2020 10 30 66 11 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis 1369-1372 SARS-CoV-2, RT-qPCR, contamination, false positive, molecular diagnosis https://academic.oup.com/clinchem/article/66/11/1369/5902447 EMPIR 2018: Health Oxford University Press (OUP) 30 0009-9147, 1530-8561 10.1093/clinchem/hvaa214 NA J.F.Huggett V.Benes S.A.Bustin J.A.Garson K.Harris M.Kammel M.Kubista T.D.McHugh J.Moran-Gilad T.Nolan M.W.Pfaffl M.Salit G.Shipley P.M.Vallone J.Vandesompele C.Wittwer H.Zeichhardt miscellaneous auseviCv 1645 2020 10 21 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards gas flow measurement, measurement uncertainty, master meter, meter under test, calibration EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.4114438 NA M.Čaušević M.G.Cox A.M.H.van der Veen miscellaneous auseviMvC 1638 2020 10 13 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards permeation, calibration gas mixtures, uncertainty evaluation EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.4084956 NA M.Čaušević H.Meuzelaar A.M.H.van der Veen M.G.Cox article MeuzelaarLPvv2020 2156 International Journal of Hydrogen Energy 2020 10 45 58 17IND09: MetAMCII: Metrology for Airborne Molecular Contaminants II 34024-34036 Hydrogen, fuel cell vehicles, Hydrogen purity, ISO 14687, ISO 21087, Permeation, Spectroscopy EMPIR 2017: Industry Elsevier 30 10.1016/j.ijhydene.2020.09.046 NA H.Meuzelaar J.Liu S.Persijn J.van Wijk A.van der Veen article WelshvBCHLLLvNTWWJ2020 1707 Journal of Extracellular Vesicles 2020 9 24 9 1 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses 1816641 Calibration; exosomes; extracellular vesicles; microvesicles; optical analysis; reference materials; standardization; quality control; validation EMPIR 2018: Health 30 2001-3078 10.1080/20013078.2020.1816641 NA J.A. Welsh E.van der Pol B.A. Bettin D.R.F. Carter A.Hendrix M.Lenassi M-A. Langlois A.Llorente A.S.van de Nes R.Nieuwland V.Tang L.Wang K.W. Witwer J.C. Jones article EckmannvCLvKR2020 1605 International Journal of Thermophysics 2020 9 23 41 11 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 1-19/156 Cryogenic state · Density measurement · Liquefied binary mixtures ·Magnetic-suspension coupling · Single-sinker densimeter EnG EMPIR 2016: Energy Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-020-02728-2 NA P.Eckmann N.von Preetzmann G.Cavuoto J.Li A.van der Veen R.Kleinrahm M.Richter article KuipervNVv2020 1706 American Journal of Reproductive Immunology 2020 9 23 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses calibration,data interpretation,extracellular vesicles,flow cytometry,standardization EMPIR 2018: Health John Wiley & Sons Ltd 30 1046-7408 10.1111/aji.13350 NA M.Kuiper A.van de Nes R.Nieuwland Z.Varga E.van de Pol miscellaneous CarulloCV 1597 2020 9 14 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Data acquisition systems; Electrical quantities: Measurement uncertainty; Cross Talk EMPIR 2017: Pre-Co-Normative 30 NA https://zenodo.org/record/4028283 ACarullo S.Corbellini A.Vallan article WinterSVMRPKHLHDBBBBBBKSR2020 1950 37th European Photovoltaic Solar Energy Conference and Exhibition 2020 9 11 16ENG02: PV-Enerate: Advanced PV energy rating 877 - 882 Testing, PV Module, Bifacial PV EMPIR 2016: Energy 30 NA https://zenodo.org/record/4055707 S.Winter H.Sträter A.Vegas R.R.Molinero S.Riechelmann D.Pavanello R.Kenny W.Herrmann J.Lopez-Garcia D.Hinken S.Dittmann J.Bonilla M. Bliss K.Bothe J.C.Blakesley T.R.Betts G.Bellenda G. Koutsourakis A.Schmid M.Rauer article CrottivMTLSACMMA2020 2130 Conference on Precision Electromagnetic Measurements CPEM 2020 Proceedings 2020 8 24 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements Instrument transformers, calibration, measurement standards, measurement techniques, measurementuncertainty, precision measurements SEG EMPIR 2019: Pre-Co-Normative 30 10.5281/zenodo.5136547 NA G.Crotti H.E.van den Brom E.Mohns R.Tinarelli M.Luiso R.Styblikova M.Agazar H.Çaycı P.Mazza J.Meyer M. Almutairi article MustapaaNHV2020 1670 Sensors 2020 8 21 20 17 17IND02: SmartCom: Communication and validation of smart data in IoT-networks 4730 IoT-communication, sensor networks, smart agents, metrology, digital calibration certificate, traceability https://www.mdpi.com/1424-8220/20/17/4730 EMPIR 2017: Industry MDPI AG

Basel CH-4005 Switzerland

30 1424-8220 10.3390/s20174730 NA T.Mustapää P.Nikander D.Hutzschenreuter R.Viitala article deKromBZEvvvvHvDCE2020 1994 Measurement 2020 8 16 169 2021 16ENV01: MercOx: Metrology for oxidised mercury 108351 Mercury, Metrology, Primary gas standard, Calibration, SI-traceability, Environmental EMPIR 2016: Environment Elsevier 30 0263-2241 10.1016/j.measurement.2020.108351 NA I.de Krom W.Bavius R.Ziel E.Efremov D.van Meer P.van Otterloo I.van Andel D.van Osselen M.Heemskerk A.M.H.van der Veen M.A.Dexter W.T.Corns H.Ent proceedings vandenBromv2020 1942 2020 Conference on Precision Electromagnetic Measurements (CPEM) 2020 8 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Current measurement, measurement standards, measurement techniques, precision measurements, transducers https://www.techrxiv.org/articles/preprint/Calibrating_Sensors_to_Measure_Braking_Chopper_Currents_in_DC_Traction_Units/13469679 EMPIR 2016: Energy IEEE Denver, CO, USA Conference on Precision Electromagnetic Measurements (CPEM) 24-08-2020 to 28-08-2020 30 978-1-7281-5898-3 2160-0171 10.1109/CPEM49742.2020.9191822 NA H.van den Brom R.van Leeuwen proceedings vanLeeuwenvRHH2020 1943 2020 Conference on Precision Electromagnetic Measurements (CPEM) 2020 8 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Current measurement, current transformers, measurement standards, precision measurements SEG https://www.techrxiv.org/articles/preprint/Measuring_the_Voltage_Dependence_of_Current_Transformers/13469673/1 EMPIR 2016: Energy IEEE Denver, CO, USA Conference on Precision Electromagnetic Measurements (CPEM) 24-08-2020 to 28-08-2020 30 978-1-7281-5898-3 2160-0171 10.1109/CPEM49742.2020.9191845 NA R.van Leeuwen H.van den Brom G.Rietveld E.Houtzager D.Hoogenboom proceedings vanVeghelSvHRvMK2020 2103 2020 Conference on Precision Electromagnetic Measurements (CPEM) 2020 8 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters Energy measurement,electromagnetic compatibility,measurement errors,electricity meters SEG https://www.techrxiv.org/articles/preprint/Towards_improved_standardization_of_electricity_meter_testing/13469622/1 EMPIR 2017: Pre-Co-Normative IEEE Bolder Conference of Precession Electromagnetic MeasurementsPEM 01-08-2020 to 07-08-2020 30 10.1109/CPEM49742.2020.9191719 NA M.G.A.van Veghel S.Sharma H.E.van den Brom D.Hoogenboom G.Rietveld R.van Leeuwen Z.Marais G.J.P.Kok proceedings vandenBromGGWG2020 1941 2020 Conference on Precision Electromagnetic Measurements (CPEM) 2020 8 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Current measurement, energy measurement, rail transportation, transducers, measurement uncertainty https://www.techrxiv.org/articles/preprint/Accurate_Measurement_of_Energy_Dissipated_in_Braking_Rheostats_in_DC_Railway_Systems/13469739/1 EMPIR 2016: Energy IEEE Denver, CO, USA Conference on Precision Electromagnetic Measurements (CPEM) 24-08-2020 to 28-08-2020 30 978-1-7281-5899-0 2160-0171 10.1109/CPEM49742.2020.9191917 NA Helkovan den Brom DomenicoGiordano DanielleGallo AndreasWank DomenicoGiordano miscellaneous PennecchiRSEv 1553 2020 7 31 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Uncertainty evaluation; Monte Carlo method; GUM uncertainty framework;Benzo[a]pyrene; Polycyclic Aromatic Hydrocarbons EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3968940 NA F.Pennecchi F.Rolle M.Sega S.L.R.Ellison A.M.H.van der Veen article ShuVZAF2020 1544 Frontiers in Mechanical Engineering 2020 7 24 6 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel liquefied natural gas, liquefied biogas, rapid compression machine, auto-ignition delays, chemical kinetics, modeling, shock tube EnG EMPIR 2016: Energy Frontiers Media SA 30 2297-3079 10.3389/fmech.2020.00047 NA B.Shu S.K.Vallabhuni J.Zheng S.Agarwal R.X.Fernandes thesis Vadlejch2020 1720 2020 7 14 17FUN07: CC4C: Coulomb Crystals for Clocks motional systematic frequency shifts, quadrupole transition of calcium ion, micromotion, minimization of micromotion, detection of micromotion, photon-correlation method, linear Paul ion trap https://dspace.vutbr.cz/xmlui/handle/11012/192380 EMPIR 2017: Fundamental Brno University of Technology 27 NA http://hdl.handle.net/11012/192380 D.Vadlejch article AlKhafajiGWBV2020 1714 Materials 2020 7 11 13 14 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses 3101 silica nanoparticle; size distribution; light scattering; small-angle X-ray scattering; microfluidic resistive pulse sensing EMPIR 2018: Health MDPI AG 30 1996-1944 10.3390/ma13143101 NA M.A.Al-Khafaji A.Gaál A.Wacha A.Bóta Z.Varga article HeeringSCANNQRBBNSLLURVSDRKL2020 1554 Symmetry 2020 7 12 7 17FUN09: UnipHied: Realisation of a Unified pH Scale 1150 unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid EMPIR 2017: Fundamental MDPI AG 30 2073-8994 10.3390/sym12071150 NA AgnesHeering DanielaStoica FilomenaCamões BárbaraAnes DánielNagy ZsófiaNagyné Szilágyi RaquelQuendera LuisRibeiro FrankBastkowski RasmusBorn JaakNerut JaanSaame SilvieLainela LokmanLiv EmrahUysal MatildaRoziková MartinaVičarová AlanSnedden LisaDeleebeeck ValentinRadtke IngoKrossing IvoLeito article DrAmatoVMLFP2020 2116 Measurement 2020 7 159 16ENV08: IMPRESS 2: Metrology for air pollutant emissions 107746 Ammonia was measured as a target gas in an artificial stack; Optical detection techniques exhibit different resilience to absorption lineshapes; Target gas absorption widths are sensitive to the concentrations of water and CO2; Direct absorption and derivative detection were compared with respect to calibration; An optical multipass cell was used, completely inside an artificial stack at 140 °C. https://www.sciencedirect.com/science/article/pii/S0263224120302840?via%3Dihub EMPIR 2016: Environment Elsevier BV 30 0263-2241 10.1016/j.measurement.2020.107746 NA F.D’Amato S.Viciani A.Montori A.Lapini I.Fraboulet J.Poulleau article SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020 1522 Physics in Medicine and Biology 2020 6 22 65 9 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 095011 TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo EMPIR 2016: Pre-Co-Normative Institute of Physics

London

30 10.5281/zenodo.3903294 NA J.Seuntjens L.A.de Prez M.Pinto M.Pimpinella C.P.Oliver J.Ojala B.Muir L.Mirzakhanian M.D.Hanlon P.Francescon F.Delaunay J.Borbinha F.Ballester C.E.Andersen S.Vatnitsky M. McEwen R.P.Kapsch D.T.Burns P.Andreo L.Sommier P.Teles J.Tikkanen J.Vijande K.Zink article dePooterBdDKKvW2020 1629 Physics in Medicine & Biology 2020 6 22 1 1 19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy 1 Reference dosimetry, MRI linac, Monte Carlo simulation, MR guided radiotherapy EMPIR 2019: Pre-Co-Normative IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ab9efe NA J.A.de Pooter I.Billas L.A.de Prez S.Duane R-P.Kapsch C.P.Karger B.van Asselen J.W.H.Wolthaus article SetinaTIBBJVW2020 1519 Vacuum 2020 6 10 179 16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge Ionisation gauge, Hot cathode, Sensitivity, Secondary electrons, Electron stimulated desorption EMPIR 2016: Pre-Co-Normative Elsevier

Munich

30 0042-207X 10.1016/j.vacuum.2020.109545 NA K.Jousten F.Boineau N.Bundaleski C.Illgen J.Šetina O.M.N.D.Teodoro M.Vicar M.Wüest miscellaneous SegaRPSdv 1509 2020 6 3 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Gas mixtures; Nitrogen oxides; Dynamic dilution; Mass flow controllers; Chemiluminescence analyser; Calibration; Uncertainty and covariance evaluation; Weighted Total Least-Squares EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3875469 NA M.Sega F.Rolle F.Pennecchi P.Spazzini I.de Krom A.M.H.van der Veen proceedings LuchkovNV2020 2020 SMSI 2020 Conference Proceedings - Sensor and Measurement Science International 2020 6 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident Radiation monitoring, spectro-dosemeter, cerium bromide, UAV, "Preparedness" https://www.ama-science.org/proceedings/details/3775 EMPIR 2016: Environment Nuremberg Sensor and Measurement Science International 22-06-2020 to 25-06-2020 30 978-3-9819376-2-6 NA 978-3-9819376-2-6 M.Luchkov S.Neumaier A.Vargas miscellaneous vanderVeen 1499 2020 5 20 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Mass, calibration https://zenodo.org/record/3836190#.XsZdEmhKg2w EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3836190 NA A.van der Veen article BilousBBSvTPLP2020 1541 Physical Review Letters 2020 5 12 124 19 17FUN07: CC4C: Coulomb Crystals for Clocks highly charged Ionshigh-intensity optical laserHighly Charged 229Th Ions EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.124.192502 NA P.V.Bilous H.Bekker J.C.Berengut B.Seiferle L.von der Wense P.G.Thirolf T.Pfeifer J.R.C.López-Urrutia A.Pálffy article MartinezABNVJHKVKL2020 1488 Measurement Science and Technology 2020 4 23 15SIB09: 3DNano: Traceable three-dimensional nanometrology nanometrology, transfer standard, calibration, CSI, SWLI, AFM, traceability EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab8c6a NA V.Heikkinen I.Kassamakov T.Viitala M.Järvinen T.Vainikka A.Nolvi C.Bermudez R.Artigas P.Martinez V.Korpelainen A.Lassila article YacootKHDDRVN2020 1489 Measurement Science and Technology 2020 4 15SIB09: 3DNano: Traceable three-dimensional nanometrology atomic force microscopy, Fibre interferometry, probe sample interaction, nanometrology EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab85d8 NA P.Klapetek A.Yacoot V.Hortvík V.Duchoň H.Dongmo S.Rerucha M.Valtr D.Nečas miscellaneous SousaPvCFDBKE 1467 2020 3 25 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Bayesian statistics, measurement uncertainty, prior knowledge, calibration EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3726908 NA J.A.Sousa O.Pellegrino A.M.H.van der Veen M.G.Cox N.Fischer S.Demeyer A.Bošnjakovic V.Karahodžić C.Elster miscellaneous vanderVeenHCPE 1459 2020 3 22 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Conformity assessment; Multicomponent material; Measurement uncertainty; Risk of false decision; Correlated test results EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3723507 NA A.M.Hvan der Veen PHarris M.GCox FPennecchi S.L.REllison article KueraKPBV2020 1607 Measurement Science and Technology 2020 3 17 31 6 17RPT04: VersICaL: A versatile electrical impedance calibration laboratory based on digital impedance bridges 064002 signal generator, synthesizer, voltage, calibration, metrology, impedance,AC Josephson effect EMPIR 2017: Research Potential IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab6f2e NA J.Kucera J.Kováč L.Palafox R.Behr L.Vojáčková article FialovaOVM2020 2042 International Journal of Environmental Research and Public Health 2020 3 15 17 6 16ENV10: MetroRADON: Metrology for radon monitoring 1904 radon; radon chamber; radon source; low-level radon activity concentration https://www.mdpi.com/1660-4601/17/6/1904 EMPIR 2016: Environment MDPI AG 30 1660-4601 10.3390/ijerph17061904 NA E.Fialova P.P.S.Otahal J.Vosahlik E.Mazanova article ElGawharyvU2020 1450 Physical Review Research 2020 3 13 2 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 013308 Strong scattering, Born series, perturbation methods, inverse problems, optical metrology, Padé approximants EMPIR 2017: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.2.013308 NA T. A.van der Sijs O.El Gawhary H. P.Urbach article SalmiCVWVYKHS2020 1354 Journal of Vacuum Science & Technology A 2020 3 38 2 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 022401 Spatial Atomic Layer Deposition, aluminum oxide, surface passivation, light soaking, damp heat EMPIR 2016: Energy American Vacuum Society 30 0734-2101, 1520-8559 10.1116/1.5133896 NA I.T.S.Heikkinen G. Koutsourakis S.Virtanen M.Yli-Koski S.Wood V.Vähänissi E.Salmi F.A.Castro H.Savin article LanevskiMVHKMAKI2020 1876 Measurement Science and Technology 2020 3 31 5 16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials 054010 reflectance, Monte-Carlo, reflective insulators, foil, curved surface, reference sample,additive manufacturing EMPIR 2016: Pre-Co-Normative IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab68bf NA D.Lanevski F.Manoocheri A.Vaskuri J.Hameury R.Kersting C.Monte A.Adibekyan E.Kononogova E.Ikonen article TangSLKNBMSCKMKBNMKKSSDPvM2020 1473 Nature Reviews Cardiology 2020 2 24 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion cardiac imaging, myocardial ischaemia EMPIR 2015: Health Springer Science and Business Media LLC 30 1759-5002, 1759-5010 10.1038/s41569-020-0341-8 NA M.Dewey M.Siebes M.Kachelrieß K.F.Kofoed P.Maurovich-Horvat K.Nikolaou W.Bai A.Kofler R.Manka S.Kozerke A.Chiribiri T.Schaeffter F.Michallek F.Bengel S.Nekolla P.Knaapen M.Lubberink R.Senior M-X.Tang J.J.Piek T.van de Hoef J.Martens L.Schreiber article PeralesMHV2020 1725 Coatings 2020 2 20 10 316 16NRM08: BiRD: Bidirectional reflectance definitions 1-10 special-effect pigments, graininess, psychophysical experiment, visual perception EMPIR 2016: Pre-Co-Normative MDPI

Basel (Switzerland)

30 2079-6412 10.3390/coatings10040316 NA E.Perales B.Micó-Vicent K.Huraibat V.Viqueira article BiaekVGAGFU2020 1904 Journal of Atmospheric and Oceanic Technology 2020 2 37 2 16ENV03: MetEOC-3: Further metrology for earth observation and climate 177-196 Monte Carlo, Ocean colour, Uncertainty evaluation, Radiometry EMPIR 2016: Environment American Meteorological Society 30 0739-0572, 1520-0426 10.1175/JTECH-D-19-0049.1 NA A.Białek V.Vellucci B.Gentil D.Antoine J.Gorroño N.Fox C.Underwood article BurnellLRvHBNSRMHBFZM2020 1425 Nature Communications 2020 1 22 11 1 17FUN08: TOPS: Metrology for topological spin structures skyrmion motion, spin-orbit torque EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-019-14232-9 NA K.Zeissler S.Finizio C.Barton A.J.Huxtable J.Massey J.Raabe A.V.Sadovnikov S.A.Nikitov R.Brearton T.Hesjedal G.van der Laan M.C.Rosamond E.H.Linfield G.Burnell C.H.Marrows article KendigVUMZ2020 1438 IEEE Transactions on Power Electronics 2020 Not yet pr Not yet pr 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 1-1 Thermoreflectance measurement , boost converter , gallium nitride, power transistor http://epubs.surrey.ac.uk/853825/ EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0885-8993, 1941-0107 10.1109/TPEL.2020.2964996 NA C.Matei J.Urbonas H.Votsi D.Kendig P.H.Aaen article TummonLKCCCAZSV2020 1472 Atmospheric Measurement Techniques 2020 13 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 1539–1550 pollen monitoring, digital holography, https://www.atmos-meas-tech.net/13/1539/2020/ EMPIR 2016: Environment Copernicus Publications 30 10.5194/amt-13-1539-2020 NA E.Sauvageat Y.Zeder K.Auderset B.Calpini B.Clot B.Crouzy T.Konzelmann G. Lieberherr F.Tummon K.Vasilatou article VilloneVMDSFD2020 1418 IEEE Transactions on Industrial Electronics 2020 ea ea 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 1-11 This paper derives low-complexity behavioral analytical models of the mutual inductance between the coupling coils of Wireless Power Transfer Systems (WPTSs), as functions of their reciprocal position. These models are extremely useful in the characterization and design optimization of WPTSs. Multi-Objective Genetic Programming (MOGP) algorithm is adopted to generate models ensuring an optimal trade-off between accuracy and complexity. The training and validation data sets needed for the generation of the models are here obtained by performing numerical full-3D electromagnetic simulations. The resulting behavioral models allow accurate and fast evaluation of the WPTS coils mutual inductance, over a wide range of misalignment conditions, enabling easier system analysis and optimization. https://ieeexplore.ieee.org/document/8994192 EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0278-0046, 1557-9948 10.1109/TIE.2019.2962432 NA G.Di Capua N.Femia K.Stoyka G.Di Mambro A.Maffucci S.Ventre F.Villone article WanslebenVWBHBK2020 1685 Journal of Analytical Atomic Spectrometry 2020 35 11 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 2679-2685 - https://arxiv.org/abs/2005.09509 EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 0267-9477, 1364-5544 10.1039/D0JA00244E NA M.Wansleben J.Vinson A.Wählisch K.Bzheumikhova P.Honicke B.Beckhoff Y.Kayser article HorenzTBNAGV2020 1716 Microscopy and Microanalysis 2020 26 S2 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements 2282 nanoparticles, size traceability, bi-modal distribution, silica, gold, electron microscoopy https://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/study-on-the-analysis-of-particle-size-distribution-for-bimodal-model-nanoparticles-by-electron-microscopy/B9157A370AC198219A734770694340F3 EMPIR 2017: Pre-Co-Normative Cambridge University Press

Cambridge

30 1435-8115 10.1017/S1431927620021054 NA C.Hörenz O.Tache D.Bartczak S.Nunez I.Abad Alvaro H.Goenaga-Infante V-D.Vasile-Dan Hodoroaba article LeviHVBH2019 1398 Optics Express 2019 12 27 26 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 37099 Non destructive measurement, Optical Lattice Clocks EMPIR 2017: Fundamental The Optical Society 30 1094-4087 10.1364/OE.27.037099 NA R.Hobson W.Bowden A.Vianello I.R.Hill P.Gill article HorenderSIDVA2019 1333 Metrologia 2019 11 27 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality aerosol, optical particle counter, calibration, clean room, counting efficiency EMPIR 2016: Environment IOP Publishing Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 μm and number concentrations up to 2 cm⁻³ 30 0026-1394, 1681-7575 10.1088/1681-7575/ab5c84 NA KonstantinaVasilatou KaiDirscherl KenjiroIida HiromuSakurai StefanHorender KevinAuderset article BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019 2340 International Journal of Environmental Research and Public Health 2019 11 21 16ENV10: MetroRADON: Metrology for radon monitoring radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability EMPIR 2016: Environment 30 10.3390/ijerph182212150 NA T.R.Beck A.Antohe F.Cardellini A.Cucoş E.Fialova C.Grossi K.Hening J.Jensen D.Kastratović M.Krivošík P.Lobner A.Luca F.J.Maringer N.Michielsen P.P.S.Otahal L.Quindos D.Rabago C.Sainz L.Szücs T.Teodorescu C.Tolinsson C.L.Tugulan T.Turtiainen A.Vargas J.Vosahlik G.Vukoslavovic H.Wiedner K.Wołoszczuk article KlauiJPDGVCC2019 1308 Communications Physics 2019 11 15 2 1 17FUN08: TOPS: Metrology for topological spin structures 145 Skyrmion, MFM https://www.nature.com/articles/s42005-019-0242-5#article-info EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2399-3650 10.1038/s42005-019-0242-5 NA A.Casiraghi H.Corte-León M.Vafaee F.Garcia-Sanchez G.Durin M.Pasquale G.Jakob M.Kläui article KlauiJPDGVCC20190 1308 Communications Physics 2019 11 15 2 1 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 145 Skyrmion, MFM https://www.nature.com/articles/s42005-019-0242-5#article-info EMPIR 2015: SI Broader Scope Springer Science and Business Media LLC 30 2399-3650 10.1038/s42005-019-0242-5 NA A.Casiraghi H.Corte-León M.Vafaee F.Garcia-Sanchez G.Durin M.Pasquale G.Jakob M.Kläui article KipperHLBPHLV2019 1406 Journal of Chromatography A 2019 11 in press in press 17FUN09: UnipHied: Realisation of a Unified pH Scale 460667 Eluent additivesHFIPHFTBPPNFTBRetention mechanisms https://www.sciencedirect.com/search/advanced?qs=Retention%20of%20acidic%20and%20basic&pub=Journal%20of%20Chromatography%20A&cid=271409&volumes=0&lastSelectedFacet=volumes EMPIR 2017: Fundamental Elsevier BV 30 0021-9673 10.1016/j.chroma.2019.460667 NA R.Veigure K.Lossmann M.Hecht E.Parman R.Born I.Leito K.Herodes K.Kipper proceedings CucciaSBLvAMCVSBPCT2019 1781 19th International Congress of Metrology (CIM2019) 2019 9 23 16ENG05: Biomethane: Metrology for biomethane biomethane, terpenes, amines, ammonia EnG EMPIR 2016: Energy EDP Sciences Paris 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201906001 NA L.Cuccia B.Sanz D.Ballestas Castro J.Li A.M.H.van der Veen E.Amico di Meane S.Moreno L.P.Culleton D.Vorin C.Senné F.Bougueroua L.Pyrée Y.Courtois C.Tastard proceedings PersijndMvL2019 1782 19th International Congress of Metrology (CIM2019) 2019 9 23 16ENG05: Biomethane: Metrology for biomethane biomethane, siloxanes, halogenated hydrocarbons, hydrogen chloride, hydrogen fluoride, conformity assessment EnG EMPIR 2016: Energy EDP Sciences Paris 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201906002 NA S.Persijn I.de Krom H.Meuzelaar A.M.H.van der Veen J.Li article KokHvvR2019 1380 2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS) 2019 9 Not Applic Not Applic 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters 6 Electromagnetic compatibility , static meters , interference , accuracy , testing , household appliances SEG https://zenodo.org/record/3582391#.XiG1P3u7KUl EMPIR 2017: Pre-Co-Normative IEEE 30 10.1109/AMPS.2019.8897771 NA R.van Leeuwen H.van den Brom D.Hoogenboom G.Kok G.Rietveld article RietveldKvWB2019 1377 2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE 2019 9 Not Applic Not Applic 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters 6 Power Quality Electricity Meters Short Time Fourier Transform Wavelet Transform Multiresolution Signal Decomposition Wavelets Smart Meters https://zenodo.org/record/3582153#.XiGzUXu7KUm EMPIR 2017: Pre-Co-Normative IEEE 30 10.1109/EMCEurope.2019.8872120 NA F.Barakou P.S.Wright H.E.van den Brom G.J.PKok G.Rietveld article vanLeeuwenHMvR2019 1378 2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE 2019 9 Not Applic Not Applic 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters 6 Static meters, energy measurement, standards, Electromagnetic Compatibility, EMC immunity testing, electricity meters. SEG https://zenodo.org/record/3580444#.XiG0OHu7KUk EMPIR 2017: Pre-Co-Normative IEEE 30 10.1109/EMCEurope.2019.8872130 NA H.E.van den Brom Z.Marais D.Hoogenboom R.van Leeuwen G.Rietveld article HoogenboomvRvMR2019 1379 2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE 2019 9 Not Applic Not Applic 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters 6 static energy meter; metering error; electromagnetic interference; accuracy; impedance; phase firing angle. SEG https://zenodo.org/record/3580436#.XiG00Xu7KUl EMPIR 2017: Pre-Co-Normative IEEE 30 10.1109/EMCEurope.2019.8872006 NA Z.Marais H.E.van den Brom G.Rietveld R.van Leeuwen D.Hoogenboom J.Rens proceedings CastroVWKHS2019 1202 AIP Conference Proceedings 2019 8 27 2147 1 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 050003 Aluminium oxide, surface passivation, damp heat exposure, atomic layer deposition, degradation https://aip.scitation.org/doi/pdf/10.1063/1.5123852?class=pdf EMPIR 2016: Energy AIP Publishing Leuven, Belgium SiliconPV 2019, THE 9TH INTERNATIONAL CONFERENCE ON CRYSTALLINE SILICON PHOTOVOLTAICS 08-04-2019 to 10-04-2019 30 978-0-7354-1892-9 1551-7616 10.1063/1.5123852 NA I.T.S.Heikkinen G. Koutsourakis S.Wood V.Vähänissi F.A.Castro H.Savin proceedings ViniciusdLYHHFL2019 1187 21st International Symposium on High Voltage Engineering 2019 8 26 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients puncture test, measurement EMPIR 2015: Pre-Co-Normative Budapest, Hungary 21st International Symposium on High Voltage Engineering 26-08-2019 to 30-08-2019 30 10.5281/zenodo.3243452 NA J.Hällström J.Havunen W.Yan Y.Li M.Vinicius O.Filho M.Laiho proceedings VentreMDBCFPPRSTBASSGHBZFDKL2019 1200 2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE) 2019 8 19 Electrical 2019 AEIT 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 6 pages Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety SEG http://arxiv.org/abs/1908.11108 EMPIR 2016: Energy IEEE Turin (Italy) 2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE) 02-07-2019 to 04-07-2019 30 978-8-8872-3743-6 0018-9219 10.23919/EETA.2019.8804498 NA M.Zucca O.Bottauscio S.Harmon R.Guilizzoni F.Schilling M.Schmidt P.Ankarson T.Bergsten K.Tammi P.Sainio J.B.Romero E.L.Puyal L.Pichon F.Freschi V.Cirimele P.Bauer J.Dong A.Maffucci S.Ventre N.Femia G.Di Capua N.Kuster I.Liorni article ChouhaniFiPBJVH2019 2041 Sensors 2019 8 19 15 16ENV01: MercOx: Metrology for oxidised mercury 3432 Nanostructure Knitting based Passive Sampler , Hg2+, Water EMPIR 2016: Environment MDPI AG 30 1424-8220 10.3390/s19153432 NA R.S.Chouhan G.Žitko V.Fajon I.Živković M.Pavlin S.Berisha I.Jerman A.Vesel M.Horvat article CinelliNViePG2019 1216 Journal of Environmental Radioactivity 2019 8 204 16ENV10: MetroRADON: Metrology for radon monitoring 163-174 metroRADON, indoor radon surveys, representativeness EMPIR 2016: Environment Elsevier BV 30 0265-931X 10.1016/j.jenvrad.2019.04.010 NA G.Pantelić I.Čeliković M.Živanović I.Vukanac J.K.Nikolić G.Cinelli V.Gruber article MurugandBvAtH2019 1816 International Journal of Hydrogen Energy 2019 7 44 35 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 19326-19333 Hydrogen; Fuel cell; Vehicles; ISO 14687; Metrology; Measurement; Flow metering; Quality control EnG EMPIR 2016: Energy Elsevier BV 30 0360-3199 10.1016/j.ijhydene.2019.03.190 NA A.Murugan M.de Huu T.Bacquart J.van Wijk K.Arrhenius I.te Ronde D.Hemfrey article VasilatouAH2019_2 1220 Review of Scientific Instruments 2019 7 90 7 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 075111 optical particle counters, aerosol instrumentation, aerosol generation setup, turbulent flow tube, particle homogenization, isokinetic sampling ports, particle counter, Stable and reproducible aerosols, polystyrene latex particles https://aip.scitation.org/doi/10.1063/1.5095853 EMPIR 2016: Environment AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.5095853 NA S.Horender K.Auderset K.Vasilatou proceedings HoffmannVQZB2019 1610 2019 IEEE 19th International Conference on Nanotechnology (IEEE-NANO) 2019 7 2019 - 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 1-4 calibration, doping profiles, inductors, scanning probe microscopy, silicon compounds https://zenodo.org/record/4275929 EMPIR 2016: Energy IEEE Macao IEEE Nano 22-07-2019 to 26-07-2019 30 Electronic ISBN: 978-1-7281-28 Electronic ISSN: 1944-9380 Pri NA https://zenodo.org/record/4275929 J.Hoffmann D.Vasyukov T. L.Quang F.Ziade A.Buchter article HibberdMOCORMOPVHC2019 1159 Genome Medicine 2019 6 24 11 1 15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance 41 whole genome sequencing, drug resistance, tuberculosis https://genomemedicine.biomedcentral.com/articles/10.1186/s13073-019-0650-x EMPIR 2015: Health Springer Science and Business Media LLC 30 1756-994X 10.1186/s13073-019-0650-x NA J.E.Phelan D.M.O’Sullivan D.Machado J.Ramos Y.E.A.Oppong S.Campino J.O’Grady R.McNerney M.L.Hibberd M.Viveiros J.F.Huggett T.G.Clark article IacomussiVR2019 1277 PROCEEDINGS OF the 29th Quadrennial Session of the CIE 2019 6 24 16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting Smart lighting, Road lighting, ILMD detector, Pedestrian safety, Systemic Design, Design by Components, Design Network, SURFACE, EMPIR EMPIR 2016: Pre-Co-Normative International Commission on Illumination, CIE 30 10.25039/x46.2019.PO192 NA Fab.Valpreda P.Iacomussi G.Rossi article VernyGM2019 1274 Proceedings of the 29th Quadrennial Session of the CIE 2019 6 24 16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting Road photometry, Adaptative road lighting, Real-site experiment, Time evolution, Obtrusive ligh, 16NRM02 EMPIR 2016: Pre-Co-Normative International Commission on Illumination, CIE 30 10.25039/x46.2019.OP72 NA V.Muzet F.GREFFIER P.Verny article vandenBromHHBKWI2019 1154 IEEE Transactions on Instrumentation and Measurement 2019 6 68 6 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 2066-2071 Josephson arbitrary waveform synthesizer, Josephson arrays, measurement, metrology, optoelectronics, voltage measurement EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2018.2877562 NA J.Ireland J.Williams O.Kieler R.Behr E.Houtzager R.Hornecker H.E.van den Brom article WolthausRLdvvW2019 1144 Medical Physics 2019 5 27 15HLT08: MRgRT: Metrology for MR guided radiotherapy Reference dosimetry, MRgRT, ionisation chamber EMPIR 2015: Health Wiley 30 0094-2405, 2473-4209 10.1002/mp.13623 NA S.J.Woodings B.van Asselen T.L.van Soest L.A.de Prez J.J.WLagendijk B.WRaaymakers J.W.HWolthaus article GardiniVPC2019 1165 Biomedical Imaging and Sensing Conference 2019 4 21 11140 2019 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 170-174 Quantitative imaging of efflux pumps in planktonic and biofilm-associated bacteria throughsingle-molecule localization microscopy https://www.spiedigitallibrary.org/conference-proceedings-of-spie/11140/2535451/Biomedical-Imaging-and-Sensing-Conference/10.1117/12.2535451.full EMPIR 2015: Health SPIE 30 0277-786X 10.1117/12.2535451 NA L.Gardini T.Vignolini F.S.Pavone M.Capitanio article MartinezVerduVVBP2019 1014 Journal of Modern Optics 2019 4 67 1 16NRM08: BiRD: Bidirectional reflectance definitions 1-10 graininess, special-effect pigments, multidimensional scaling algorithm, psychophysical experiment https://www.tandfonline.com/doi/full/10.1080/09500340.2019.1589006 EMPIR 2016: Pre-Co-Normative Taylor & Francis 30 1362-3044 10.1080/09500340.2019.1589006 NA E.Perales F.J.Burgos M.Vilaseca V.Viqueira F.M.Martínez-Verdú article RaaymakersJWvdWd2019 1046 Physics in Medicine and Biology 2019 4 15HLT08: MRgRT: Metrology for MR guided radiotherapy absorbed dose, MRgRT, kB, kQ, magnetic field https://iopscience.iop.org/article/10.1088/1361-6560/ab1511/pdf EMPIR 2015: Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ab1511 NA L.A.de Prez S.J.Woodings J.A.de Pooter B.van Asselen J.W.H.Wolthaus B.J.Jansen B.W.Raaymakers article KiselevDMFVPABBLXBHD2019 1024 Sensors 2019 2019 3 22 19(6) 1410 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements cantilever microprobe; high-speed; contact resonance; tip wear; piezo-resistive; mechanical damping; tip-testing standard https://www.mdpi.com/1424-8220/19/6/1410 EMPIR 2017: Industry MDPI AG

Basel

30 10.3390/s19061410 NA U.Brand M.XU L.Doering J.Langfahl-Klabes H.Behle S.Bütefisch T.Ahbe E.Peiner S.Völlmeke T.Frank B.Mickan I.Kiselev M.Hauptmannl M.Drexel article vandenBromvv2019 1458 IEEE Transactions on Instrumentation and Measurement 2019 3 68 6 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems 2084-2090 Current measurement, current sensors, current transducers, measurement standards, measurement techniques, measurement uncertainty, precision measurements. SEG https://zenodo.org/record/3265674#.Xnj0qYj7Q2w EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2019.2898014 NA H.van den Brom H.E.van den Brom R.van Leeuwen article GramegnaRPARVDG2019 1006 Scientific Reports 2019 2 28 9 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 1-9 quantum technologies EMPIR 2017: Fundamental Springer Nature 30 2045-2322 10.1038/s41598-019-39334-8 NA S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.Ruo Berchera I.P.Degiovanni M.Genovese article GramegnaRPARVDG20190 1006 Scientific Reports 2019 2 28 9 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1-9 quantum technologies EMPIR 2017: Fundamental Springer Nature 30 2045-2322 10.1038/s41598-019-39334-8 NA S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.Ruo Berchera I.P.Degiovanni M.Genovese article GramegnaRPARVDG20191 1006 Scientific Reports 2019 2 28 9 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 1-9 quantum technologies EMPIR 2014: Industry Springer Nature 30 2045-2322 10.1038/s41598-019-39334-8 NA S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.Ruo Berchera I.P.Degiovanni M.Genovese article RaaymakersWHMv2019 1048 Physics in Medicine and Biology 2019 2 26 15HLT08: MRgRT: Metrology for MR guided radiotherapy out-of-field dose, MRgRT EMPIR 2015: Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ab0aa0 NA V.N.Malkov S.L.Hackett J.W.H.Wolthaus B.W.Raaymakers B.van Asselen article WolthausRvHM2019 1142 Medical Physics 2019 2 14 46 3 15HLT08: MRgRT: Metrology for MR guided radiotherapy 1467-1477 MRgRT, Monte Carlo, dosimetry, magnetic field https://aapm.onlinelibrary.wiley.com/doi/full/10.1002/mp.13392 EMPIR 2015: Health Wiley 30 0094-2405 10.1002/mp.13392 NA V.N.Malkov S.L.Hackett B.van Asselen B.W.Raaymakers Jochem W. H.Wolthaus article LazzeriniDGVKYB2019 1074 Measurement Science and Technology 2019 2 30 3 15SIB09: 3DNano: Traceable three-dimensional nanometrology 035002 multi-axis positioning stages, traceability, nanopositioning, dimensional metrology EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aafd03 NA AndrewYacoot PetrKlapetek MiroslavValtr PetrGrolich HerveDongmo Giovanni MLazzerini AngusBridges article KokvvWWJddR2019 1045 Physics in Medicine & Biology 2019 1 29 64 3 15HLT08: MRgRT: Metrology for MR guided radiotherapy 035013 dosimetry, MRgRT, primary standard, magnetic field, MRI-linac, calorimetry https://iopscience.iop.org/article/10.1088/1361-6560/aaf975 EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aaf975 NA L.de Prez J.de Pooter B.Jansen S.Woodings J.Wolthaus B.van Asselen T.van Soest J.Kok B.Raaymakers proceedings Horneckervv2019 1147 2018 IEEE International Conference on Electrical Systems for Aircraft, Railway, Ship Propulsion and Road Vehicles & International Transportation Electrification Conference (ESARS-ITEC) 2019 1 14 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems current sensor, current measurement function, energy measurement function, railway application SEG EMPIR 2016: Energy IEEE Nottingham, UK, Conference on Electrical Systems for Aircraft, Railway, Ship Propulsion and Road Vehicles (ESARS) & International Transportation Electrification Conference (ITEC) 07-11-2018 to 09-11-2018 30 10.5281/zenodo.3265659 NA R.Hornecker R.van Leeuwen H.E.van den Brom article PiacentiniGRAVVMDG2019 1005 Nature Communications 2019 1 14 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 1-7 quantum entanglement, pseudo-density operators, https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/ EMPIR 2017: Fundamental Springer Nature 30 2041-1723 10.1038/s41467-018-08100-1 NA C.Marletto V.Vedral S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.P.Degiovanni M.Genovese article PiacentiniGRAVVMDG20190 1005 Nature Communications 2019 1 14 10 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1-7 quantum entanglement, pseudo-density operators, https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/ EMPIR 2017: Fundamental Springer Nature 30 2041-1723 10.1038/s41467-018-08100-1 NA C.Marletto V.Vedral S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.P.Degiovanni M.Genovese proceedings LalereGPV2019 2096 19th International Congress of Metrology (CIM2019) 2019 16RPT02: ALCOREF: Certified forensic alcohol reference materials road safety, breath analyser, ethanol in water solution, metrological European infrastructure, certified reference material, traceability https://cim2019.com/home.html EMPIR 2016: Research Potential EDP Sciences Paris CIM 2019 24-09-2019 to 26-09-2019 30 10.1051/METROLOGY/201915002 NA B.Lalère F.Gantois R.Philipp S.Vaslin-Reimann article VavassoriASCGPRCC2019 1307 Nanoscale 2019 11 10 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 4478-4488 MFM https://pubs.rsc.org/en/content/articlelanding/2019/NR/C8NR07729K#!divAbstract EMPIR 2015: SI Broader Scope Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/C8NR07729K NA H.Corte-León H.Corte-León L A.Rodríguez M.Pancaldi C.Gatel D.Cox E.Snoeck V.Antonov P.Vavassori article HashadVVNS2019 1020 Metrologia 2019 56 015004 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range 1-10 primary pressure standard, effective area, rarefied gas dynamics, FPG and FRS characterization https://doi.org/10.1088/1681-7575/aaee18 EMPIR 2014: Industry IOP Publishing 30 1681-7575/19/015004+10$33.00 10.1088/1681-7575/aaee18 NA S.Naris N.Vasileiadis D.Valougeorgis A.S.Hashad W.Sabuga proceedings SpasovaBNOSCTHZSAV2019 1490 19th International Congress of Metrology (CIM2019) 2019 - 2019 18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance 5/18006 EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple EMPIR 2018: Research Potential EDP Sciences Paris, France 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201918006 NA N.Arifovic D.Sestan D.Zvizdić N.Hozic E.Turzó-András S.Čohodarević R.Strnad K.Opel D.Neagu C.Bordianu S.Spasova T.Vukičević proceedings SPINELLICTVDKWMDDD2019 1405 unavailable 2019 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 1032-1036 External beam radiotherapy, EBRT, HITU, Ultrasound, Hyperthermia http://publications.rwth-aachen.de/record/767416 EMPIR 2018: Health Deutsche Gesellschaft für Akustik Aachen, Germany 23rd International Congress on Acoustics : integrating 4th EAA Euroregio 09-09-2019 to 13-09-2019 30 978-3-939296-15-7 NA https://doi.org/10.18154/RWTH-CONV-238838 A.SPINELLI B.CACCIA G.TER HAAR G.VAN RHOON J.de Pooter B.Karaböce V.Wilkens P.MILORO G.Durando A.DENKOWA R.DIJKEMA proceedings PeinerXBVKF2018 1025 Proceedings 2018 11 21 2 13 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 889 contact resonance spectroscopy; layer analysis; piezoresistive; tactile cantilever;automatic gain control; phase-locked-loop https://www.mdpi.com/2504-3900/2/13/889 EMPIR 2017: Industry MDPI AG Graz, Austria Eurosensors 2018 09-09-2018 to 12-09-2018 30 2504-3900 10.3390/proceedings2130889 NA M.Fahrbach L.Krieg T.Voss M.Bertke J.Xu E.Peiner article VasilatouE2018 895 Aerosol Science and Technology 2018 11 15 16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols 1-16 soot, black carbon, miniCAST, aerosol https://www.tandfonline.com/doi/full/10.1080/02786826.2018.1536818 EMPIR 2016: Environment Informa UK Limited 30 0278-6826, 1521-7388 10.1080/02786826.2018.1536818 NA M.N.Ess K.Vasilatou article MartinezVerduCPVF2018 1008 Optics Express 2018 11 26 23 16NRM08: BiRD: Bidirectional reflectance definitions 30116 Graininess, texture effects, reflectance and traceability https://www.osapublishing.org/oe/fulltext.cfm?uri=oe-26-23-30116&id=400717 EMPIR 2016: Pre-Co-Normative The Optical Society 30 1094-4087 10.1364/OE.26.030116 NA A.Ferrero J.L. Velázquez E.Perales J.Campos F.M.Martínez Verdú proceedings DambrineRVMMDRH2018 1002 2018 48th European Microwave Conference (EuMC) 2018 11 14IND02: PlanarCal: Microwave measurements for planar circuits and components 25-28 S-parameters, microwave, uncertainty, on-wafer, https://hal.archives-ouvertes.fr/hal-02056825 EMPIR 2014: Industry IEEE Madrid EuMC 2018 23-09-2018 to 27-09-2018 30 10.23919/EuMC.2018.8541607 NA K.Daffé F.Mubarak V.Mascolo H.Votsi N.M.Ridler G.Dambrine I.Roch K.Haddadi article FarooqAMLPLVF2018 1028 Fuel 2018 11 232 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 423-430 Alternative fuels, combustion, kinetics, LNG, Shock tube, RCM EnG https://www.sciencedirect.com/science/article/pii/S0016236118308238 EMPIR 2016: Energy Elsevier BV 30 0016-2361 10.1016/j.fuel.2018.04.168 NA S.K.Vallabhuni A.D.Lele V.Patel A.Lucassen K.Moshammer M.AlAbbad A.Farooq R.X.Fernandes article VargasBCMPR2018 894 Remote Sensing 2018 10 30 10 11 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 1712 UAS, CZT, UAS software Architecture, radiological detection EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs10111712 NA P.Royo E.Pastor M.Macias R.Cuadrado C.Barrado A.Vargas article KuosmanenTHWV2018 Precision Engineering 2018 10 54 ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems 118-130 Monte-Carlo simulation, Phase uncertainty, Harmonic component uncertainty, Uncertainty evaluation, Bearing excitation, Odd and even harmonic components, Four-point method, Three-point method https://www.sciencedirect.com/science/article/pii/S0141635918302368 EMRP A169: Call 2013 Energy II Elsevier BV 30 0141-6359 10.1016/j.precisioneng.2018.05.008 NA P.Kuosmanen K.Tammi B.Hemming T.Widmaier R.Viitala article ChebenVMOHLSWH2018 873 Optics Letters 2018 9 21 43 19 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 4691 Subwavelength, anisotropy, silicon, waveguides https://riuma.uma.es/xmlui/handle/10630/16695 EMPIR 2014: Industry The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.43.004691 NA J.M.Luque-González A.Herrero-Bermello A.Ortega-Monux I.Molina-Fernandez A.V.Velasco P.Cheben J.H.Schmid S.Wang R.Halir article UrbachVG2018 953 Physical Review Letters 2018 9 21 121 12 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 123202-1 Angular Momentum of Light, Electromagnetism, Helmholtz Natural Modes, Spin-orbit coupling, Light propagation, transmission and absorption, Metrology, Optical vortices, Classical field theory EMPIR 2016: Energy American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.121.123202 NA O.E.Gawhary T.Van Mechelen H.P.Urbach article BurianovaVS2018 810 Journal of Instrumentation 2018 9 20 13 09 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy P09018-P09018 Medical phantom; radiology; ionizing radiation; 3D print; linear attenuation coefficient; Hounsfield unit http://mrtdosimetry-empir.eu/?page_id=1166 EMPIR 2015: Health IOP Publishing 30 1748-0221 10.1088/1748-0221/13/09/P09018 NA J.Solc T.Vrba L.Burianová article KuosmanenWV2018 Mechanical Systems and Signal Processing 2018 9 110 ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems 42-58 Rotor dynamics, Dynamic run-out, Low-order bearing waviness, Four-point method https://www.sciencedirect.com/science/article/pii/S0888327018301298 EMRP A169: Call 2013 Energy II Elsevier BV 30 0888-3270 10.1016/j.ymssp.2018.03.010 NA P.Kuosmanen T.Widmaier R.Viitala article VanhaeckeCL2018_2 971 Analytica Chimica Acta 2018 9 1025 15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease 69-79 MC-ICP-MS; Copper; Gallium; Isotope ratio; Interferences; Micro-samples https://www.sciencedirect.com/science/article/pii/S0003267018306147?via%3Dihub EMPIR 2015: Health Elsevier BV 30 0003-2670 10.1016/j.aca.2018.05.025 NA S.Lauwens M.Costas-Rodríguez F.Vanhaecke article LeuenbergerPHMVN2018 Applied Physics B 2018 8 30 124 9 ENV55: MetNH3: Metrology for ammonia in ambient air 189 Ammonia, adsorption, moisture EMRP A169: Call 2013 Environment II Springer Nature America, Inc 30 0946-2171, 1432-0649 10.1007/s00340-018-7054-2 NA D.Leuenberger S.Persijn L.Halonen M.Metsälä O.Vaittinen B.Niederhauser article BruchertseiferFCDPHVPLMM2018 Applied Radiation and Isotopes 2018 8 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity γ-ray intensities, 227Ac, 227Th, 223Ra, decay data, γ-ray spectrometry EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2018.08.023 NA F.Bruchertseifer A.Fazio P.Carconi P.Dryák S.Pierre M.Hult R.Van Ammel S.Pommé G.Lutter M.Marouli A.Morgenstern article GafvertVMDF2018 Journal of Environmental Radioactivity 2018 8 188 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 58-66 In-situ gamma spectrometry, Detector calibration, Software tool, Measurement uncertainty, Environmental radioactivity EMRP A169: Call 2013 Environment II Elsevier BV 30 0265-931X 10.1016/j.jenvrad.2017.10.011 NA T.Gäfvert T.Vidmar A.Mauring J.Drefvelin A.Fazio article LuisoLGGDV2018 990 Journal of Physics: Conference Series 2018 8 1065 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems 052019 Railroad transportation, Railroad, Characterization procedures, Current transducer, Dynamic characterization, Measurement system, Metrological characteristics, Power quality measurements, Railway applications, Real operating conditions SEG https://iopscience.iop.org/article/10.1088/1742-6596/1065/5/052019 EMPIR 2016: Energy IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1065/5/052019 NA A.Delle Femine D.Gallo D.Giordano C.Landi M.Luiso R.Visconte article OguzAytekinKMSISFSZSJoHBHPV2018 1086 Journal of Physics: Conference Series 2018 8 1065 15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement 122019 Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019 EMPIR 2015: Research Potential IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1065/12/122019 NA N.Hodzic S.Čohodarević N.Jandrić R.Strnad D.Zvizdić D.Sestan V.Fernicola D.Smorgon L.Iacomini S.Simic D.Mac Lochlainn N.Karaboce S.Oguz Aytekin J.Bojkovski D.Hudoklin O.Petrušova T.Vukičević article KuuskABVF2018 2453 IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing 2018 8 11 8 16ENV03: MetEOC-3: Further metrology for earth observation and climate 2925-2932 Optical fibre devices, Optical spectroscopy, stray light, laser measurement, Illumination beam geometry EMPIR 2016: Environment Institute of Electrical and Electronics Engineers (IEEE) 30 1939-1404, 2151-1535 10.1109/JSTARS.2018.2841772 NA J.Kuusk I.Ansko A.Bialek R.Vendt N.Fox article vanSchaikPBP2018 999 Metrologia 2018 7 13 55 4 14IND11: HIT: Metrology for humidity at high temperatures and transient conditions 597-608 calibration, high temperatures, relative humidity, sensors, speed of sound https://iopscience.iop.org/article/10.1088/1681-7575/aacecc/meta EMPIR 2014: Industry IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aacecc NA R.Bosma R.J.Pouw W.van Schaik A.Peruzzi thesis vanHove2018 1342 2018 7 12 16ENV08: IMPRESS 2: Metrology for air pollutant emissions uncertainty quantification, large-eddy simulation, OpenFOAM, pipe flow, S-type pitot tube, uncertainty propagation EMPIR 2016: Environment TU Delft Library

Delft

Delft University of Technology 30 NA https://doi.org/10.4233/uuid:f56ff5c1-8a9c-4b5c-b404-ab421b7ede59 A.van Hove article EllingsbergBAVLRWPS2018 1376 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 2018 7 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters. SEG https://zenodo.org/record/3587786#.XiGxp3u7KUn EMPIR 2017: Pre-Co-Normative IEEE 30 10.1109/CPEM.2018.8500945 NA P.S.Wright G.Rietveld F.Leferink H.E.van den Brom F.R.IAlonso J.P.Braun K.Ellingsberg M.Pous M.Svoboda article PonsVFC2018 901 Optics Express 2018 7 26 14 15SIB07: PhotoLED: Future photometry based on solid-state lighting products 18633 photometer, spectral, mismatch, error, quality index EMPIR 2015: SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.26.018633 NA A.Ferrero J.L. Velázquez A.Pons J.Campos article CampCV2018 Applied Radiation and Isotopes 2018 7 137 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 241-249 H*(10) calculation methods, LaBr3(Ce) detector, MetroERM EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2018.03.026 NA A.Camp N.Cornejo A.Vargas article IkonenGEVK2018 Atmospheric Measurement Techniques 2018 6 20 11 6 ENV59: atmoz: Traceability for atmospheric total column ozone 3595-3610 solar UV, spectral irradiance, total ozone column, systematic spectral deviations, spectral correlations, uncertainty https://doi.org/10.5194/amt-11-3595-2018 EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-11-3595-2018 NA E.Ikonen J.Gröbner L.Egli A.Vaskuri P.Kärhä article RaaymakersKvHWvW2018 951 Physics in Medicine & Biology 2018 6 11 63 12 15HLT08: MRgRT: Metrology for MR guided radiotherapy 125008 Dosimetry, MRgRT, Radiotherapy, magnetic fields http://iopscience.iop.org/article/10.1088/1361-6560/aac70e/meta EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aac70e NA B.van Asselen S.J.Woodings S.L.Hackett T.L.van Soest J.G.MKok B.WRaaymakers J.W.HWolthaus article CorrederaSPGdV2018 569 Sensors 2018 6 10 18 6 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 1895 fiber-optic sensors; fiber Bragg gratings interrogators; absolute calibration EMPIR 2014: Industry MDPI AG 30 1424-8220 10.3390/s18061895 NA J.de Miguel J.Galindo-Santos C.Pulido de Torres P.Salgado A.V.Velasco P.Corredera article WidmaierVRLEHKL2018 Measurement Science and Technology 2018 6 29 7 ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems 074012 CMM, verification, metrology http://iopscience.iop.org/article/10.1088/1361-6501/aabd2b EMRP A169: Call 2013 Energy II IOP Publishing 30 10.1088/1361-6501/aabd2b NA T.Widmaier R.Viitala A.Rantanen P.Laukkanen V.P.Esala B.Hemming P.Kuosmanen A.Lassila article vanSlagerenKFKPFKMPKBMP2018 898 Advanced Science 2018 5 11 5 7 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 1800257 Magnetic Anisotropy, Nanotechnology, Nano-scale traceable magnetic field measurements EMPIR 2015: SI Broader Scope Wiley 30 2198-3844 10.1002/advs.201800257 NA F.Moro M.A.Bhuiyan Z.R.Kudrynskyi R.Puttock O.Kazakova O.Makarovsky M.W.Fay C.Parmenter Z.D.Kovalyuk A.J.Fielding M.Kern J.van Slageren A.Patanè article VandervorstvAZFMMC2018 482 Journal of Vacuum Science & Technology B, Nanotechnology and Microelectronics: Materials, Processing, Measurement, and Phenomena 2018 5 36 3 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 03F130 accuracy, composition, Atom probe, GaN https://avs.scitation.org/doi/10.1116/1.5019693 EMPIR 2014: Industry American Vacuum Society 30 2166-2746, 2166-2754 10.1116/1.5019693 NA R.J.H.Morris R.Cuduvally D.Melkonyan C.Fleischmann M.Zhao L.Arnoldi P.van der Heide W.Vandervorst article GenoveseDBTVLGAP2018 532 Scientific Reports 2018 5 8 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies EMPIR 2014: Industry Springer Nature 30 2045-2322 10.1038/s41598-018-25156-7 NA F.Piacentini A.Avella M.Gramegna R.Lussana F.Villa A.Tosi G.Brida I.P.Degiovanni M.Genovese article GenoveseDBTVLGAP20180 532 Scientific Reports 2018 5 8 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies EMPIR 2017: Fundamental Springer Nature 30 2045-2322 10.1038/s41598-018-25156-7 NA F.Piacentini A.Avella M.Gramegna R.Lussana F.Villa A.Tosi G.Brida I.P.Degiovanni M.Genovese article MolinaFernandezHOVWGHV2018 570 IEEE Photonics Journal 2018 4 10 2 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 1-10 Mode-division multiplexing, mode-converter, broadband, sub-wavelength grating waveguides, silicon-on-insulator EMPIR 2014: Industry Institute of Electrical and Electronics Engineers (IEEE) 30 1943-0655 10.1109/JPHOT.2018.2819364 NA D.Gonzalez-Andrade J.G.Wanguemert-Perez A.Velasco A.V.Velasco A.Ortega-Monux A.Herrero-Bermello I.Molina-Fernandez R.Halir article VenceljPDCBGP2018 Applied Radiation and Isotopes 2018 4 134 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 439-445 Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements, Radon and thoron background, Radon progeny, Walk-in radon chamber EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.07.039 NA M.Vencelj D.Ponikvar P.De Felice F.Cardellini D.Brodnik D.Glavič-Cindro T.Petrovič article CalonicoPTVR2018 589 Review of Scientific Instruments 2018 3 89 3 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 033103 frequency metrology, optical fibre links http://arxiv.org/abs/1807.10818 EMPIR 2015: SI Broader Scope AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.5016514 NA B.Rauf M. C.Vélez López P.Thoumany M.Pizzocaro D.Calonico article PaleckiOMLLJIHHGDTPdTVM2018_2 International Journal of Climatology 2018 3 38 6 ENV58: MeteoMet2: Metrology for essential climate variables 2760-2774 climate, metrology, essential climate variables, climate change EMRP A169: Call 2013 Environment II Wiley 30 0899-8418 10.1002/joc.5458 NA M.Palecki T.Oakley A.Merlone J. H.Lawrimore D. H.Lister P. D.Jones N. B.Ingleby Z.Hausfather S.Harrigan B.Goodison H. J.Diamond P. W.Thorne T. C.Peterson M.de Podesta C.Tassone V.Venema G.Mana article CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018 812 Nature Physics 2018 2 12 14 5 SIB55: ITOC: International timescales with optical clocks 437-441 optical fiber, optical frequency transfer EMRP A169: Call 2011 SI Broader Scope Springer Nature 30 1745-2473, 1745-2481 10.1038/s41567-017-0042-3 NA G.A.Costanzo M.Zucco P.Barbieri A.Tampellini F.Bregolin B.Rauf M.Pizzocaro P.Thoumany H.S.Margolis M.Zampaolo A.Rolland F.N.Baynes L.Timmen H.Denker C.Voigt C.Lisdat S.Häfner U.Sterr S.Vogt S.Koller J.Grotti C.Clivati F.Levi D.Calonico article PeyresERHVPLMGDMC2018 Applied Radiation and Isotopes 2018 2 132 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 72-78 γ-ray spectrometry, 235U, 231Th, Decay data, γ-ray emission probabilities, NORM EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.10.049 NA V.Peyres R.Eykens S.Richter M.Hult R.Van Ammel S.Pommé G.Lutter M.Marouli E.García-Toraño P.Dryák M.Mazánová P.Carconi article HollandtMGRDv2018 Journal of Physics: Conference Series 2018 2 972 ENV53: MetEOC2: Metrology for earth observation and climate 012006 Traceability, radiometric standards EMRP A169: Call 2013 Environment II IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/972/1/012006 NA J.Hollandt C.Monte B.Gutschwager M.Reiniger P.Dekker S.van den Berg proceedings SaverioPavoneCCGV2018 849 Biophysical Journal 2018 2 114 3 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 14a Highly Inclined and Laminated Optical sheet (HILO) microscopy, dSTORM https://www.biophysics.org/Portals/0/EasyDNNnews/Uploads/2131/2018%20Program-WEB.pdf EMPIR 2015: Health Elsevier BV Moscone Center Biophysical Society 62nd Annual Meeting 17-02-2018 to 21-02-2018 30 0006-3495 10.1016/j.bpj.2017.11.121 NA T.Vignolini L.Gardini V.Curcio M.Capitanio F.Saverio Pavone article NovotnyDSKV2018 987 Journal of Instrumentation 2018 1 24 13 01 15SIB10: MetroBeta: Radionuclide beta spectra metrology P01021-P01021 Si(Li) detector, beta spectrometry, beta spectra, Monte Carlo simulations https://arxiv.org/abs/1904.01294 EMPIR 2015: SI Broader Scope IOP Publishing 30 1748-0221 10.1088/1748-0221/13/01/P01021 NA P.Novotny P.Dryák J.Solc P.Kovář Z.Vykydal article VermesseSLDBROGDDPDSGCP2018 Physica Medica 2018 1 45 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 106-116 Dose-area product, Beam quality, DAP ratio, Small photon beams EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2017.12.012 NA D.Vermesse L.Sommier M.Le Roy J.Daures J.M.Bordy B.Rapp A.Ostrowsky J.Gouriou S.Dufreneix F.Delaunay A.Petrucci V.De Coste L.Silvi A.S.Guerra C.Caporali M.Pimpinella article vandenBergCVL2017 Optics Express 2017 12 14 25 26 SIB60: Surveying: Metrology for long distance surveying 32570 Fabry-Perot, Interferometry, Metrology, Mode-locked lasers, Optical resonators, Laser range finder, Ultra fast lasers https://www.osapublishing.org/DirectPDFAccess/294E3804-A5DD-C864-BA58B8635F309FB1_379535/oe-25-26-32570.pdf?da=1&id=379535&seq=0&mobile=no EMRP A169: Call 2012 SI Broader scope (II) The Optical Society 30 1094-4087 10.1364/OE.25.032570 NA S.van den Berg O.Číp D.Voigt A.Lešundák article PivacPSDVFWKBHFDDB2017 544 physica status solidi (a) 2017 12 215 6 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 1700866 SIMS, APT, GISAXS, 3D nanostructures, di-block copolymers EMPIR 2014: Industry Wiley 30 1862-6300 10.1002/pssa.201700866 NA M.Dialameh F.Ferrarese Lupi P.Honicke Y.Kayser B.Beckhoff T.Weimann C.Fleischmann W.Vandervorst P.Dubček B.Pivac M.Perego G.Seguini N.De Leo L.Boarino article EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017 602 Physics in Medicine & Biology 2017 11 14 62 23 15HLT08: MRgRT: Metrology for MR guided radiotherapy L41-L50 MRgRT, Radiotherapy, MRI EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aa9517 NA B WRaaymakers I MJürgenliemk-Schulz G HBol MGlitzner A N T JKotte Bvan Asselen J C Jde Boer J JBluemink S LHackett M AMoerland S JWoodings J W HWolthaus H Mvan Zijp M E PPhilippens RTijssen J G MKok E Nde Groot-van Breugel IKiekebosch L T CMeijers C NNomden G GSikkes P A HDoornaert W S CEppinga NKasperts L G WKerkmeijer J H ATersteeg K JBrown BPais PWoodhead J J WLagendijk article SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017 Measurement Science and Technology 2017 11 13 ENV58: MeteoMet2: Metrology for essential climate variables Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta EMRP A169: Call 2013 Environment II IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa99fc NA L.Šindelárová D.Sestan J.Salminen H.Sairanen L.Rosso J.del Rio M.K.Rasmussen S.Oguz Aytekin M.de Podesta P.Pavlasek M.Nogueras Cervera J.Nielsen C.Musacchio P.Miao L.G.Lanza A.Kowal M.Kalemci D.Hudoklin R.Högström S.Hernandez de la Villa M.Heinonen D.Groselj A.Gonzalez Calvo E.Georgin T.Gardiner C.García Izquierdo A.Garcia-Benadí VFernicola V.Ebert J.Drnovsek M.Dobre R.Cuccaro G.Coppa M.Colli N.Chiodo A.Castrillo D.del Campo M.Brunet J.Bojkovski G.Beltramino S.A.Bell G.Beges F.Sanna A.Merlone D.Smorgon F.Sparasci R.Strnad M.Voldán R.J.Underwood G.Mana article vanderVeenGUTBG2017 Journal of Chemical Metrology 2017 11 11 2 ENG54: Biogas: Metrology for biogas 78-85 PAH; biogas; biomethane; thermal desorption; isotope dilution; GC-TOF-MS EnG http://www.acgpubs.org/JCM/2017/Volume%2011/Issue%201/11-JCM_2017-11-01.pdf EMRP A169: Call 2013 Energy II ACG Publications 30 1307-6183 10.25135/jcm.11.17.11.01 NA A.van der Veen A.C.Goren I.Un T.Tarhan G.Bilsel T.Gokcen article QuinceyVTSPMMHWBWWSN2017 956 Aerosol Science and Technology 2017 10 26 52 2 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 146-164 aerosol metrology , mobility particle size spectrometers , calibration, measurement uncertainties EMPIR 2016: Environment Informa UK Limited 30 0278-6826, 1521-7388 10.1080/02786826.2017.1387229 NA A.Wiedensohler A.Wiesner K.Weinhold W.Birmili M.Hermann M.Merkel T.Müller S.Pfeifer A.Schmidt T.Tuch F.Velarde P.Quincey S.Seeger A.Nowak article LestremauLKvBMBCBRYAB2017 Biomass and Bioenergy 2017 10 105 ENG54: Biogas: Metrology for biogas 127-135 BiogasCompositionImpuritiesVesselsSampling EnG http://www.sciencedirect.com/science/article/pii/S0961953417302118 EMRP A169: Call 2013 Energy II Elsevier BV 30 10.1016/j.biombioe.2017.06.025 NA F.Lestremau J.Li I.Krom A.M.H.van der Veen B.Brewer A.Murugan S.Bartlett L.Culleton O.Büker L.Rosell H.Yaghooby K.Arrhenius J.Beranek article WehmannLSTVASFNLZSHW2017 Journal of Crystal Growth 2017 10 476 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 90-98 Crystal morphology, Metalorganic vapor phase epitaxy, Gallium compounds, Nitrides, Light emitting diodes http://www.sciencedirect.com/science/article/pii/S0022024817305146 EMRP A169: Call 2013 Energy II Elsevier BV 30 0022-0248 10.1016/j.jcrysgro.2017.08.021 NA H-HWehmann H-JLugauer M.Straßburg A.Trampert T.Varghese A.Avramescu T.Schimpke S.Fündling L.Nicolai J.Ledig H.Zhou F.Steib J.Hartmann AWaag article FailleauHHPSRBZARGVSSKSPLG2017 Applied Radiation and Isotopes 2017 9 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities Decommissioning, Sample preparation, Metrology EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.08.032 NA G.Failleau B.Hay P.Holm K.Peräjärvi J.Sand B.Rogiers S.Boden D.Zapata-García D.Arnold B.Russell M.Garcia Miranda R.Van Ammel J.Solc J.Smoldasova P.Kovář J.Šuráň S.Plumeri Y.Laurent Beck T.Grisa article BogucarskaPdJASSSKSTv2017 Applied Radiation and Isotopes 2017 9 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities nuclear decommissioning, radioactive waste, free release, clearance level EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.09.043 NA T.Bogucarska B.Pedersen P.De Felice S.Jerome D.Arnold L.Skala J.Solc J.Smoldasova P.Kovář J.Šuráň F.Tzika R.Van Ammel article RotellaCMMVIDLNRSN2017 Spectrochimica Acta Part B: Atomic Spectroscopy 2017 9 135 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 22-28 Combined >XRR-GIXRF, Depth profiling, thin films, TCO EMRP A169: Call 2013 Energy II Elsevier BV 30 0584-8547 10.1016/j.sab.2017.06.011 NA H.Rotella B.Caby Y.Ménesguen Y.Mazel A.Valla D.Ingerle B.Detlefs M.-C.Lépy A.Novikova G.Rodriguez C.Streli E.Nolot article ZhaovH2017 1189 Measurement Science and Technology 2017 8 16 28 9 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 095004 AC Josephson voltage standard, impedance matching, simulation, error sources,uncertainty https://zenodo.org/record/3265687#.XWZRsuhKgdW EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa7aba NA D.Zhao H.E.van den Brom E.Houtzager article DegiovanniAPRLVTGBCVG2017 334 Nature Physics 2017 8 14 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 4 Protective Measurements, Weak Measurements https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf; EMPIR 2014: Industry Springer Nature 30 1745-2473, 1745-2481 10.1038/nphys4223 NA F.Piacentini A.Avella E.Rebufello R.Lussana F.Villa A.Tosi M.Gramegna G.Brida E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article MarouliVPL2017 Applied Radiation and Isotopes 2017 8 126 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 150-153 U-235, Th-231, Photon emission intensities, NORM EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2016.12.045 NA M.Marouli R.Van Ammel S.Pierre M.C.Lépy article VandervorstMAFDKBV2017 565 Ultramicroscopy 2017 8 179 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 100-107 Atom probe tomography, Tip shape, FinFET, Local magnification, Trajectory overlaps https://lirias2repo.kuleuven.be/rest/bitstreams/515063/retrieve EMPIR 2014: Industry Elsevier BV 30 0304-3991 10.1016/j.ultramic.2017.04.006 NA D.Melkonyan C.Fleischmann L.Arnoldi J.Demeulemeester A.Kumar J.Bogdanowicz F.Vurpillot W.Vandervorst article LodewyckTBEBV2017 400 New Journal of Physics 2017 8 19 8 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 083002 optical clock, frequency stability, optical lattice clock, non-destructive detection, spin squeezing http://iopscience.iop.org/1367-2630/19/8/083002 EMRP A169: Call 2012 Open excellence call IOP Publishing 30 1367-2630 10.1088/1367-2630/aa7c84 NA J.Lodewyck R.L.Targat S.Bilicki U.Eismann E.Bookjans G.Vallet article KazakovaVGPW2017 253 Ultramicroscopy 2017 8 179 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 41-46 MFM, Scanning probe microscopy, Magnetic probes https://pure.royalholloway.ac.uk/portal/files/28310834/For_ResearchGate_Switchable_bi_stable_ML_probes.pdf EMPIR 2015: SI Broader Scope Elsevier BV 30 0304-3991 10.1016/j.ultramic.2017.03.032 NA T.Wren R.Puttock B.Gribkov S.Vdovichev O.Kazakova article NeuVSMSRGCPK2017 581 Scientific Reports 2017 8 7 1 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 7224 Magnetic straz field, Magnetic force microscopy, multi-layered probe, Hall sensor. https://www.nature.com/articles/s41598-017-07327-0 EMPIR 2015: SI Broader Scope Springer Nature 30 2045-2322 10.1038/s41598-017-07327-0 NA V.Panchal H.Corte-León B.Gribkov L.A.Rodriguez E.Snoeck A.Manzin E.Simonetto S.Vock V.Neu O.Kazakova article KeightleyBPVPBGW2017 Applied Radiation and Isotopes 2017 8 126 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 219-224 Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2016.12.036 NA L.Keightley S.J.Bell D.Ponikvar M.Vencelj T.Petrovič D.Brodnik D.Glavič-Cindro S.Woods article MantynenVKMI2017 Metrologia 2017 7 18 54 4 ENV59: atmoz: Traceability for atmospheric total column ozone 524-534 uncertainty, color temperature, color coordinates, Monte Carlo, spectral irradiance http://iopscience.iop.org/article/10.1088/1681-7575/aa7b39/meta EMRP A169: Call 2013 Environment II IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa7b39 NA H.Mäntynen AVaskuri P.Kärhä N.Mikkonen E.Ikonen article GarciaToranoVPMCP2017 Applied Radiation and Isotopes 2017 7 125 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 196-202 Alpha spectrometry, 226Ra, Decay data, Alpha-particle emission probabilities EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.04.029 NA E.García-Toraño R.Van Ammel S.Pommé M.Marouli T.Crespo S.Pierre article SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017 477 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fibre, network, clock, time, dissemination, service https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE 30 10.1109/FCS.2017.8089004 NA P.Krehlik L.Śliwczyński J.Dostal J.Radil V.Smotlacha R.Velc J.Vojtech M.Campanella D.Calonico C.Clivati F.Levi O.Číp S.Rerucha R.Holzwarth M.Lessing F.Camargo B.Desruelle J.Lautier-Gaud E.L.English J.Kronjäger P.Whibberley P.E.Pottie R.Tavares P.Tuckey F.John M.Snajder J.Stefl P.Nogaś R.Urbaniak A.Binczewski W.Bogacki K.Turza G.Grosche H.Schnatz E.Camisard N.Quintin J.Diaz T.Garcia E.Ros A.Galardini A.Seeds Z.Yang A.Amy-Klein article HoutzagerBKv2017 IEEE Transactions on Instrumentation and Measurement 2017 6 66 6 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1391-1396 AC–DC difference, Josephson voltage standard, measurement standards, measurement techniques, voltagemeasurement. http://ieeexplore.ieee.org/document/7898429/ EMRP A169: Call 2012 SI Broader scope (II) Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2017.2662381 NA E.Houtzager S.Bauer O.F.O.Kieler H.E.van den Brom article HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017 141 Physical Review Letters 2017 6 118 22 15SIB05: OFTEN: Optical frequency transfer - a European network https://arxiv.org/abs/1703.04426 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.118.221102 NA P.Delva J.Lodewyck S.Bilicki E.Bookjans G.Vallet R.Le Targat P.-E.Pottie C.Guerlin F.Meynadier C.Le Poncin-Lafitte O.Lopez A.Amy-Klein W.-K.Lee N.Quintin C.Lisdat A.Al-Masoudi S.Dörscher C.Grebing G.Grosche A.Kuhl S.Raupach U.Sterr I. R.Hill R.Hobson W.Bowden J.Kronjäger G.Marra A.Rolland F. N.Baynes H. S.Margolis P.Gill article BoothGOVNNFDT2017 IEEE Transactions on Power Delivery 2017 6 32 3 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids 1605-1615 HVDC protection, multi-terminal direct current, modular multi-level converters, optical sensors. EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 0885-8977, 1937-4208 10.1109/TPWRD.2016.2645231 NA C.D.Booth N.Gordon P.Orr D.Vozikis P.Niewczas J.Nelson G.Fusiek A.Dysko D.Tzelepis article XuCJSCPVHSC2017 574 Optics Letters 2017 6 42 11 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 2239 temperature, silicon on insulator, microspectrometer https://digital.csic.es/handle/10261/164048 EMPIR 2014: Industry The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.42.002239 NA A.Herrero-Bermello A.V.Velasco H.Podmore P.Cheben J.H.Schmid S.Janz M.L.Calvo D.XXu A.Scott P.Corredera article JehlBKCVSHLBKC2017 369 IEEE Electron Device Letters 2017 4 38 4 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 414-417 Quantum dots, Quantum effect semiconductor devices, Quantization, Current control https://arxiv.org/abs/1612.09547 http://www.e-si-amp.eu/outputs/ EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0741-3106, 1558-0563 10.1109/LED.2017.2670680 NA P.Clapera J.Klochan R.Lavieville S.Barraud L.Hutin M.Sanquer M.Vinet A.Cinins G.Barinovs V.Kashcheyevs X.Jehl article CarmeleRBSSSGSSvTHKR2017 234 Nature Communications 2017 4 8 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 14870 Quantum dots, Quantum optics, Single photons and quantum effects . https://www.nature.com/articles/ncomms14870 EMPIR 2014: Industry Springer Nature 30 2041-1723 10.1038/ncomms14870 NA T.Heindel A.Thoma M.von Helversen M.Schmidt A.Schlehahn M.Gschrey P.Schnauber J. -H.Schulze A.Strittmatter J.Beyer S.Rodt A.Carmele A.Knorr S.Reitzenstein article VelascoVSVCSP2017 573 Optics Letters 2017 3 31 42 7 waveguides and applications 1440 Fourier transform, silicon on insulator, compressive sensing https://digital.csic.es/handle/10261/163371 EMPIR 2014: Industry The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.42.001440 NA H.Podmore A.Scott P.Cheben A.V.Velasco A.V.Velasco J.H.Schmid M.Vachon article GotzingerVPCLSMIBS2017 Metrologia 2017 3 21 54 2 EXL02: SIQUTE: Single-photon sources for quantum technologies 218-223 single photon sources, single photon metrology, silicon vacancy center, low optical flux detector, photon on demand EMRP A169: Call 2012 Open excellence call IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa5ba2 NA S.Götzinger A.Vaigu G.Porrovecchio X.L.Chu S.Lindner M.Smid A.Manninen E.Ikonen C.Becher V.Sandoghdar article MottonenVPTGKL2017 Advanced Electronic Materials 2017 3 3 6 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 1600227 proximity Josephson junction, microwave admittance http://onlinelibrary.wiley.com/doi/10.1002/aelm.201600227/abstract EMRP A169: Call 2012 Open excellence call Wiley-Blackwell 30 2199-160X 10.1002/aelm.201600227 NA M.Möttönen P.Virtanen M.Partanen K.Y.Tan J.Govenius R.Kokkoniemi R.E.Lake proceedings GrobnerVKEI2017 AIP Conference Proceedings 2017 2 22 1810 1 ENV59: atmoz: Traceability for atmospheric total column ozone 110005 Monte Carlo, TOC, Ozone, Uncertainty, Spectral irradiance http://aip.scitation.org/toc/apc/1810/1?size=all&expanded=1810 EMRP A169: Call 2013 Environment II American Institute of Physics The University of Auckland International Radiation Symposium 16-04-2016 to 22-04-2016 30 978-0-7354-1478-5 1551-7616 10.1063/1.4975567 NA J.Gröbner A.Vaskuri P.Kärhä L.Egli E.Ikonen article VilloingMGB2017 92 Physics in Medicine and Biology 2017 2 62 5 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy 1885-1904 Monte Carlo modelling, internal dosimetry, GATE, MCNPX, voxelized models EMPIR 2015: Health IOP Publishing

Bristol

30 0031-9155, 1361-6560 10.1088/1361-6560/62/5/1885 NA DVilloing SMarcatili M-PGarcia MBardiès article PavsiDBFVJSeHRKMAAM2017 2144 Analytical and Bioanalytical Chemistry 2017 1 26 409 10 HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms 2601-2614 Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials EMRP A169: Call 2011 Metrology for Health Springer Science and Business Media LLC 30 1618-2642, 1618-2650 10.1007/s00216-017-0206-0 NA J.Pavšič A.Devonshire A.Blejec C.A.Foy F.Van Heuverswyn G.M.Jones H.Schimmel J.Zel J.F.Huggett N.Redshaw M.Karczmarczyk E.Mozioglu S.Akyürek M.Akgöz M.Milavec proceedings PokatilovPNETLICDYNPVTC2017_2 1152 18th International Congress of Metrology 2017 15RPT04: TracePQM: Traceability routes for electrical power quality measurements 8 power quality; metrology; power; traceability; measurement EMPIR 2015: Research Potential EDP Sciences Paris 18th International Congress of Metrology 19-09-2017 to 21-09-2017 30 10.1051/metrology/201704001 NA V.Nováková Zachovalová A.Yovcheva J.Diaz de Aguilar R.Caballero Santos D.Ilić J.Lončarević B.Trinchera K.Ellingsberg H.Ndilimabaka A.Philominraj A.Pokatilov O.Power B.Voljc V.Tarasso H.Çaycı article VavassoriAMCNCPK2017 255 IEEE Transactions on Magnetics 2017 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 1-1 Probes, Magnetic domains, Magnetic resonance imaging, Magnetic field measurement, Perpendicular magnetic anisotropy, Saturation magnetization https://pure.royalholloway.ac.uk/portal/en/publications/vshaped-domain-wall-probes-for-calibrated-magnetic-force-microscopy(9c2d50b1-9b1a-4aae-9b39-ca8c1864daf3).html EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9464, 1941-0069 10.1109/TMAG.2017.2694324 NA R.Puttock H.Corte-León V.Neu D.Cox A.Manzin V.Antonov P.Vavassori O.Kazakova proceedings VenceljPGB2017 Proceedings of the eleventh symposium of the Croatian radiation protection association 2017 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 175-181 MetroERM, dose rate equivalent rate, radioactivity concentrations in air and ground EMRP A169: Call 2013 Environment II Osijek, Croatia 11th Symposium Of The Croatian Radiation Protection Association 05-04-2017 to 07-04-2017 30 1849 - 5060 NA M.Vencelj T.Petrovič D.Glavič - Cindro D.Brodnik article BojkovskiOKMSISFZSSJoHHPV2017 1095 18th International Congress of Metrology 2017 2017 18th 15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement 4/06006 Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html EMPIR 2015: Research Potential EDP Sciences 30 10.1051/metrology/201706006 NA N.Hodzic S.Čohodarević N.Jandrić R.Strnad D.Sestan D.Zvizdić V.Fernicola D.Smorgon L.Iacomini S.Simic D.Mac Lochlainn N.Karaboce S.Oguz Aytekin J.Bojkovski D.Hudoklin O.Petrušova T.Vukičević proceedings Resumen de la Contribuciones. XI Reunión Nacional de Óptica 2016 12 10 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 168 size pigment, sparkle, visual detection - EMRP A169: Call 2012 Metrology for Industry (II) Universidad de Salamanca

Salamanca

Salamanca, Spain XI Reunión Nacional de Óptica 01-09-2015 to 03-09-2015 112 978-84-608-4609-3 - 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. O.Gómez E.Perales E.Chorro V.Viqueira F.M.Martínez-Verdú A.Ferrero J.Campos proceedings Resúmenes de las contribuciones. XI Reunión Nacional de Óptica 2016 12 10 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 171 goniochromatism, AUDI2000 color difference formula, STRESS - EMRP A169: Call 2012 Metrology for Industry (II) Universidad de Salamanca

Salamnaca

Salamanca XI Reunión Nacional de Óptica 01/09/2015 to 03/09/2015 112 978-84-608-4609-3 - 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.Perales E.Chorro O.Gómez V.Viqueira F.M.Martínez-Verdú L.Gómez-Robledo M.Melgosa proceedings Resúmenes de las contribuciones. XI Reunión Nacional de Óptica 2016 12 10 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 170 lighting booths, goniochromatism, color rendering - EMRP A169: Call 2012 Metrology for Industry (II) Universidad de Salamanca

Salamanca

Salamanca, Spain XI Reunión Nacional de Óptica 01-09-2015 to 03-09-2015 112 978-84-608-4609-3 - 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.Perales E.Chorro V.Viqueira F.M.Martínez-Verdú techreport HultMSMLAVP2016 JRC Technical report 2016 12 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities Reference materials, Radiochemical analysis, standard sources http://publications.jrc.ec.europa.eu/repository/handle/JRC103355 EMRP A169: Call 2013 Environment II European commission Publication office

Luxemburg

30 978-92-79-63506-9 1831-9424 10.2789/949534 NA M.Hult G.Marissens H.Stroh M.Marouli G.Lutter T.Altzitzoglou R.Van Ammel S.Pommé article VandervorstDPFLTHVBTFCS2016 158 The Journal of Physical Chemistry C 2016 12 120 49 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 28074-28082 ToF-SIMS, GCIB, Ar cluster, quantification, depth profiling, organics, solar cells, polymer, fullerenes EMPIR 2014: Industry American Chemical Society (ACS)

CAS, a division of the American Chemical Society 2540 Olentangy River Road Columbus Ohio 43210 United States

30 1932-7447, 1932-7455 10.1021/acs.jpcc.6b09911 NA S.Surana T.Conard C.Fleischmann J.G.Tait J.P.Bastos E.Voroshazi R.Havelund M.Turbiez P.Louette A.Felten C.Poleunis A.Delcorte W.Vandervorst techreport LutterSV2016 JRC Technical reports 2016 11 18 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities Calibration, Decommissioning, reference standards http://publications.jrc.ec.europa.eu/repository/handle/JRC103167 EMRP A169: Call 2013 Environment II European commission Publication office 30 978-92-79-62200-7 1831-9424 10.2789/787831 NA G.Lutter K.Sobiech-Matura R.Van Ammel article Nature Photonics 2016 11 14 - SIB57: NEWSTAR: New primary standards and traceability for radiometry Imaging and sensing, Nanowires, Optical metrology, Optical sensors, X-rays http://www.nature.com/nphoton/journal/vaop/ncurrent/full/nphoton.2016.226.html EMRP A169: Call 2012 SI Broader scope (II) Nature

-

30 10.1038/nphoton.2016.226 1 No, EURAMET is never allowed to make the publication publicly available. M.A.Juntunen J.Heinonen V.Vähänissi P.Repo D.Valluru H.Savin article Journal of Luminescence 2016 11 1 179 November 2016 EXL02: SIQUTE: Single-photon sources for quantum technologies 59-63 Diamond; Color center; Defect; Ion implantation; Photoluminescence http://www.journals.elsevier.com/journal-of-luminescence EMRP A169: Call 2012 Open excellence call Elsevier

Amsterdam

30 0022-2313 10.1016/j.jlumin.2016.06.039 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-1 J.J. Forneris A.A. Tengattini S.S. Ditalia Tchernij F.F. Picollo A.A. Battiato P.P. Traina I.P.I.P. Degiovanni E.E. Moreva G.G. Brida V.V. Grilj N.N. Skukan M.M. Jakšić M.M. Genovese P.P. Olivero article YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016 321 The Journal of Physical Chemistry C 2016 10 27 120 42 14IND12: Innanopart: Metrology for innovative nanoparticles 24070-24079 VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory https://spiral.imperial.ac.uk/handle/10044/1/40824 EMPIR 2014: Industry American Chemical Society (ACS)

CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States

30 1932-7447, 1932-7455 10.1021/acs.jpcc.6b06713 NA N.A.Belsey D.Cant D.J.H.Cant C.Minelli J.R.Araujo B.Bock P.Brüner D.G.Castner G.Ceccone J.D.P.Counsell P.M.Dietrich M.H.Engelhard S.Fearn C.E.Galhardo H.Kalbe J.W.Kim L.Lartundo-Rojas H.S.Luftman T.S.Nunney J.Pseiner E.F.Smith V.Spampinato J.M.Sturm A.G.Thomas J.P.W.Treacy L.Veith M.Wagstaffe H.Wang M.Wang Y.C.Wang W.Werner L.Yang article VilllaLCDBGLAPTZG2016 231 Physical Review Letters 2016 10 20 117 17 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 170402 Weak Measurements, Optical tests of quantum theory, Weak Values https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.170402 EMPIR 2014: Industry American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.117.170402 NA F.Piacentini A.Avella M. P.Levi M.Gramegna G.Brida I. P.Degiovanni E.Cohen R.Lussana F.Villa A.Tosi F.Zappa M.Genovese article KhoramshahiRVKHHNN2016 Earth Resources and Environmental Remote Sensing/GIS Applications VII 2016 10 18 10005 ENV53: MetEOC2: Metrology for earth observation and climate Remote sensing, Unmanned aerial vehicles, Clouds, Radiative energy transfer, Modeling, RGB color model, Radiation, Hyperspectral imaging, LIDAR, Anisotropy http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2571414&resultClick=1 EMRP A169: Call 2013 Environment II SPIE 30 10.1117/12.2240936 NA E.Khoramshahi T.Rosnell N.Viljanen S.Kaasalainen T.Hakala E.Honkavaara O.Nevalainen R.Näsi article RietveldvJJNCAC2016 2016 17th International Conference on Harmonics and Quality of Power (ICHQP) 2016 10 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics Phasor measurement units, Power Quality, Power system harmonics, Impedance measurement, Harmonic impedance, Load modeling SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/ICHQP.2016.7783374 NA G.Rietveld H.E.van den Brom A.Jongepier W.Jin F.Ni V.Cuk M.Acanski J.F.G.Cobben article BrabanCEFBLPHTPMPVWvTNP2016 Measurement Science and Technology 2016 10 27 11 ENV55: MetNH3: Metrology for ammonia in ambient air 115012 ammonia in ambient air, traceability, reference gas standards, optical transfer standard, validation and testing infrastructure EMRP A169: Call 2013 Environment II IOP Publishing

Bristol, United Kingdom

30 0957-0233, 1361-6501 10.1088/0957-0233/27/11/115012 NA Christine FBraban NathanCassidy VolkerEbert ValerioFerracci DavidBalslev-Harder DaianaLeuenberger CélinePascale TuomasHieta CarloTiebe JariPeltola Nicholas AMartin StefanPersijn OlaviVaittinen KlausWirtz Jannekevan Wijk Marsailidh MTwigg BernhardNiederhauser AndreaPogány article DeLeoCVSMTFB2016 161 Nanoscale Research Letters 2016 9 29 11 436 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 1-10 Porous silicon, Optical lithography, 4-Nitrobenzenediazonium, grafting, Improved chemical resistance https://nanoscalereslett.springeropen.com/articles/10.1186/s11671-016-1654-8 EMPIR 2014: Industry SpringerOpen

London

30 1556-276X 10.1186/s11671-016-1654-8 NA M.V.Tiddia G.Mula E.Sechi A.Vacca E.Cara N.De Leo M.Fretto L.Boarino proceedings 2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 2016 9 28 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics 13-18 Smart meter; state estimation; distribution system; measurement uncertainty; data aggregation SEG http://ieeexplore.ieee.org/document/7602805/ EMRP A169: Call 2013 Energy II IEEE

Piscataway, NJ 08855-1331 USA

Aachen, Germany 2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 28-30 September 2016 30 978-1-5090-2373-8 10.1109/AMPS.2016.7602805 1 No, EURAMET is never allowed to make the publication publicly available. F.Ni P.H.Nguyen J.F.G.Cobben H.E.van den Brom D.Zhao article Journal of the Optical Society of America A 2016 9 14 33 10 IND52: XD Reflect: Multidimensional reflectometry for industry 1978-1988 BSDF, BRDF, BTDF, Diffraction, Radiometry, Scattering measurements. https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-33-10-1978 EMRP A169: Call 2012 Metrology for Industry (II) OSA

Washington, DC, USA

30 1084-7529 (print), 1520-8532 (online) 10.1364/JOSAA.33.001978 1 No, EURAMET is never allowed to make the publication publicly available. AFerrero BBernad JCampos EPerales J LVelázquez F MMartínez-Verdú article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, Free Field, Directivity http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) German Acoustical Society (Deutsche Gesellschaft für Akustik, DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. R.Arina K.Völkel article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, directivity, spectral shape http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Völkel V.Wittstock proceedings Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on 2016 8 11 1 1 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 Delta-sigma modulation, Josephson junctions, measurement, metrology, voltage measurement. http://ieeexplore.ieee.org/document/7540457/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

New York

Ottawa Conference on Precision Electromagnetic Measurements 2016, (CPEM 2016) 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540457 1 59 No, EURAMET is never allowed to make the publication publicly available. http://ieeexplore.ieee.org/document/7540457/ JIreland ACryer JMWilliams EHoutzager RHornecker HEvan den Brom article Applied Optics 2016 8 9 55 23 IND52: XD Reflect: Multidimensional reflectometry for industry 6458-6463 sparkle, detection, perception psychology, psycophysics, industrial inspection, https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-23-6458 EMRP A169: Call 2012 Metrology for Industry (II) Optical Society of America (OSA)

Washington, DC

30 2155-3165 10.1364/AO.55.006458 1 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. OGómez EPerales EChorro VViqueira FMMartínez-Verdú article SvecSSRPNMLKJGFFDMAHBTTVW2016_2 Applied Radiation and Isotopes 2016 8 114 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry 167-172 Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET EMRP A169: Call 2010 Industry Elsevier BV 30 0969-8043 10.1016/j.apradiso.2016.05.014 NA A.Svec J.Solc L.Silva M.Reis V.Peyres M.Nečemer H.Moser A.Luca S.Klemola A.Javornik E.García-Toraño L..Ferreux A.Fazio P.Dryák B.C.Marroyo D.Arnold M.Hult O.Burda F.Tzika Z.Tyminski B.Vodenik U.Wätjen article IEEE Transactions on Electromagnetic Compatibility 2016 8 Not known yet Not known yet IND60: EMC: Improved EMC test methods in industrial environments 1-8 radiated emissions; in-situ testing; reverberation chambers; http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=15 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, NJ

30 not known yet 1 59 No, EURAMET is never allowed to make the publication publicly available. R.A.Vogt-Ardatjew U.Lundgren S.F.Romero article IEEE Transactions on Electromagnetic Compatibility 2016 8 Submitted and accepted for publication in a future issue of this journal Not known yet IND60: EMC: Improved EMC test methods in industrial environments 1-9 Electromagnetic compatibility, electromagnetic coupling, electromagnetic fields, marine electrical equipment http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=16 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, NJ

30 not known yet 1 59 No, EURAMET is never allowed to make the publication publicly available. B.J.A.M.van Leersum C.C.J.van der Ven J.G.Bergsma F.J.K.Buesink F.B.J.Leferink article Energy Procedia 2016 8 92 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 341-346 Black silicon, Nano-texturing, Surface passivation, Lifetime, Atomic layer deposition, Al2O3, Solar cells http://www.sciencedirect.com/science/article/pii/S1876610216305203 EMRP A169: Call 2013 Energy II Elsevier 30 10.1016/j.egypro.2016.07.093 1 No, EURAMET is never allowed to make the publication publicly available. E.Calle P.Ortega G. .von Gastrow IMartin H.Savin R.Alcubilla article WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016 Atmospheric Chemistry and Physics Discussions 2016 7 20 ENV51: MeTra: Traceability for mercury measurements 1-33 mercury, wet deposition flux, EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1680-7375 10.5194/acp-2016-517 NA I.Wängberg C.Walters M.Vardè P.Spandow V.Somerset F.Sena M.R.Islas V.Obolkin J.Munthe T.Mkololo N.Mashyanov L.Martin O.Magand C.Labuschagne J.Kotnik M.Horvat K.Hansson U.Hageström B.Gawlik P.E.Garcia X.Fu X.B.Feng R.Ebinghaus A.Dommergue M.D.C.Diéguez S.Comero W.Cairns F.Arcega-Cabrera E.G.Brunke C.Barbante H.Angot F.D'Amore M.Bencardino N.Pirrone F.Sprovieri A.Weigelt X.Yang P.Fisicaro proceedings Proceedings CPEM 2016 2016 7 18 54 12 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 Power, signal windowing, sampling, noise, spectral components. http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540739 EMRP A169: Call 2012 SI Broader scope (II) IEEE

Unknown

Ottawa Conference on Precision Elexctromagnetic Measurements 10-07-2016 to 15-07-2016 30 0018-9456 0018-9456 10.1109/CPEM.2016.7540739 1 59 No, EURAMET is never allowed to make the publication publicly available. RadoLapuh BoštjanVoljč MatjažLindič proceedings Proceedings CPEM 2016 2016 7 18 54 12 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 Measurement, sampling, estimation algorithms, harmonic distortion, estimation error, uncertainty http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540596 EMRP A169: Call 2012 SI Broader scope (II) IEEE

Unknown

Ottawa Conference on Precision Elexctromagnetic Measurements 10-07-2016 to 15-07-2016 30 0018-9456 0018-9456 10.1109/CPEM.2016.7540596 1 59 No, EURAMET is never allowed to make the publication publicly available. RadoLapuh BoštjanVoljč MihaKokalj MatjažLindič ZoranSvetik proceedings Proceedings CPEM 2016 2016 7 18 54 12 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 Measurement, sampling, estimation algorithms, harmonic distortion, estimation error, uncertainty http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540770 EMRP A169: Call 2012 SI Broader scope (II) IEEE

Unknown

Ottawa Conference on Precision Elexctromagnetic Measurements 10-07-2016 to 15-07-2016 30 0018-9456 0018-9456 10.1109/CPEM.2016.7540770 1 59 No, EURAMET is never allowed to make the publication publicly available. RadoLapuh MartinŠira MatjažLindič BoštjanVoljč proceedings Proceedings CPEM 2016 2016 7 18 54 12 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 Measurement, sampling, quantization noise, 1/f noise, interferences, measurement uncertainty http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540597 EMRP A169: Call 2012 SI Broader scope (II) IEEE

Unknown

Ottawa Conference on Precision Elexctromagnetic Measurements 10-07-2016 to 15-07-2016 30 0018-9456 0018-9456 10.1109/CPEM.2016.7540597 1 59 No, EURAMET is never allowed to make the publication publicly available. RadoLapuh BoštjanVoljč MatjažLindič article Metrologia 2016 7 8 53 4 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 1123 atomic clocks, high precision spectrocopy, frequency ratios, optical lattice clocks http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1123/meta EMRP A169: Call 2012 Open excellence call IOP Publishing

Bristol, UK

30 0026-1394 10.1088/0026-1394/53/4/1123 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. JLodewyck SBilicki EBookjans J-LRobyr CShi GVallet RLe Targat DNicolodi YLe Coq JGuéna MAbgrall PRosenbusch SBize article vandenBromRWCB2016 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 2016 7 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality instrument transformers, smart grids, metrology, phasor measurement units, synchrophasors, power quality,impedance measurement SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/CPEM.2016.7540462 NA H. E.van den Brom G.Rietveld P. S.Wright G.Crotti J. P.Braun proceedings Microwave Measurement Conference (ARFTG), 2016 87th ARFTG 2016 6 30 N/A 14IND02: PlanarCal: Microwave measurements for planar circuits and components N/A Probes, Standards, Frequency measurement, Radio frequency, Calibration, Microwave measurement, https://hal.archives-ouvertes.fr/hal-02083251/document EMPIR 2014: Industry IEEE San Francisco CA USA Microwave Measurement Conference (ARFTG), 2016 87th ARFTG 27-05-2016 to 27-05-2016 30 978-1-5090-1308-1 10.1109/ARFTG.2016.7501967 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Daffé G.Dambrine F.von Kleist-Retzow K.Haddadi article Precision Engineering 2016 6 18 46 -- IND62: TIM: Traceable in-process dimensional measurement 323–338 New material standard, Reversal technique, Calibration, Geometric errors, Machine tools EMRP A169: Call 2012 Metrology for Industry (II) Elsevier Inc.

Elsevier Inc.

30 0141-6359 10.1016/j.precisioneng.2016.06.002 1 59,80 No, EURAMET is never allowed to make the publication publicly available. FBViprey HNNouira SLLavernhe CTTournier proceedings OliveiraNKRVNHHT2016 ISPRS - International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences 2016 6 17 XLI-B7 ENV53: MetEOC2: Metrology for earth observation and climate 77-82 Hyperspectral, Radiometry, Photogrammetry, Geometry, Matching, Uncertainty http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B7/77/2016/isprs-archives-XLI-B7-77-2016.pdf EMRP A169: Call 2013 Environment II Copernicus GmbH

Gottingen

Prague, Czech Republic XXIII ISPRS Congress 12-07-2016 to 19-07-2016 30 2194-9034 10.5194/isprsarchives-XLI-B7-77-2016 NA R.Oliveira R.Näsi E.Khoramshahi T.Rosnell N.Viljanen O.Nevalainen T.Hakala E.Honkavaara A.Tommaselli article SterrAKGHVL2016 Journal of Physics: Conference Series 2016 6 723 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 012020 time and frequency metrology, transportable optical lattice clock, chronometric geodesy http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012020/meta EMRP A169: Call 2012 Open excellence call IOP Publishing

Bristol

30 1742-6588, 1742-6596 10.1088/1742-6596/723/1/012020 NA U.Sterr A.Al-Masoudi S.Koller J.Grotti S.Häfner S.Vogt C.Lisdat proceedings N/A 2016 5 27 N/A N/A SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1-4 Nonlinear measurements, oscilloscope, sampling, analogue to digital conversion http://www.arftg.org/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway

San Francisco, CA, USA 87th ARFTG Microwave Measurement Conference 27-05-2016 30 978-1-5090-1308-1 N/A 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30 IEEE Catalog Number: CFP16ARF-ART D. A.Humphreys A.Raffo G.Bosi G.Vannini D.Schreurs K. N.Gebremicael K.Morris article MaturilliVVMM2016 Rendiconti Lincei 2016 5 17 27 S1 ENV58: MeteoMet2: Metrology for essential climate variables 243-249 Metrology, Ny-Ålesund, Arctic Climate, Calibration EMRP A169: Call 2013 Environment II Springer Nature 30 2037-4631, 1720-0776 10.1007/s12210-016-0531-9 NA MarionMaturilli VitoVitale AngeloViola AndreaMerlone ChiaraMusacchio article Advanced Functional Materials 2016 5 11 Volume 26 Issue 26 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems Pages 4704–4711 Spintronics, Perpendicular magnetic anisotropy, CoFeB thin films http://onlinelibrary.wiley.com/doi/10.1002/adfm.201505138/abstract EMRP A169: Call 2012 Open excellence call 30 10.1002/adfm.201505138 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.Vemulkar R.Mansell A.Fernández-Pacheco R.P.Cowburn article ZappaTVLLAPGBDG2016 232 Physical Review Letters 2016 5 116 18 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 180401 Quantum Foundations, Quantum Nonlocality, Weak Values, Weak Measurements EMPIR 2014: Industry American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.116.180401 NA F.Piacentini A.Avella M. P.Levi R.Lussana F.Villa A.Tosi F.Zappa M.Gramegna G.Brida I. P.Degiovanni M.Genovese proceedings Proceedings of SPIE 2016 4 29 9899 SIB60: Surveying: Metrology for long distance surveying 989906 Distance measurement, frequency combs, homodyne detection, intererometry EMRP A169: Call 2012 SI Broader scope (II) SPIE

Bellingham

Brussels, Belgium SPIE Photonics Europe 2016, Optical Sensing and Detection IV 04-04-2016 to 07-04-2016 30 1996-756X 10.1117/12.2227360 59 No, EURAMET is never allowed to make the publication publicly available. D.Voigt S.A.van den Berg A.Lešundák S.van Eldik N.Bhattacharya proceedings Proceedings of the third Joint International Symposium on Deformation Monitoring 2016 4 SIB60: Surveying: Metrology for long distance surveying Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf EMRP A169: Call 2012 SI Broader scope (II) Vienna, Austria Joint International Symposium on Deformation Monitoring March 30-April 1, 2016 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Pollinger A.Bauch J.Leute K.Meiners-Hagen J.Mildner J.Guillory J.-P.Wallerand J.Jokela U.Kallio H.Koivula S.Lahtinen M.Poutanen M.Astrua C.Francese M.Zucco L.Eusebio F.Marques C.Pires F.Saraiva O.Pelligrino T.Tomberg T.Hieta T.Fordell M.Merimaa V.Kupko P.Neyezhmakov S.Bergstrand S.A.van den Berg T.Kersten T.Krawinkel article Philosophical Transactions of the Royal Society A 2016 3 28 374 2064 SIB01: InK: Implementing the new kelvin 20150044 high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics http://rsta.royalsocietypublishing.org/content/374/2064/20150044 EMRP A169: Call 2011 SI Broader Scope The Royal Society

London

30 10.1098/rsta.2015.0044 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.RWooliams KAnhalt MBallico PBloembergen FBourson SBriaudeau JCampos M.GCox Ddel Campo WDong M.RDury VGavrilov IGrigoryeva M.LHernanz FJahan BKhlevnoy VKhromchenko D.HLowe XLu GMachin J.MMantilla M.JMartin H.CMcEvoy BRougie MSaldi S.G.RSalim NSasajima D.RTaubert A.D.WTodd RVan den Bossche article Microelectronic Engineering 2016 3 5 153 5 March 2016 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures pp 29-36 Nanoscale production; Lateral AFM calibration; Virtual standard; Traceability; Measurement uncertainty; Non-linearity EMRP A169: Call 2010 Industry Elsevier 30 10.1016/j.mee.2016.01.010 1 59 No, EURAMET is never allowed to make the publication publicly available. R.Koops M.van Veghel A.van de Nes article Applied Radiation and Isotopes 2016 3 109 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry 54-60 comparisons, proficiency tests, ζ–score, high resolution gamma-ray spectrometry, environmental samples, radioactivity, natural and artificial radionuclides, Co-60, Cs-137, K-40, Ra-226 http://www.sciencedirect.com/science/article/pii/S0969804315303687 EMRP A169: Call 2010 Industry Elsevier Ltd. 30 10.1016/j.apradiso.2015.12.025 1 59 No, EURAMET is never allowed to make the publication publicly available. D.Glavič-Cindro M.Korun M.Nečemer B.Vodenik B.Zorko article Philosophical Transactions of the Royal Society A 2016 2 22 374 2064 SIB01: InK: Implementing the new kelvin 20150054 noise, thermometry, PLTS-2000, SQUID, primary, uncertainty http://rsta.royalsocietypublishing.org/content/374/2064/20150054 EMRP A169: Call 2011 SI Broader Scope The Royal Society Publishing

London

30 1471-2962 10.1098/rsta.2015.0054 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-22 AShibahara OHahtela JEngert Hvan der Vliet L VLevitin ACasey C PLusher JSaunders DDrung ThSchurig article Journal of the CMSC [reproduced in Quality Digest] 2016 2 18 9 1 (Spring 2016) IND53: Large Volume: Large volume metrology in industry 6pp FSI, coordinate metrology, SI, traceable http://www.qualitydigest.com/inside/cmsc-article/021816-novel-coordinate-measurement-system-based-frequency-scanning# EMRP A169: Call 2012 Metrology for Industry (II) Coordinate Metrology Society

Weatherford

30 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.qualitydigest.com/inside/cmsc-article/021816-novel-coordinate-measurement-system-based-frequency-scanning# BHughes MCampbell DVeal article ChebenDKVNV2016 578 IEEE Photonics Technology Letters 2016 2 15 28 4 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 528-531 mid-IR, spectrometry, silicon photonics http://hdl.handle.net/10261/167745 https://dx.doi.org/10.5258/SOTON/383407 EMPIR 2014: Industry Institute of Electrical and Electronics Engineers (IEEE)

445 Hoes Lane Piscataway NJ 08855-1331 United States

30 1041-1135, 1941-0174 10.1109/LPT.2015.2496729 NA MilosNedeljkovic Aitor V.Velasco Aitor V.Velasco Ali Z.Khokhar AndreDelage PavelCheben article MonteyneVPRFEBE2016 Accreditation and Quality Assurance 2016 2 21 2 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 113-120 Homogeneity, Stability, Uncertainty, Whole water, Reference materials, PAHs, PBDEs, TBT, Water Framework Directive EMRP A169: Call 2010 Environment Springer Nature 30 0949-1775, 1432-0517 10.1007/s00769-015-1189-1 NA E.Monteyne G.Vanermen R.Philipp J.Richter I.Fettig S.Elordui-Zapatarietxe G.Boom H.Emteborg article VelazquezFCPH2016 Journal of Optics 2016 1 18 2 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 1-9 goniophotometry, light-emitting diodes, Zernike polynomials, photometry EMRP A169: Call 2013 Energy II IOP Publishing

Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom

30 2040-8978, 2040-8986 10.1088/2040-8978/18/2/025605 NA J LVelazquez AFerrero JCampos APons M LHernanz article vanderVeenBA2016 Analytica Chimica Acta 2016 1 902 ENG54: Biogas: Metrology for biogas 22-32 Sampling; Containers; Suitability; Biogas; Biomethane; Impurities; VOCs; Siloxanes EnG https://www.ncbi.nlm.nih.gov/pubmed/26703250 EMRP A169: Call 2013 Energy II Elsevier BV

New York

30 0003-2670 10.1016/j.aca.2015.10.039 NA A.M.H.van der Veen A.S.Brown K.Arrhenius article Coloration Technology 2016 131 4 IND52: XD Reflect: Multidimensional reflectometry for industry 303-309 gonio-apparent colours, sparkle, graininess, measurements http://onlinelibrary.wiley.com/doi/10.1111/cote.12157/citedby EMRP A169: Call 2012 Metrology for Industry (II) Society of Dyers and Colourists. John Wiley & Sons

New York

30 1478-4408 10.1111/cote.12157 1 59 No, EURAMET is never allowed to make the publication publicly available. E.Chorro E.Perales F.J.Burgos O.Gómez M.Vilaseca J.Pujol F.M.Martínez-Verdú proceedings CIE Proceeding 2016 IND52: XD Reflect: Multidimensional reflectometry for industry Goniofluorescence, fluorescence, photoluminescence, spectrophotometry EMRP A169: Call 2012 Metrology for Industry (II) International Comission on Illumination

Serrano 144

Manchester/UK 28th Session CIE June 28 - July 4, 2015 30 59 No, EURAMET is never allowed to make the publication publicly available. AFerrero BBernad J LVelazquez APons M LHernanz PJaanson F MMartinez-Verdu EChorro EPerales JCampos article Surface and Interface Analysis 2016 1 46 NEW01: TReND: Traceable characterisation of nanostructured devices 54-57 depth profiling, sputter yield, ion yield, matrix effect, OPV, P3HT, PCDTBT, PCBM http://onlinelibrary.wiley.com/doi/10.1002/sia.5621/abstract EMRP A169: Call 2011 Metrology for New Technologies Wiley Online Library

New Jersey NYC

30 0142-2421 10.1002/sia.5621 1 59 No option selected C.Fleischmann T.Conard R.Havelund A.Franquet C.Poleunis E.Voroshazi A.Delcorte W.Vandervorst article International Journal of Thermophysics 2016 - Special Issue Tempmeko 2016 SIB64: METefnet: Metrology for moisture in materials - Water content, metrological traceability, coulometric Karl Fischer titration, Evolved Water Vapour analysis, biopolymers - EMRP A169: Call 2012 SI Broader scope (II) Springer

Berlin

30 ISSN: 0195-928X 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Rolle G.Beltramino V.Fernicola M.Sega A.Verdoja article Journal of Analytical Atomic Spectrometry 2016 SIB09: ELEMENTS: Primary standards for challenging elements EMRP A169: Call 2011 SI Broader Scope The Royal Society of Chemistry

London

30 10.1039/c6ja00013d 1 59 No, EURAMET is never allowed to make the publication publicly available. JochenVogl Bj¨ornBrandt JanineNoordmann OlafRienitz DmitriyMalinovskiy article Energy & Environmental Science 2016 9 5 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 1818-1827 Thin films, solar cells, Cu(In,Ga)Se2, XRD, XRF, in-situ, planar defects, TEM EMRP A169: Call 2013 Energy II The Royal Society of Chemistry

London

30 1754-5692 10.1039/c6ee00402d 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-18 R.Mainz E.Simsek Sanli H.Stange D.Azulay S.Brunken D.Greiner S.Hajaj M. D.Heinemann C. A.Kaufmann M.Klaus Q. M.Ramasse H.Rodriguez-Alvarez A.Weber I.Balberg O.Millo P. A.van Aken D.Abou-Ras article IEEE Nuclear Science Symposium and Medical Imaging Conference 2016 (2013 NSS/MIC), Seoul, 2013 HLT11: MetroMRT: Metrology for molecular radiotherapy pp. 1-3. Index Terms—Nuclear Medicine, Monte Carlo Modelling, Gamma-Camera, Whole-Body Planar Imaging, Anthropomorphic Model. http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=6829150&isnumber=6829008 EMRP A169: Call 2011 Metrology for Health IEEE

Seoul

30 1082-3654 10.1109/NSSMIC.2013.6829150 1 59 No, EURAMET is never allowed to make the publication publicly available. MPGarcia DVilloing EMcKay LFerrer HDer Sarkissian MPoirot MBardiès article Proceedings of the 2015 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Taipei, Taiwan 2016 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 604-607 Reverberation Chamber, Stirrer Design, Stirrer Comparison EMRP A169: Call 2012 SI Broader scope (II) IEEE

Piscataway, NJ

30 2162-7673 10.1109/APEMC.2015.7175394 1 59 No, EURAMET is never allowed to make the publication publicly available. A.Ubin R.Vogt-Ardatjew F.Leferink M.Z.M.Jenu S.van de Beek article Proceedings of the Asia Pacific Symposium on EMC (APEMC), Tokio, 2014 2016 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 685-688 reverberation chamber, enclosed environment, extreme field strength, Q-factor, chamber loading http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=6997237&tag=1 EMRP A169: Call 2012 SI Broader scope (II) IEEE

Piscataway, N.J.

30 N.A. 1 59 No, EURAMET is never allowed to make the publication publicly available. INSPEC 14837809 R.A.Vogt-Ardatjew S.van de Beek F.B.J.Leferink article Proceedings of the 2014 International Symposium on EMC (EMC Europe) Gothenburg, Sweden 2016 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 332 - 336 reverberation chambers, reverberant environments, in-situ measurements, electric field strength, Q-factor http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=6930927 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, N.J.

30 2325-0356 10.1109/EMCEurope.2014.6930927 1 59 No, EURAMET is never allowed to make the publication publicly available. R.A.Vogt-Ardatjew S.van de Beek F.B.J.Leferink FritsBuesink article IEEE Electromagnetic Compatibility Magazine 2016 2016-3 or 4 N.A. IND60: EMC: Improved EMC test methods in industrial environments 1-12 Regions, Zoning, Current Boundary, Current Barrier, Electromagnetic Separation, http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=5962381 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, NJ

30 Not known yet 1 59 No, EURAMET is never allowed to make the publication publicly available. F.J.K.Buesink B.J.A.M.van Leersum F.B.J.Leferink article Proceedings of the 2016 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Shenzhen, China 2016 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 865-868 anechoic chamber, antenna, S-parameter, s-VSWR, reflection coefficient, time domain reflectometry http://ieeexplore.ieee.org/document/7522892/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

Piscataway, NJ

30 10.1109/APEMC.2016.7522892 1 59 No, EURAMET is never allowed to make the publication publicly available. D.Mandaris D.J.G.Moonen G.S.van de Beek F.J.K.Buesink F.B.J.Leferink article Journal of Chemical Thermodynamics 2016 101 1 ENG54: Biogas: Metrology for biogas 168-179 methane; helium; natural gas thermodynamic characterization; density; single-sinker densimeter; GERG-2008 equation of state EnG EMRP A169: Call 2013 Energy II Elsevier

Amsterdam

30 0021-9614 10.1016/j.jct.2016.05.024 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. R.Hernández-Gómez D.Tuma R.Villamañán C.R.Chamorro proceedings ERK 2015 2016 Volume A 2015 IND60: EMC: Improved EMC test methods in industrial environments 273-276 EMC, adapter, LISN http://www.ieee.si/erk/erk15.html EMRP A169: Call 2012 Metrology for Industry (II) 24th International Electrotechnical and Computer Science Conference ERK 2015

Portorož

Portorož 24th International Electrotechnical and Computer Science Conference ERK 2015 21-9-2015 to 23-9-2015 110 1581-4572 1 59 No, EURAMET is never allowed to make the publication publicly available. M.Kokalj B.Voljč B.Pinter M.Lindič Z.Svetik MihaKokalj article Journal of Geophysical Research: Atmospheres 2016 121 10 ENV58: MeteoMet2: Metrology for essential climate variables 5115–5137 diurnal temperature range, data set, reassessment http://onlinelibrary.wiley.com/doi/10.1002/2015JD024583/abstract EMRP A169: Call 2013 Environment II Wiley

Hoboken

30 2169-897X 10.1002/2015JD024583 1 79,59 No, EURAMET is never allowed to make the publication publicly available. P WThorne M JMenne C NWilliams J JRennie J HLawrimore R SVose T CPetersono IDurre RDavy IEsau A M GKlein-Tank AMerlone proceedings LiDHRVAR2016 80 IEEE XPlore 2016 14IND02: PlanarCal: Microwave measurements for planar circuits and components Standards, Calibration, Impedance, Nanoscale devices, Impedance measurement, Probes, Transmission line measurements, extreme impedance measurement, Calibration, on-wafer measurement, nano-scale, co-planar waveguide, RF nanotechnology http://epubs.surrey.ac.uk/813783/1/Votsi_88th_ARFTG_Paper_Summary%20%28002%29.pdf EMPIR 2014: Industry IEEE

USA & Canada

Austin, TX, USA Microwave Measurement Conference (ARFTG) 08-12-2016 to 09-12-2016 30 10.1109/ARFTG.2016.7839719 NA H.Votsi I.Roch-Jeune K.Haddadi C.Li G.Dambrine P.H.Aaen N.Ridler article KarhaIVB2016 Applied Physics Letters 2016 109 23 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 231103 band gap, III-V optosemiconductors EMRP A169: Call 2013 Energy II American Institute of Physics 30 10.1063/1.4971831 NA P.Kärhä E.Ikonen A.Vaskuri H.Baumgartner article Radiation Measurements 2015 12 12 85 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 26-31 TEPC, Sealed TEPCs, Microdosimetry, Gas pressure Monitoring, Simulated site size http://www.sciencedirect.com/science/article/pii/S1350448715300834?np=y&npKey=bb8af66d5c5364335cd11492697ddcf8a85220bc4d891169d188109555d65c33 EMRP A169: Call 2011 SI Broader Scope Elsevier Ltd. 30 10.1016/j.radmeas.2015.12.004 1 59 No, EURAMET is never allowed to make the publication publicly available. S.Chiriotti D.Moro V.Conte B.Grosswendt F.Vanhavere S.Vynckier article Microwave Measurement Conference (ARFTG), 2014 86th ARFTG 2015 12 3 IEEE Catalog Number: CFP15ARG-USB December IND51: MORSE: Metrology for optical and RF communication systems 69-72 calibration;millimetre wave measurement;phase control;IQ-steering technique;amplitude predistortion technique;amplitude-phase control;calibration;direct IQ up-conversion;frequency 30 GHz to 40 GHz;frequency multiplication;multipath mm-wave signals;signal amplification;wafer probe-tip level;Calibration;Hardware;Minimization;Mixers;Phase measurement;Phase modulation;IQ modulation;calibration;mm-wave;phase coherent http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7381471&queryText=spirito%20m&refinements=4291944822&ranges=2015_2015_Year EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway

30 978-1-4673-9246-4 10.1109/ARFTG.2015.7381471 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Visweswaran C.de Martino E.Sirignano M.Spirito article Optica Pura y Aplicada 2015 12 1 48 4 14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications 283-289 integrated optics, spectroscopy, Fourier transform, Silicon on insulator, temperature drift, spectral retrieval. - EMPIR 2014: Industry SEDOPTICA

MADRID

112 - 10.7149/OPA.48.4.283 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A. V.Velasco J.Galindo-Santos P.Cheben M. LCalvo J.Schmid A.Delage D.-X.Xu S.Janz P.Corredera article IEEE Transactions on electromagnetic compatibility 2015 12 57 6 IND60: EMC: Improved EMC test methods in industrial environments 1391 - 1397 Electromagnetic field mapping, modulated scatterer technique (MST), numerical validation, pyramidal absorber, optically modulated scatterer (OMS), optically modulated scatterer technique. http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7155550 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, NJ

30 0018-9375 10.1109/TEMC.2015.2449354 1 59 No, EURAMET is never allowed to make the publication publicly available. R.A.Vogt-Ardatjew A.E.Sowa article DeStefanoCPFVTMDFM2015 Physica Medica 2015 12 31 8 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 897-902 Intra operative radiation therapy, Electron beam dosimetry, High dose-per-pulse radiation therapy, Synthetic diamond dosimeters EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2015.06.008 NA S.De Stefano A.Ciccotelli M.Pimpinella M.D.Falco G.Verona-Rinati A.Tonnetti M.Marinelli C.Di Venanzio G.Felici F.Marangoni article KralikBAVSS2015 Radiation Protection Dosimetry 2015 12 172 4 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 341-345 Secondary neutrons, proton therapy, Bonner Sphere Spectrometer EMRP A169: Call 2011 Metrology for Health Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncv504 NA M.Králík H.Bártová M.Andrlík Z.Vykydal J.Solc J.Solc proceedings FerreroVHCP2015 Proceedings of the CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard 2015 11 26 1 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 24-33 GONIOSPECTRORADIOMETRY, OLED, photometry, near-field, sub-source EMRP A169: Call 2013 Energy II Commission Internationale de L'Eclairage

CIE Central Bureau, Babenbergerstraße 9/9A, 1010 Vienna, Austria

Braunschweig, Germany CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard 26-11-2015 to 26-11-2015 30 978-3-902842-28-2 NA A.Ferrero J.L. Velázquez M.L.Hernanz J.Campos A.Pons article Physics in Medicine and Biology 2015 11 12 60 23 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 9145 –9156 Geant4-DNA, nanodosimetry, proton therapy http://iopscience.iop.org/article/10.1088/0031-9155/60/23/9145 EMRP A169: Call 2011 SI Broader Scope IOP Publishing

Bristol, UK

30 0031-9155 10.1088/0031-9155/60/23/9145 1 59 No, EURAMET is never allowed to make the publication publicly available. FAlexander CVillagrasa HRabus J JWilkens article Anal Bioanal Chem 2015 11 9 408 2 SIB09: ELEMENTS: Primary standards for challenging elements 417–429 Mass spectrometry . ICP-MS . Biological samples . Metals . Heavy metals . Reference materials . Geochemistry . Geology http://link.springer.com/article/10.1007%2Fs00216-015-9131-2 EMRP A169: Call 2011 SI Broader Scope Springer

Berlin

30 10.1007/s00216-015-9131-2 1 59 No, EURAMET is never allowed to make the publication publicly available. AnaRua-Ibarz EduardoBolea-Fernandez FrankVanhaecke article Elementa 2015 11 3 3 N/A ENV52: HIGHGAS: Metrology for high-impact greenhouse gases N/A None supplied https://www.elementascience.org/articles/75 EMRP A169: Call 2013 Environment II BioOne

Washington DC

30 2325-1026 10.12952/journal.elementa.000075 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. G CRhoderick B DHall C MHarth J SKim JLee S AMontzka JMuhle SReimann M KVollmer R FWeiss article Color Research and Application 2015 11 3 41 4 IND52: XD Reflect: Multidimensional reflectometry for industry 384-391 vision; color; color measurement; perception psychology; psychophysics; industrial inspection http://onlinelibrary.wiley.com/doi/10.1002/col.21964/abstract EMRP A169: Call 2012 Metrology for Industry (II) Wiley Periodicals, Inc.

Arlington VA

30 1520-6378 10.1002/col.21964 1 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. OGómez EPerales EChorro FJBurgos MVilaseca FMMartínez-Verdú JPujol article Measurement 2015 10 9 78 ENG01: GAS: Characterisation of Energy Gases 168-179 High temperature measurement High temperature fixed points (HTFPs) Industrial process control Radiation thermometry Thermocouples Reference functions http://www.sciencedirect.com/science/article/pii/S026322411500500X EMRP A169: Call 2009 Energy ELSEVIER

Amsterdam

30 0263-2241 10.1016/j.measurement.2015.09.033 1 59 No option selected GMachiin KAnhalt MBattuello FBourson PDekker ADiril FEdler C.J.Elliott FGirard AGreenen LKnazovická DLowe PPavlasek J.V.Pearce MSadli RStrnad MSeifert E.M.Vuelban article Review of Scientific Instruments 2015 10 5 83 IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale 103901 Piezoelectric fields, Interferometers, Ferroelectric materials, Polarization, Diffractometers http://scitation.aip.org/content/aip/journal/rsi/86/10/10.1063/1.4931992 EMRP A169: Call 2012 Metrology for Industry (II) AIP Publishing

Melville

30 0034-6748 10.1063/1.4931992 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CVVecchini PTThompson MSStewart AMPMuniz-Piniella SRCMMcMitchell JWWooldridge SLLepadatu LBBouchenoire SBBrown DWWermeille OBBikondoa CALLucas THHase MLLesourd DDDontsov MGCCain proceedings International Congress of Metrology (CIM) 2015, Proceedings 2015 9 23 2015 n.a. ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions 07008 EMRP, industrial emissions http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07008/metrology_metr2015_07008.html EMRP A169: Call 2013 Environment II EDP Sciences - Web of Conferences

Les Ulis Cedex

Paris 17th International Comgress of Metrology 2015 2015-09-21 to 2015-09-24 30 n.a. n.a. 10.1051/metrology/20150007008 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. AnneRausch OlavWerhahn OliverWitzel VolkerEbert Edgar MorenoVuelban JanGersl GjermundKvernmo JohnKorsman MarcColeman TomGardiner RodRobinson article 17th International Congress of Metrology 2015 9 21 17th 2015 SIB64: METefnet: Metrology for moisture in materials 15003 Development - Moisture in materials http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences

London

30 NA 10.1051/metrology/20150015003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SBell AAro FArpino SAytekin GCortellessa MDell’Isola ZFerenčíková VFernicola RGavioso EGeorgin MHeinonen DHudoklin LJalukse NKaraböce ILeito AMäkynen PMiao JNielsen INicolescu MRudolfová MOjanen-Saloranta PÖsterberg PØstergaard MRujan MSega RStrnad TVachova proceedings 17th International Congress of Metrology 2015 9 21 2015 ENV55: MetNH3: Metrology for ammonia in ambient air 07003 ammonia, reference gas mixture, reference gas generator, dilution, absolute spectroscopic measurements, sampling, gas cylinders http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07003/metrology_metr2015_07003.html EMRP A169: Call 2013 Environment II EDP Sciences - Web of Conferences

Les Ulis Cedex

Paris, France 17th International Congress of Metrology 21-09-2015 to 24-09-2015 30 10.1051/metrology/201507003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Pogány D.Balslev-Harder C. F.Braban N.Cassidy V.Ebert V.Ferracci T.Hieta D.Leuenberger N.Lüttschwager N.Martin C.Pascale C.Tiebe M. M.Twigg O.Vaittinen J.van Wijk K.Wirtz B.Niederhauser article 17 th International Congress of Metrology, 14009 (2015 ) 2015 9 21 SIB64: METefnet: Metrology for moisture in materials humiditiy, wood samples, humidification wood http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_14009.pdf EMRP A169: Call 2012 SI Broader scope (II)

Paris

30 10.1051/metrology/20150014009 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M.R.Rudolfová L.P. N.Pitrová Netolická Z. F.Ferenčíková T. V.Váchová R. S.Strnad proceedings Proceedings of CIM 2015 - 17th International Congress of Metrology 2015 9 - - SIB64: METefnet: Metrology for moisture in materials - Moisture, Food, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis www.metrologie2015.com EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences

Paris

Paris CIM 2015 - 17th International Congress of Metrology 21-24 September 2015 30 - - 10.1051/metrology/20150015006 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Rolle G.Beltramino V.Fernicola M.Sega A.Verdoja proceedings Proceedings of CIM 2015 - 17th International Congress of Metrology 2015 9 - - SIB64: METefnet: Metrology for moisture in materials - Moisture, Metrological Traceability, Wood Pellets, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis www.metrologie2015.com EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences

Paris

Paris CIM 2015 - 17th International Congress of Metrology 21-24 September 2015 30 - - 10.1051/metrology/20150008002 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M.Sega G.Beltramino V.Fernicola F.Rolle A.Verdoja proceedings 17th International Congress of Metrology 2015 9 2015 2015 SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 12006 - http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/contents/contents.html EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences

London

Paris International Congress of Metrology 21-09-2015 to 24-09-2015 37 - - 10.1051/metrology/20150012006 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. DAllal BHall PVincent ALitwin FZiadé DjamelAllal article ViefhausNSRHAHPYY2015 Review of Scientific Instruments 2015 9 86 9 SIB58: Angles: Angle metrology 093109 synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors EMRP A169: Call 2012 SI Broader scope (II) AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.4930968 NA J.Viefhaus J.Nordgren F.Siewert R.Reininger A.Hage M.Agåker U.Hahn H. B.Peters Z.Yin TanferYandayan article Journal of Analytical Atomic Spectrometry 2015 8 17 31 1 SIB09: ELEMENTS: Primary standards for challenging elements 179–196 EMRP A169: Call 2011 SI Broader Scope The Royal Society of Chemistry

London

30 10.1039/C5JA00284B 1 59 No, EURAMET is never allowed to make the publication publicly available. Bj¨ornBrandt JochenVogl JanineNoordmann AngelaKaltenbach OlafRienitz article Metrologia 2015 8 15 52 5 SIB01: InK: Implementing the new kelvin S257-S262 Boltzmann constant, acoustic gas thermometry, speed of sound, new kelvin, uncertainty budget http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S257 EMRP A169: Call 2011 SI Broader Scope IOP Science

Bristol

30 NA 10.1088/0026-1394/52/5/S257 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F JPérez-Sanz J JSegovia M CMartin M AVillamanan Ddel Campo CGarcia proceedings 135 IAG 150 Years - Proceedings of the 2013 IAG Scientific Assembly 2015 8 1 143 2015 SIB60: Surveying: Metrology for long distance surveying calibration · EDM · GNSS · local ties · reference baseline · long distance http://link.springer.com/chapter/10.1007%2F1345_2015_154 EMRP A169: Call 2012 SI Broader scope (II) Springer International Publishing

Berlin Heidelberg

Potsdam, Germany International Association of Geodesy (IAG) Scientific Assembly 2013 September 1-6, 2013 30 0939-9585 10.1007/1345_2015_154 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Pollinger M.Astru A.Bauch S.Bergstrand B.Görres J.Jokela U.Kallio H.Koivula H.Kuhlmann V.Kupko K.Meiners-Hagen M.Merimaa W.Niemeier P.Neyezhmakov M.Poutanen F.Saraiva S.Schön S.A.van den Berg J.-P.Wallerand M.Zucco techreport - 2015 7 30 - - NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation - - MAT https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf EMRP A169: Call 2011 Metrology for New Technologies PTB

Brunswick & Berlin

- 30 - - 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf C.Elster K.Klauenberg M.Walzel G.Wuebbeler P.Harris M.Cox C.Matthews I.Smith L.Wright A.Allard N.Fischer S.Cowen S.Ellison P.Wilson F.Pennecchi G.Kok A.Van der Veen L.R.Pendrill article PimpinellaBFVVTPMGD2015 Medical Physics 2015 7 13 42 8 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 4636-4644 synthetic diamond dosimeter, in vivo dosimetry, radiation therapy, semiconductor detector EMRP A169: Call 2011 Metrology for Health Wiley-Blackwell 30 0094-2405 10.1118/1.4926556 NA M.Pimpinella P.Bagalà M. D.Falco G.Verona-Rinati C.Verona A.Tonnetti G.Prestopino M.Marinelli A. S.Guerra V.De Coste article Nuclear Instruments and Methods in Physics Research, Section A 2015 7 1 797 not available IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry 271-277 High Purity Germanium; Minimum detectable activity; Monte Carlo; Spectrometer; Standardisation; Steel factories http://www.sciencedirect.com/science/article/pii/S0168900215008220 EMRP A169: Call 2010 Industry ELSEVIER

Amsterdam

30 0168-9002 10.1016/j.nima.2015.07.002 1 59 No, EURAMET is never allowed to make the publication publicly available. AndreaPetrucci DirkArnold OleksiyBurda PierinoDe Felice EduardoGarcía-Toraño MarcoMejuto VirginiaPeyrés JaroslavŠolc BrankoVodenik article Instrumentation and Measurement, IEEE Transactions 2015 6 26 PP 99 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures 1 thermal behavior and drift, capacitive displacement probe, dimensional metrology, evaluation EMRP A169: Call 2010 Industry IEEE 30 0018-9456 10.1109/TIM.2015.2440563 59 No, EURAMET is never allowed to make the publication publicly available. KBouderbala HNouira MGirault EVidecoq JSalgado article Optics Letters 2015 6 16 40 13 IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments 2933-2936 Spectrometers, Spectroscopy; photothermal and visible, Laser sensors. - EMRP A169: Call 2012 Metrology for Industry (II) OSA

Washington, DC

30 - 10.1364/OL.40.002933 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Peltola T.Hieta M.Vainio proceedings Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution 2015 6 15 n/a n/a ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1-4 power quality, power networks SEG http://cired.net/publications/cired2015/papers/CIRED2015_0663_final.pdf EMRP A169: Call 2013 Energy II n/a

n/a

Lyon, France 23rd International Conference and Exhibition on Electricity Distribution 14-06-2015 to 15-06-2015 30 n/a n/a 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://cired.net/publications/cired2015/papers/CIRED2015_0663_final.pdf VCuk Hvan den Brom SCobben GRietveld proceedings Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 2015 2015 6 15 n/a n/a ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1-5 phasor measurement units, smart grids, renewable energy sources http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf EMRP A169: Call 2013 Energy II n/a

n/a

Lyon, France 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 14-06-15 to 15-06-15 30 n/a n/a 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf GRietveld AJongepier Jvan Seters MVisser PLiu MAcanski DHoogenboom H. E.van den Brom article Optics Letters 2015 5 40 SIB55: ITOC: International timescales with optical clocks 2112 - 2115 https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-9-2112 https://arxiv.org/abs/1502.02608 EMRP A169: Call 2012 SI Broader scope (II) 30 10.1364/OL.40.002112 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-5-31 SebastianHafner StephanFalke ChristianGrebing StefanVogt ThomasLegero MikkoMerimaa ChristianLisdat UweSterr article Journal of the Optical Society of America A, Optics, Image Science and Vision. 2015 4 27 32 5 IND52: XD Reflect: Multidimensional reflectometry for industry 921-927 sparkle, Color, measurement, Vision - acuity, Color visión, Vision - contrast sensitivity, Spectral discrimination, Astronomical optics https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-5-921 EMPIR 2014: Industry The Optical Society (OSA)

Washington, DC

30 1084-7529 10.1364/JOSAA.32.000921 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. EKirchner Ivan der Lans EPerales FMMartínez-Verdú JCampos AFerrero article IEEE Transaction on Instrumentation and Measurement 2015 4 16 64 6 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1331-1335 Estimation, measurement, noise, quantization, sampling, signal-to-noise ratio (SNR), synchronization, time jitter, uncertainty http://ieeexplore.ieee.org/document/7087386/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

New York

30 0018-9456 10.1109/TIM.2015.2408793 1 59 No, EURAMET is never allowed to make the publication publicly available. RadoLapuh BoštjanVoljč MatjažLindič article Radiation Protection Dosimetry 2015 4 15 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy http://rpd.oxfordjournals.org/content/early/2015/04/15/rpd.ncv140.abstract EMRP A169: Call 2011 SI Broader Scope 30 10.1093/rpd/ncv140 59 No, EURAMET is never allowed to make the publication publicly available. S.Chiriotti D.Moro V.Conte P.Colautti B.Grosswendt E.Sterpin S.Vynckier article Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms 2015 4 1 348 8 EXL02: SIQUTE: Single-photon sources for quantum technologies 187-190 Diamond; Electroluminescence; Graphite; Ion beam micro-machining http://www.sciencedirect.com/science/journal/0168583X EMRP A169: Call 2012 Open excellence call Elsevier

London

30 0168-583X 10.1016/j.nimb.2014.12.036 1 59 No, EURAMET is never allowed to make the publication publicly available. J.Forneris A.Battiato D.Gatto Monticone F.Picollo G.Amato L.Boarino G.Brida I.P.Degiovanni E.Enrico M.Genovese E.Moreva P.Traina C.Verona G.Verona Rinati P.Olivero article Metrologia 2015 4 1 52 2 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 392-399 Bayesian analysis, prior knowledge, posterior distribution, calibration, flow meter, least squares, regression MAT http://iopscience.iop.org/article/10.1088/0026-1394/52/2/392/meta EMRP A169: Call 2011 Metrology for New Technologies BIPM

Sèvres

30 - 10.1088/0026-1394/52/2/392 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. G. J. P.Kok A. M. H.Van der Veen P. M.Harris I. M.Smith C.Elster article AlexanderRVW2015 Radiotherapy and Oncology 2015 4 115 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy S796 BioQuaRT, track structure, ion beam therapy, nanodosimetry, treatment planning EMRP A169: Call 2011 SI Broader Scope Elsevier BV

Suite 800, 230 Park Avenue, New York, NY 10169 United States

30 0167-8140 10.1016/S0167-8140(15)41460-4 59 NA F.Alexander H.Rabus C.Villagrasa J.J.Wilkens article MeylanGGVBOABBG2015 Radiotherapy and Oncology 2015 4 115 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy S106-S107 BioQuaRT, track structure, ion beam therapy, microdosimetry, nanodosimetry, multi-scale model, reactive species EMRP A169: Call 2011 SI Broader Scope Elsevier BV

Suite 800, 230 Park Avenue, New York, NY 10169, United States

30 0167-8140 10.1016/S0167-8140(15)40209-9 59 NA S.Meylan G.Gruel G.Gonon C.Villagrasa M.U.Bug SandraOtto A.Arndt W.Y.Baek M.Bueno U.Giesen article MairaniMCVVPMRM2015 Medical Physics 2015 3 31 42 4 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 2085-2093 synthetic diamond detector, carbon ions, relative dosimetry EMRP A169: Call 2011 Metrology for Health Wiley-Blackwell 30 0094-2405 10.1118/1.4915544 NA A.Mairani A.Mirandola M.Ciocca G.Verona-Rinati C.Verona G.Prestopino M.Marinelli L.Raffaele G.Magro article AzumaBBBBBCDFFHKKKMMMMNNPRRSSVWWZ Metrologia 2015 3 25 52 2 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies fundamental constants, Avogadro constant, kilogram A169 EMRP A169: Call 2011 SI Broader Scope 30 0957-0233 10.1088/0026-1394/52/2/360 1 59 NA YAzuma PBarat GBartl HBettin MBorys IBusch LCibik GD’Agostino KFujii HFujimoto AHioki MKrumrey UKuetgens NKuramoto GMana EMassa RMeeß SMizushima TNarukawa ANicolaus APramann S ARabb ORienitz CSasso MStock R DVocke Jr AWaseda SWundrack SZakel article GenoudVPDM Optics Letters 2015 3 23 40 7 ENV09: MetroRWM: Metrology for Radioactive Waste Management radiocarbon, molecular spectroscopy, quantum cascade laser http://www.opticsinfobase.org/ol/abstract.cfm?uri=ol-40-7-1342 A169 EMRP A169: Call 2010 Environment 30 10.1364/OL.40.001342 1 59 NA G.Genoud M.Vainio H.Phillips J.Dean M.Merimaa article ReimannSHHRRV2015 Geophysical Research Letters 2015 3 13 42 5 ENV52: HIGHGAS: Metrology for high-impact greenhouse gases 1606-1611 inhalation, anaesthetics EMRP A169: Call 2013 Environment II Wiley-Blackwell 30 0094-8276 10.1002/2014GL062785 NA S.Reimann F.Schoenenberger D.Hofstetter M.Hill T.S.Rhee M.Rigby M.K.Vollmer article Applied Thermal Engineeing 2015 3 5 78 5 March 2015 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures 720-730 Temperature control;Closed-loop; State feedback; Kálmán filter; Reduced model EMRP A169: Call 2010 Industry 30 10.1016/j.applthermaleng.2014.10.080 59 No, EURAMET is never allowed to make the publication publicly available. EVidecoq MGirault KBouderbala HNouira JSalgado DPetit article IEEE TRANSACTIONS ON MAGNETICS 2015 3 51 3 NEW07: THz Security: Microwave and terahertz metrology for homeland security Dosimetry, millimeter wave propagation EMRP A169: Call 2011 Metrology for New Technologies 30 59 No, EURAMET is never allowed to make the publication publicly available. L.Zilberti D.Voyer O.Bottauscio M.Chiampi R.Scorretti article BrunnerHRV2015 Environmental Science & Technology 2015 3 49 5 ENV52: HIGHGAS: Metrology for high-impact greenhouse gases 2703-2708 synthetic halocarbons EMRP A169: Call 2013 Environment II American Chemical Society (ACS) 30 0013-936X, 1520-5851 10.1021/es505123x NA D.Brunner M.Hill S.Reimann M.K.Vollmer article JOURNAL OF ANALYTICAL ATOMIC SPECTROMETRY 2015 2 25 30 6 SIB09: ELEMENTS: Primary standards for challenging elements 1329 - 1335 ICP-MS, HALF-LIFE, 2ND VACUUM STAGE, TIME-RESOLVED MEASUREMENTS, SKIMMER, DENSITY, INTERFACE, FRACTIONATION EMRP A169: Call 2011 SI Broader Scope The Royal Society of Chemistry

London

30 0267-9477 10.1039/c4ja00150h 1 59 No, EURAMET is never allowed to make the publication publicly available. NikoKivel Heiko-DirkPotthast InesGuenther-Leopold FrankVanhaecke DetlefGuenther article Journal of Biomolecular NMR 2015 2 21 62 1 HLT10: BiOrigin : Metrology for biomolecular origin of disease 17-23 7 trans-membrane proteins Poorly available proteins Fast magic angle spinning Heteronuclear detection 13C-detection Low sample volumes http://link.springer.com/article/10.1007%2Fs10858-015-9911-1 EMRP A169: Call 2011 Metrology for Health Springer

Berlin

30 10.1007/s10858-015-9911-1 1 59 No, EURAMET is never allowed to make the publication publicly available. AnthonyWatts Peter J.Judge LubicaAsilmovska Marc PhilippPfeil Victoria A.Higman KrisztinaVarga Garrick F.Taylor Hugh R WDannatt article KuepferlingZSVDPRRB2015 Journal of Applied Physics 2015 2 13 117 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems http://scitation.aip.org/content/aip/journal/jap/117/17/10.1063/1.4908142 A169 EMRP A169: Call 2012 Open excellence call English 0021-8979 10.1063/1.4908142 1 59 NA M.Kuepferling S.Zullino A.Sola B.Van de Wiele G.Durin M.Pasquale K.Rott G.Reiss G.Bertotti article BeckerBBBJJMPV2015 Measurement 2015 2 61 IND12: Vacuum: Vacuum metrology for production environments Gas flow metrology, Standard leak artefacts, Experimental data set A169 EMRP A169: Call 2010 Industry English 10.1016/j.measurement.2014.10.045 1 59 NA UteBecker DjlaliBentouati MerdedeBergoglio FrédéricBoineau WolfangJitschin KarlJousten DomenicoMari DominikPražák MartinVičar article VerbeystABF2015 Measurement Science and Technology 2015 1 20 26 2 IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications 025203 electro-optic sampling, pulse generator, waveform metrology EMRP A169: Call 2010 Industry IOP Publishing 30 0957-0233, 1361-6501 10.1088/0957-0233/26/2/025203 NA F.Verbeyst S.Ahmed M.Bieler H.Füser proceedings Proceddings SPIE 9450, Photonics, Devices and Systems VI 2015 1 6 94501L 6 January 2015 SIB60: Surveying: Metrology for long distance surveying Fabry-Perot cavity, laser frequency comb, repetition rate multiplication http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2089426 EMRP A169: Call 2012 SI Broader scope (II) SPIE Prague 7th Internataional Conference on Photonics, Devices and Systems August 27-29, 2014 30 10.1117/12.2074415 1 59 No, EURAMET is never allowed to make the publication publicly available. A.Lešundák R.Smid D.Voigt M.Čížek S.van den Berg O.Číp article Metrologia 2015 1 52 1 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 72-81 dynamic calibration bridge amplifier charge amplifier voltage amplifier EMRP A169: Call 2010 Industry IOP Publishing on behalf of Bureau International des Poids et Mesures

Bristol

30 ISSN 0026-1394 (print) ; ISSN 1681-7575 (online) 10.1088/0026-1394/52/1/72 1 59 No option selected L.Klaus Th.Bruns H.Volkers proceedings WinterOOJvWISN2015 Proc. Intl. Soc. Mag. Reson. Med. 2015 23 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI http://www.ismrm.org/15/ A169 EMRP A169: Call 2011 Metrology for Health Toronto, Ontario, Canada ISMRM 23rd Annual Meeting & Exhibition 30 May-05 June 2015 English 1 59 NA LukasWinter EvaOberacker CelalÖzerdem YiyiJi Florianvon Knobelsdorff-Brenkenhoff GerdWeidemann BerndIttermann FrankSeifert ThoralfNiendorf proceedings WinterOOJvWISN2015_2 Proc. Intl. Soc. Mag. Reson. Med. 2015 23 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI http://www.ismrm.org/15/ A169 EMRP A169: Call 2011 Metrology for Health Toronto, Ontario, Canada ISMRM 23rd Annual Meeting & Exhibition 30 May-05 June 2015 English 1 59 NA LukasWinter EvaOberacker CelalÖzerdem YiyiJi Florianvon Knobelsdorff-Brenkenhoff GerdWeidemann BerndIttermann FrankSeifert ThoralfNiendorf article KlapetekVPPMYM2015 Nanotechnology 2015 26 065501 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom scanning probe microscopy, high-speed SPM, metrology A169 EMRP A169: Call 2012 Metrology for Industry (II) English 10.1088/0957-4484/26/6/065501 1 59 NA PKlapetek MValtr LPicco O DPayton JMartinek AYacoot MMiles article Review of Scientific Instruments 2015 86 IND14: Frequency: New generation of frequency standards for industry EMRP A169: Call 2010 Industry 30 0034-6748 10.1063/1.4904973 59 No, EURAMET is never allowed to make the publication publicly available. J.Galindo-Santos A. V.Velasco P.Corredera article Tantala 2015 141 1 ENG54: Biogas: Metrology for biogas 128-36 Adsorption; Biogas; CHP; Interference; Landfill; VOCs EnG http://www.ncbi.nlm.nih.gov/pubmed/25966392 EMRP A169: Call 2013 Energy II Elsevier 30 10.1016/j.talanta.2015.03.063 1 59 No, EURAMET is never allowed to make the publication publicly available. C. A.Hepburn PVale A. S.Brown N. J.Simms E. J.McAdam proceedings 17 International Congress of Metrology 2015 ENG54: Biogas: Metrology for biogas Biogas EnG http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08006.pdf EMRP A169: Call 2013 Energy II EDP Sciences Paris 17 International Congress of Metrology 21 September 2015 30 10.1051/metrology/201508006 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Adriaan M. H.van der Veen Andrew S.Brown MarttiHeinonen ArulMurugan FrederiqueHaloua KarineArrhenius JianrongLi proceedings 2nd International Conference on Renewable Energy Gas Technology 2015 - - ENG54: Biogas: Metrology for biogas - Biogas EnG EMRP A169: Call 2013 Energy II -

-

Barcelona, Spain REGATEC 2015 2nd International Conference on Renewable Energy Gas Technology 7-8 May 2015 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Adriaan M. H.van der Veen JianrongLi proceedings EDULEARN14 Proceedings 2015 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 5593-5602 Color technology, special-effect pigments, automotive coatings, training internships in company, Moodle platform, adaptive learning, b-learning http://library.iated.org/publications/EDULEARN14 EMRP A169: Call 2012 Metrology for Industry (II) IATED

Valencia, Spain

Barcelona, Spain 6th International Conference on Education and New Learning Technologies 6-7/07/2014 30 978-84-617-0557-3 2340-1117 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. FMMartínez-Verdú VViqueira EPerales EChorro proceedings Proceedings of 23rd Congress of the International Commission for Optics 2015 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 1-4 effect coatings, goniochromatic , color measurement, BRDF http://hdl.handle.net/10261/111835 EMRP A169: Call 2012 Metrology for Industry (II) Proceedings of 23rd Congress of the International Commission for Optics

Orlando

Santiago de Compostela, Spain Proceedings of 23rd Congress of the International Commission for Optics 26-29/08/2014 30 N/A N/A 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.Perales A.Ferrero E.Chorro V.Viqueira A.Rabal F.Martínez-Verdú A.Pons J.Campos proceedings Shaping the future by engineering : 58th IWK, Ilmenau Scientific Colloquium, Technische Universität Ilmenau, 8 - 12 September 2014 ; proceedings 2015 2014 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 158 nanopositioning and nanomeasuring machine, metrological scanning probe microscope, SPM, AFM, long distance measurements http://www.db-thueringen.de/servlets/DocumentServlet?id=24940 EMRP A169: Call 2012 Metrology for Industry (II) TU-Ilmenau Ilmenau, Germany 58th Ilmenau Scientific Colloquium September 8-12, 2014 30 59 No, EURAMET is never allowed to make the publication publicly available. http://nbn-resolving.de/urn:nbn:de:gbv:ilm1-2014iwk-158:6 N.Vorbringer-Dorozhovets R.Fuessl E.Manske article tm – Technisches Messen 2015; 82(7–8): 359–366 2015 82 7-8 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 359-366 Nanopositioning and nanomeasuring machine, multiscale measurement, optical and tactile sensors EMRP A169: Call 2012 Metrology for Industry (II) De Gruyter

Oldenbourg

30 10.1515/teme-2015-0011 1 59 No, EURAMET is never allowed to make the publication publicly available. E.Manske R.Fuessl R.Mastylo N.Vorbringer-Dorozhovets O.Birli G.Jaeger article Microelectronic Engineering 2015 141 2015 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures 250-255 Traceability Calibration standard Areal surface texture Sq Measurement uncertainty EMRP A169: Call 2010 Industry Elsevier 30 10.1016/j.mee.2015.04.021 1 59 No, EURAMET is never allowed to make the publication publicly available. RKoops Mvan Veghel Avan de Nes article Scientific Reports 2015 5 SIB60: Surveying: Metrology for long distance surveying 14661 EMRP A169: Call 2012 SI Broader scope (II) Nature Publishing Group 30 10.1038/srep14661 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S.van den Berg S.van Eldrik N.Bhattacharya proceedings XXI IMEKO World Congress - Full Papers 2015 1 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 2279 AFM, long range AFM, nanopositioning and nanomeasuring machine, NPM machine, long distance measurements EMRP A169: Call 2012 Metrology for Industry (II) Czech Technical University

Prague

Prague XXI IMEKO World Congress August 30 - September 4, 2015 30 978-80-01-05793-3 59 No, EURAMET is never allowed to make the publication publicly available. N.Vorbringer-Dorozhovets E.Manske article The European Physical Journal D 2015 69 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 216 track structure; particle beams; radiotherapy http://link.springer.com/article/10.1140%2Fepjd%2Fe2015-60206-5 EMRP A169: Call 2011 SI Broader Scope Springer

Cham, Switzerland

30 1434-6079 10.1140/epjd/e2015-60206-5 1 59 No, EURAMET is never allowed to make the publication publicly available. FAlexander CVillagrasa HRabus J JWilkens article Medical Physics 2015 42 12 HLT11: MetroMRT: Metrology for molecular radiotherapy 6885-6894 nuclear medicine, GATE, Monte Carlo simulations, SPECT, dosimetry EMRP A169: Call 2011 Metrology for Health American Association of Physicists in Medicine

Alexandria

30 0094-2405 10.1118/1.4934828 1 59 No, EURAMET is never allowed to make the publication publicly available. MPGarcia DVilloing EMcKay LFerrer MCremonesi FBotta MFerrari MBardiès article Medical Physics 2015 42 3 HLT11: MetroMRT: Metrology for molecular radiotherapy 1288-1296 radiopharmaceutical dosimetry, Monte Carlo modeling, GATE, OLINDA/EXM, STRATOS EMRP A169: Call 2011 Metrology for Health American Association of Physicists in Medicine

Alexandria

30 0094-2405 10.1118/1.4907957 1 59 No, EURAMET is never allowed to make the publication publicly available. SMarcatili DVilloing TMauxion BJMcParland MBardiès article Proceedings of the 2015 IEEE International Symposium on EMC (EMC Europe), Dresden, 2015 2015 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 767 - 772 NUTL, coupling into cables, GTEM, reverberation chamber http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7256260 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, N.J.

30 2158-110X 10.1109/ISEMC.2015.7256260 1 59 No, EURAMET is never allowed to make the publication publicly available. R.A.Vogt-Ardatjew F.B.J.Leferink FritsBuesink article Proceedings of the 2015 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Taipei, Taiwan 2015 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 624-627 Magneto-Dielectric, Coating, Absorbing, Unsymmetrical, Cables http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7175365 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, N.J.

30 2162-7673 10.1109/APEMC.2015.7175365 1 59 No, EURAMET is never allowed to make the publication publicly available. R.A.Vogt-Ardatjew A.E.Sowa F.B.J.Leferink article Proceedings of the 2015 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Taipei, Taiwan 2015 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 470-473 Current Boundary, Zoning, Regions, Cable shield termination Cable transit http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7175236 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, NJ

30 2162-7673 10.1109/APEMC.2015.7175236 1 59 No, EURAMET is never allowed to make the publication publicly available. B.J.A.M.van Leersum F.J.K.Buesink F.B.J.Leferink article Proceedings of the 2015 IEEE International Symposium on EMC (EMC Europe), Dresden, 2015 2015 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 1478 - 1483 system level EMC; exposed cables; HIRF; naval ship; http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7256392 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, N.J.

30 2158-110X 10.1109/ISEMC.2015.7256392 1 59 No, EURAMET is never allowed to make the publication publicly available. B.J.A.M.van Leersum C.C.J.van der Ven F.J.K.Buesink F.B.J.Leferink article Journal of Radioanalytical and Nuclear Chemistry 2015 304 1 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 145–150 Technologically enhanced naturally occurring radioactive materials, Radioactive waste, Activity, Attenuation of gamma-rays, 226Ra, 228Ra http://link.springer.com/article/10.1007%2Fs10967-014-3666-0 EMRP A169: Call 2012 Metrology for Industry (II) Springer

New York City

30 10.1007/s10967-014-3666-0 1 59 No, EURAMET is never allowed to make the publication publicly available. D.Glavič-Cindro M.Korun B.Vodenik B.Zorko article Applied Physics Letters 2015 106 22 IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments 221106 DIODE-LASERS; SPECTROMETER; TEMPERATURE; SENSOR http://scitation.aip.org/content/aip/journal/apl/106/22/10.1063/1.4922149 EMRP A169: Call 2012 Metrology for Industry (II) Americal Institute of Physics

New York

30 0003-6951 10.1063/1.4922149 1 59 No, EURAMET is never allowed to make the publication publicly available. KMManfred GADRitchie NLang JRopcke JPvan Helden article Energies 2015 8 ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification 3455-3488 photovoltaic performance; spectral response; solar spectrum http://www.mdpi.com/1996-1073/8/5/3455/pdf EMRP A169: Call 2013 Energy II MDPI

Basel, Switzerland

30 ISSN 1996-1073 10.3390/en8053455 1 59 No option selected A.Gracia Amillo T.Huld P.Vourlioti R.Mueller M.Norton article METEOROLOGICAL APPLICATIONS 2015 22 Supplement S1 ENV58: MeteoMet2: Metrology for essential climate variables 847-853 Metrology for Meteorology; Everest Pyramid; climatic chamber; MeteoMet; temperature sensors calibration; pressure sensors calibration; uncertainty http://onlinelibrary.wiley.com/doi/10.1002/met.1503/abstract EMRP A169: Call 2013 Environment II Royal Meteorological Society

Reading

30 1350-4827 10.1002/met.1503 1 59 No, EURAMET is never allowed to make the publication publicly available. AMerlone GRoggero G PVerza article METEOROLOGICAL APPLICATIONS 2015 22 1 ENV58: MeteoMet2: Metrology for essential climate variables 854 - 860 atmospheric sensors calibration; GRUAN; MeteoMet; metrology; Ny-Ålesund; radiosondes http://onlinelibrary.wiley.com/doi/10.1002/met.1506/abstract EMRP A169: Call 2013 Environment II Royal Meteorological Society

Reading

30 1350-4827 10.1002/met.1506 1 59 No, EURAMET is never allowed to make the publication publicly available. CMusacchio SBellagarda MMaturilli JGraeser VVitale AMerlone article METEOROLOGICAL APPLICATIONS 2015 22 1 ENV58: MeteoMet2: Metrology for essential climate variables 879 - 885 metrology; rain gauges; calibration; uncertainty; tipping-bucket; laboratory http://onlinelibrary.wiley.com/doi/10.1002/met.1540/abstract EMRP A169: Call 2013 Environment II Royal Meteorological Society

Reading

30 1350-4827 10.1002/met.1540 1 59 No, EURAMET is never allowed to make the publication publicly available. M A ASantana P L OGuimarães L GLanza EVuerich proceedings RoscoeFVCW2015 23rd International Conference on Electricity Distribution 2015 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics Smart grids, Distribution grid sensor networks, Sensor placement algorithm, Power flow, Electrical engineering SEG http://cired.net/publications/cired2015/papers/CIRED2015_0779_final.pdf EMRP A169: Call 2013 Energy II Lyon, France International Conference on Electricity Distribution 15-06-2015 to 18-06-2015 30 2032-9644 NA AndrewRoscoe AlistairForbes AlbertoVenturi PaulClarkson PaulWright article PeltolaVHFHM2014 Optics Express 2014 12 23 22 26 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 32429-32439 optical parametric oscillator, cavity-ring-down spectroscopy, nitrous oxide, water vapor, methane EMRP A169: Call 2010 Environment The Optical Society

2010 Massachusetts Ave, NW Washington DC 20036-1023, USA

30 1094-4087 10.1364/OE.22.032429 NA JariPeltola MarkkuVainio TuomasHieta ThomasFordell LauriHalonen MikkoMerimaa article Journal of the Optical Society of America A 2014 12 3 32 1 IND52: XD Reflect: Multidimensional reflectometry for industry 1-11 OCIS codes: (330.1710) Color, measurement; (330.1720) Color vision; (290.1483) BSDF, BRDF, and BTDF. https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-1-1 EMRP A169: Call 2012 Metrology for Industry (II) OSA

Washington, DC, USA

30 1084-7529 (print), 1520-8532 (online) 10.1364/JOSAA.32.000001 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. AFerrero JCampos EPerales F. M.Martínez-Verdú Ivan der Lans EKirchner article RaffaeleLCCVVPPMRT2014 Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment 2014 12 767 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 310-317 synthetic diamond detector, proton beam, ocular therapy EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 0168-9002 10.1016/j.nima.2014.09.004 NA L.Raffaele R.M.La Rosa G.Cuttone G.A.P.Cirrone G.Verona-Rinati C.Verona G.Prestopino F.Pompili M.Marinelli F.Romano C.Tuvè article VanermenGPSLGPFEBE2014 Analytical and Bioanalytical Chemistry 2014 12 407 11 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 3055-3067 Slurry, PBDE, PAH, TBT, Reference materials, Suspended particulate matter, Whole water, Water Framework Directive EMRP A169: Call 2010 Environment Springer Nature 30 1618-2642, 1618-2650 10.1007/s00216-014-8349-8 NA G.Vanermen H.Goenaga-Infante P.Petrov C.Swart B.Lalère F.Gantois R.Philipp I.Fettig S.Elordui-Zapatarietxe G.Boom H.Emteborg article VaisanenSNL2014 International Journal of Environmental Analytical Chemistry 2014 11 24 95 1 ENV51: MeTra: Traceability for mercury measurements 1-15 - EMRP A169: Call 2013 Environment II Informa UK Limited 30 0306-7319, 1029-0397 10.1080/03067319.2014.983493 NA T.Väisänen T.Sara-Aho T.Näykki I.Leito article RastelloDSKCPSMIKSHKTBMPTACMKV2014 Metrologia 2014 11 20 51 6 IND06: MIQC: Metrology for Industrial Quantum Communications 10 Metrology, quantum cryptography, quantum communication http://iopscience.iop.org/0026-1394/ A169 EMRP A169: Call 2010 Industry English 0026-1394 10.1088/0026-1394/51/6/S267 1 59 NA M LRastello I PDegiovanni A GSinclair SKück C JChunnilall GPorrovecchio MSmid FManoocheri EIkonen TKubarsepp DStucki K SHong S KKim ATosi GBrida AMeda FPiacentini PTraina AAl Natsheh J YCheung IMüller RKlein AVaigu proceedings VolkelBBW2014 2014 11 16 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound Power, Metrology, Traceability http://www.acoustics.asn.au/conference_proceedings/INTERNOISE2014/papers/p357.pdf A169 EMRP A169: Call 2012 SI Broader scope (II) Melbourne, Australia Internoise - 43rd International Congress on Noise Control Engineering 16 to 19 November 2014 English 978-0-909882-02-0 1 59 NA KVölkel CBethke SBrezas VWittstock article ACS Applied Materials & Interfaces 2014 11 11 6(23) 2014 SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology 21389−21396 block copolymer, self-assembly, nanolithography, high aspect-ratio, rapidt hermal processing, PS-b-PMMA http://pubs.acs.org/doi/abs/10.1021/am506391n EMRP A169: Call 2012 SI Broader scope (II) ACS Publications Ameican Chemical Society

Washington

30 10.1021/am506391n 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Ferrarese Lupi T.J.Giammaria F.G.Volpe F.Lotto G.Seguini B.Pivac M.Laus M.Perego article Applied Optics 2014 11 1 53 31 SIB04: Ion Clock: High-accuracy optical clocks with trapped ions 7476-7482 Laser stabilization; Lasers, distributed-feedback; Laser cooling; Spectroscopy, diode lasers; Spectroscopy, saturation https://www.osapublishing.org/ao/abstract.cfm?uri=ao-53-31-7476 EMRP A169: Call 2011 SI Broader Scope 30 2155-3165 10.1364/AO.53.007476 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.Fordell A.E.Wallin T.Lindvall M.Vainio M.Merimaa article RoggeroBCVVM2014 Atmospheric and Climate Sciences 2014 11 04 05 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 796-802 Automatic Weather Station, Himalaya, Climate Monitoring, AWSs Calibration, QA/QC Procedure EMRP A169: Call 2010 Environment Scientific Research Publishing Inc 30 2160-0414, 2160-0422 10.4236/acs.2014.45070 NA G.Roggero P.Bonasoni P.Cristofanelli G.PVerza E.Vuillermoz A.Merlone article MaringerSKCPGCDVHRMSJDTAHM2014 Applied Radiation and Isotopes 2014 11 81 ENV09: MetroRWM: Metrology for Radioactive Waste Management Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal http://www.sciencedirect.com/ A169 EMRP A169: Call 2010 Environment English 0969-8043 10.1016/j.apradiso.2013.03.046 1 59 NA F.J.Maringer J.Šuráň P.Kovář B.Chauvenet V.Peyres E.García-Toraño M.L.Cozzella P.De Felice B.Vodenik M.Hult U.Rosengård M.Merimaa L.Szücs C.Jeffery J.C.J.Dean Z.Tymińsk D.Arnold R.Hincam G.Mirescu manual 2014 10 31 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures Picodrift interferometer http://projects.npl.co.uk/T3D/publications.html EMRP A169: Call 2010 Industry 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.van de Nes article Journal of Raman Spectroscopy 2014 10 8 46 2 IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry 273-279 poly(lactic acid)/poly(methyl methacrylate) blend; polymer blend; quantification; implant; micro Raman spectroscopy http://onlinelibrary.wiley.com/doi/10.1002/jrs.4603/full EMRP A169: Call 2012 Metrology for Industry (II) Wiley

Hoboken

30 0377-0486 10.1002/jrs.4603 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Vano-Herrera A.Misiun C.Vogt article British Journal of Radiology 2014 9 26 88 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy Radiation quantities, biologically relevant dosimetry, microbeam, nanodosimetry, microdosimetry, reactive species, BioQuaRT EMRP A169: Call 2011 SI Broader Scope 30 0007-1285 10.1259/bjr.20140392 59 No, EURAMET is never allowed to make the publication publicly available. H.Palmans H.Rabus A. L.Belchior M. U.Bug S.Galer U.Giesen G.Gonon G.Gruel G.Hilgers D.Moro H.Nettelbeck M.Pinto A.Pola S.Pszona G.Schettino P. H. G.Sharpe P.Teles C.Villagrasa J. J.Wilkens article LerardiBPFVJ2014 Measurement 2014 9 16 58 IND12: Vacuum: Vacuum metrology for production environments Focused ion beam,Nanotechnology, SEM, STEM, AFM, Standard leak, Gas flow meter, Vacuum Metrology, DSMC. A169 EMRP A169: Call 2010 Industry English 10.1016/j.measurement.2014.09.017 1 59 NA V.Lerardi U.Becker S.Pantazis G.Firpo U.Valbusa K.Jousten article Surface and Interface Analysis 2014 9 12 1 46 NEW01: TReND: Traceable characterisation of nanostructured devices 96-99 TOF-SIMS, Gentle-SIMS (G-SIMS), organic solar cell, PC70BM, PCDTBT http://onlinelibrary.wiley.com/doi/10.1002/sia.5650/full EMRP A169: Call 2011 Metrology for New Technologies Wiley Online Library

New Jersey NYC

30 0142-2421 10.1002/sia.5650 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-9-12 A.Franquet C.Fleischmann T.Conard E.Voroshazi C.Poleunis R.Havelund A.Delcorte W.Vandervorst article WinterOOJvWISN2014 Magnetic Resonance in Medicine 2014 9 11 early view HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI ultrahigh field MR; RF heating; coronary stents; specific absorption rate; RF power deposition A169 EMRP A169: Call 2011 Metrology for Health english 1522-2594 10.1002/mrm.25483 1 59 NA LukasWinter EvaOberacker Celal €Ozerdem YiyiJi Florianvon Knobelsdorff-Brenkenhoff GerdWeidemann BerndIttermann FrankSeifert ThoralfNiendorf proceedings MullerMVM2014 58th ILMENAU SCIENTIFIC COLLOQUIUM 2014 9 9 IND10: Form metrology: Optical and tactile metrology for absolute form characterization markers, coordinate referencing, surface measurement data comparison http://nbn-resolving.org/urn:nbn:de:gbv:ilm1-2014iwk:3 A169 EMRP A169: Call 2010 Industry Technische Universität Ilmenau 58th ILMENAU SCIENTIFIC COLLOQUIUM 08 – 12 September 2014 English 1 59 NA AndreasMüller RostislavMastylo NataliyaVorbringer-Dorozhovets EberhardManske thesis 2014 9 3 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects atomic force microscopy, spring constant, force measurements, nanomaterials, EMRP A169: Call 2011 Metrology for New Technologies Aalto University 30 59 No, EURAMET is never allowed to make the publication publicly available. http://nbn-resolving.de/urn:nbn:fi:aalto-201410062756 S.Vesamo article Applied Surface Science 2014 9 1 302 n/a NEW07: THz Security: Microwave and terahertz metrology for homeland security 30-33 LSMO thin films, BTO/CeO2/YSZ buffered SOI substrate, Pulsed laser deposition, TCR coefficienta EMRP A169: Call 2011 Metrology for New Technologies Elsevier

n/a

30 0169-4332 10.1016/j.apsusc.2014.05.051 1 59 No, EURAMET is never allowed to make the publication publicly available. Š.Chromik V.Štrbík E.Dobročka T.Roch A.Rosová M.Španková T.Lalinský G.Vanko P.Lobotka M.Ralbovský P.Choleva proceedings vandeNesV2014 2014 9 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures dimensional stability, picometer uncertainty, optical metrology, displacement interferometry http://www.db-thueringen.de/servlets/DerivateServlet/Derivate-30965/ilm1-2014iwk-148.pdf A169 EMRP A169: Call 2010 Industry Ilmenau, Germany 58th Ilmenau Scientific Colloquium 2014 1 59 NA A.S.van de Nes D.Voigt article EPJ Web of Conferences 2014 8 19 77 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy Radiation units, dose, microbeam, nanodosimetry, microdosimetry EMRP A169: Call 2011 SI Broader Scope 30 2100-014X 10.1051/epjconf/20147700021 59 No, EURAMET is never allowed to make the publication publicly available. H.Rabus H.Palmans G.Hilgers P.Sharpe M.Pinto C.Villagrasa H.Nettelbeck D.Moro A.Pola S.Pszona P.Teles proceedings Proceedings of SPIE 2014 8 18 9203 SIB08: subnano: Traceability of sub-nm length measurements 920308 Fabry-Perot interferometers, interferometry, nanotechnology, calibration, sensors, engineering, refractive index EMRP A169: Call 2011 SI Broader Scope SPIE

Bellingham

San Diego, CA, USA SPIE Optics & Photonics Congress, Interferometry XVII: Techniques and Analysis 17-08-2014 to 21-08-2014 30 1996-756X 10.1117/12.2060537 59 No, EURAMET is never allowed to make the publication publicly available. D.Voigt A.S.van de Nes S.A.van den Berg article GoveniusLTPJMVM2014 Physical Review B 2014 8 11 90 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 74.78.Na, 07.57.Kp, 74.45.+c, 85.25.Cp http://journals.aps.org/prb/abstract/10.1103/PhysRevB.90.064505 http://arxiv.org/abs/1403.6586 A169 EMRP A169: Call 2012 Open excellence call English 1098-0121 10.1103/PhysRevB.90.064505 1 59 NA J.Govenius R. E.Lake K. Y.Tan V.Pietilä J. K.Julin I. J.Maasilta P.Virtanen M.Möttönen article CalamantePhDFIKKORSSv2014 JOURNAL OF MAGNETIC RESONANCE IMAGING 2014 7 23 early view HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI MR safety; research; human; education; training; guidelines A169 EMRP A169: Call 2011 Metrology for Health english 1522-2586 10.1002/jmri.24717 1 59 NA FernandoCalamante, PhD William H.Faulkner Jr., BS, RT BerndIttermann, PhD EmanuelKanal, MD VeraKimbrell, BSRT TittiOwman, RT Scott B.Reeder, MD, PhD Anne M.Sawyer, BS, RT Frank G.Shellock, PhD Johan S.van den Brink, PhD on behalf of the ISMRM Safety Committee article FalkeLGLWGHHAHVSL2014 New Journal of Physics 2014 7 16 SIB55: ITOC: International timescales with optical clocks 073023 http://iopscience.iop.org/1367-2630/16/7/073023 A169 EMRP A169: Call 2012 SI Broader scope (II) 10.1088/1367-2630/16/7/073023 1 59 NA SFalke NLemke CGrebing BLipphardt SWeyers VGerginov NHuntemann CHagemann AAl-Masoudi SHaefner SVogt USterr CLisdat article Phys. Rev. A 2014 6 25 89 6 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 063619 37.25.+k,03.67.Pp,03.65.Yz http://arxiv.org/abs/1405.4749 EMRP A169: Call 2012 Open excellence call American Physical Society

College Park, MD

30 1094-1622 10.1103/PhysRevA.89.063619 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. TVanderbruggen RKohlhaas ABertoldi ECantin ALandragin PBouyer article Radiation Protection Dosimetry 2014 6 10 161 1-4 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy microdosimetry, nanodosimetry, track structure EMRP A169: Call 2011 SI Broader Scope 30 0144-8420 10.1093/rpd/ncu187 59 No, EURAMET is never allowed to make the publication publicly available. D.Bianco C.Villagrasa M.Dos Santos proceedings Conference Proceedings of the 13th International Science-to-Business Marketing Conference on Cross Organizational Value Creation 2014 6 2 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 17-29 Color Technology, Automotive Coatings, Internships, Design Thinking, University-Business cooperation http://www.s2b-conference.com/ EMRP A169: Call 2012 Metrology for Industry (II) School of Management and Law

Fachhochschule Münster

Winterthur, Switzerland 13th International Science-to-Business Marketing Conference on Cross Organizational Value Creation 2-4/06/2014 30 978-3-938137-57-4 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. FMMartínez-Verdú VViquiera EPerales EChorro proceedings Proceedings of the 14th euspen International Conference 2014 6 1 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures 305-308 high precision system, calibration, thermo mechanical, control http://www.gbv.de/dms/tib-ub-hannover/79045372x.pdf EMRP A169: Call 2010 Industry Dubrovnik 14th euspen international conference June 2014 30 59 No, EURAMET is never allowed to make the publication publicly available. KBouderbala HNouira MGirault EVidecoq JSalgado DPetit article Organic Electronics 2014 6 15 6 IND07: Thin Films: Metrology for the manufacturing of thin films 1263-1272 Mobility, Space-charge limited current, Injection-limited current, Charge-carrier mobility, Mobility benchmark http://www.sciencedirect.com/science/article/pii/S1566119914000469 EMRP A169: Call 2010 Industry Elsevier 30 1566-1199 10.1016/j.orgel.2014.02.008 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. JCBBlakesley FACCastro WKKylberg GFADDibb RVValaskib WCCremona CAArantes JSKKim JSKKim article Journal of Optics 2014 5 8 16 6 IND07: Thin Films: Metrology for the manufacturing of thin films ellipsometry, thin films, large area http://iopscience.iop.org/article/10.1088/2040-8978/16/6/065701/meta EMRP A169: Call 2010 Industry IOP Publishing Ltd 30 2040-8978 10.1088/2040-8978/16/6/065701 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. RKKoops PSSonin MVVeghel OEGEl Gawhary article Phys. Rev. Lett. 2014 4 17 112 15 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 155304 67.85.−d, 03.67.Bg, 03.67.Mn, 03.75.Mn http://arxiv.org/abs/1403.4542v2 EMRP A169: Call 2012 Open excellence call American Physical Society

College Park, MD

30 1079-7114 10.1103/PhysRevLett.112.155304 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BLücke JPeise GVitagliano JArlt LSantos GTóth CKlempt article Biogeosciences 2014 4 8 11 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate 1873-1897 http://www.biogeosciences.net/11/1873/2014/bg-11-1873-2014.pdf EMRP A169: Call 2010 Environment European Geosciences Union (EGU)

Munich

30 1726-4170 10.5194/bg-11-1873-2014 1 59 No, EURAMET is never allowed to make the publication publicly available. ALLoew PMBvan Bodegom JLWWidlowski JOOtto TQQuaife BPPinty TRRaddatz article Journal of Low Temperature Physics 2014 3 18 175 5-6 SIB01: InK: Implementing the new kelvin 764-775 Johnson noise, Fixed point device, Precision, SQUID http://link.springer.com/article/10.1007/s10909-014-1147-z EMRP A169: Call 2011 SI Broader Scope Springer US

New York

30 1573-7357 10.1007/s10909-014-1147-z 1 59 No, EURAMET is never allowed to make the publication publicly available. ACasey FArnold L VLevitin C PLusher JNyeki JSaunders AShibahara Hvan der Vliet BYager DDrung ThSchurig GBatey M NCuthbert A JMatthews article Measurement Science and Technology 2014 3 25 4 IND07: Thin Films: Metrology for the manufacturing of thin films 044022 scanning thermal microscopy, thin films, thermal conductivity https://www.researchgate.net/publication/260559141_Thermal_conductivity_analysis_of_delaminated_thin_films_by_scanning_thermal_microscopy EMRP A169: Call 2010 Industry IOP Publishing 30 0957-0233 10.1088/0957-0233/25/4/044022 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. JMMartinek MVValtr RCCimrman PKKlapetek proceedings Proceedings of SPIE 2014 2 24 9018 IND52: XD Reflect: Multidimensional reflectometry for industry 901804 Reflectometry ; Metrology ; Modeling ; Optical design ; Optical testing ; Bidirectional reflectance transmission function ; CCD cameras ; Calibration ; Data analysis ; Light sources http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835520 EMRP A169: Call 2012 Metrology for Industry (II) SPIE - The International Society for Optical Engineering

Bellingham

San Francisco (USA) Measuring, Modeling, and Reproducing Material Appearance 4-5 February, 2014 30 978-0-8194-9935-6 0277-786X 10.1117/12.2035981 1 59 No option selected A.Höpe A.Koo F.-M.Verdu F.-B.Leloup G.Obein G.Wübbeler J.Campos P.Iacomussi P.Jaanson S.Källberg M.Smids proceedings Measuring, Modeling, and Reproducing Material Appearance 2014 2014 2 2 9018 90180K IND52: XD Reflect: Multidimensional reflectometry for industry 90180K-1 - 90180K-11 Special effect coatings, spectral BRDF, interference pigments, metallic coatings, rendering, spectrophotometry http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835535 EMRP A169: Call 2012 Metrology for Industry (II) SPIE

Bellingham WA, USA

San Francisco, California, USA IS&T/SPIE Electronic Imaging 2-6 February, 2014 30 9780819499356 0277786X 10.1117/12.2036726 1 59 No, EURAMET is never allowed to make the publication publicly available. AlejandroFerrero BertaBernad JoaquínCampos Francisco MMartínez-Verdú EstherPerales Ivovan de Lans Erickirchner article KivelPGVG2014 Spectrochimica Acta Part B 2014 1 27 B 93 SIB09: ELEMENTS: Primary standards for challenging elements 34-40 Multi-collector-ICP-MS, Mass discrimination, Shock wave formation, Direct Simulation Monte Carlo, High performance computing A169 EMRP A169: Call 2011 SI Broader Scope English 10.1016/j.sab.2013.12.010. 59 NA NikoKivel Heiko-DirkPotthast InesGünther-Leopold FrankVanhaecke DetlefGünther proceedings LapuhVKPSL2014 CPEM 2014 Digest 2014 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 420 - 421 Asynchronous sampling, arbitrary signals, time-domain windows, estimators, noise. http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250 A169 EMRP A169: Call 2012 SI Broader scope (II) Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements 24 - 29 August 2014 English 0589-1485 10.1109/CPEM.2014.6898438 1 59 NA RadoLapuh BostjanVoljc MihaKokalj BorutPinter ZoranSvetik MatjazLindic proceedings Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR 2014 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 442-443 Electron pumps, Cryogenic current comparator, Quantum metrology EMRP A169: Call 2011 SI Broader Scope Rio de Janeiro Conference on Precision Electromagnetic Measurements 24-29 August 2014 30 978-1-4799-2478-3 59 No, EURAMET is never allowed to make the publication publicly available. T.Charron L.Devoille S.Djordjevic O.Séron F.Piquemal P.Clapera S. J.Ray X.Jehl R.Wacquez M.Vinet proceedings Margolis2014 Proceedings of European Frequency and Time Forum & International Frequency Control Symposium (EFTF/IFC) 2014 SIB55: ITOC: International timescales with optical clocks 908-911 geodesy, international timescales, optical clock, redefinition of the second, time and frequency transfer http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6702183 EMRP A169: Call 2012 SI Broader scope (II) Prague, Czech Republic European Frequency and Time Forum & International Frequency Control Symposium (EFTF/IFC) 21 - 25 July 2013 English 10.1109/EFTF-IFC.2013.6702183 1 59 NA H.Margolis R.Godun P.Gill L.Johnson L.Shemar P.Whibberley D.Calonico F.Levi L.Lorini M.Pizzocaro P.Delva S.Bize J.Achkar H.Denker L.Timmen C.Voigt S.Falke D.Piester C.Lisdat U.Sterr S.Vogt S.Weyers J.Gersl T.Lindvall M.Merimaa article PaepenDMPVS2014 Applied Radiation and Isotopes 2014 87 ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants 320-324 Alpha-particle spectrometry; conversion electrons; manget; Alpha-particle emission probabilities http://www.sciencedirect.com/science/article/pii/S0969804313004430 A169 EMRP A169: Call 2009 Energy English 0969-8043 10.1016/j.apradiso.2013.11.023 1 59 NA JanPaepen AbdullahDirican MariaMarouli StefaanPommé RafVan Ammel HeikoStroh article PommeGMCJVPS2014 Applied Radiation and Isotopes 2014 87 1 ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants Alpha-particle spectrometry; 238U; Decay data; Alpha-particle emissionprobabilities A169 EMRP A169: Call 2009 Energy English 0969-8043 10.1016/j.apradiso.2013.11.075 1 59 NA StefaanPommé EduardoGarcía-Toraño MariaMarouli Maria-TeresaCrespo ViktorJobbágy RafVan Ammel JanPaepen HeikoStroh article PeksaGJVSKP2014_2 Vacuum 2014 101 IND12: Vacuum: Vacuum metrology for production environments orifice, multi-opening-orifice, orifice flow standard, gas throughput A169 EMRP A169: Call 2010 Industry English 0042-207X/$ 10.1016/j.vacuum.2013.10.014 1 59 NA LadislavPeksa TomášGronych MartinJeřáb MartinVičar FrantišekStaněk ZdeněkKrajíček DominikPražák article VargasNVPJ2014 Vacuum 2014 109 IND12: Vacuum: Vacuum metrology for production environments Unsteady vacuum gas dynamics, Binary mixtures, Gas separation, DSMC, Hybrid models, Rarefied gas dynamics. A169 EMRP A169: Call 2010 Industry English 10.1016/j.vacuum.2014.06.024 1 59 NA ManuelVargas SteryiosNaris DimitrisValougeorgis SarantisPantazis KarlJousten proceedings ClaperaRJSVB2014 Low Temperature Electronics (WOLTE), 2014 11th International Workshop on, IEEE 2014 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 73 to 76 http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6881029&pageNumber%3D42493%26rowsPerPage%3D75 A169 EMRP A169: Call 2011 SI Broader Scope Grenoble 11th International Workshop On Low Temperatures Electronics 7-9 July 2014 English 10.1109/WOLTE.2014.6881029 1 59 NA PClapera SRay XJehl MSanquer AValentian SBarraud proceedings VolkelSW2014 2014 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound 794 to 795 Circular piston, Sound Power, Hemianechoic room. A169 EMRP A169: Call 2012 SI Broader scope (II) Oldenburg, Germany Annual German Congress on Acoustics (DAGA 2014) 10 to 13 March 2014 978-3-939296-06-5 1 59 NA KVölkel MSchmelzer VWittstock article GonzalezGagoSVHH2014 Analytical and Bioanalytical Chemistry 2014 SIB09: ELEMENTS: Primary standards for challenging elements GD-OES. GD-MS. Glow discharge analysis. Oxygen determination A169 EMRP A169: Call 2011 SI Broader Scope English 10.1007/s00216-014-8186-9 1 59 NA C.Gonzalez-Gago P.Smid C.Venzago T.Hofmann V.Hoffmann proceedings KohlmannBKDSSTGMJONLIWLVBECHvO2014 CPEM 2014 Digest 2014 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 522 - 523 AC Josephson voltage standards European Metrology Research Programme (EMRP) binary-divided Josephson series arrays pulse-driven Josephson series arrays http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250 A169 EMRP A169: Call 2012 SI Broader scope (II) Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements 24 - 29 August 2014 English 0589-1485 10.1109/CPEM.2014.6898489 1 59 NA J.Kohlmann R.Behr O.Kieler J.Diaz de Aguilar Rois M.Sira A.Sosso B.Trinchera J.Gran H.Malmbekk B.Jeanneret F.Overney J.Nissilä T.Lehtonen J.Ireland J.Williams R.Lapuh B.Voljc T.Bergsten G.Eklund T.Coskun Ozturk E.Houtzager H.E.van den Brom P.Ohlckers article VorbringerDorozhovetsGMFHM2014 Meas. Sci. Technol. 2014 25 044006 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom nanopositioning and nanomeasuring machine, metrological scanning probe microscope, AFM, electromagnetic changer for SPM probes, fiducial marks A169 EMRP A169: Call 2012 Metrology for Industry (II) English 10.1088/0957-0233/25/4/044006 1 59 NA NVorbringer-Dorozhovets BGoj TMachleidt K-HFranke MHoffmann EManske proceedings Macroscale 2014 2014 IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products dimensional metrology, computed tomography, structural resolution, frequency response, spatial frequency EMRP A169: Call 2012 Metrology for Industry (II) Vienna Macroscale 2014 28-30 October, 2014 30 10.7795/810.20150223B 59 No, EURAMET is never allowed to make the publication publicly available. MatthiasFleßner NemanjaVujaklija EricHelmecke TinoHausotte proceedings Proceedings of NEWRAD 2014 2014 IND52: XD Reflect: Multidimensional reflectometry for industry 295-297 http://newrad2014.aalto.fi/Newrad2014_Proceedings.pdf EMRP A169: Call 2012 Metrology for Industry (II) Seongchong Park

Yuseong-gu

Helsinki NEWRAD 2014 2014 30 59 No, EURAMET is never allowed to make the publication publicly available. A.Höpe A.Koo C.Forthmann F. M.Verdú F.Manoocheri F. B.Leloup G.Obein G.Wübbeler G.Ged J.Campos K. O.Hauer L.Yang M.Šmíd M.Langovoy P.Iacomussi P.Jaanson S.Källberg article PAK 2014 60 02 (2014) IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 069-072 nanopositioning and nanomeasuring machine, metrological scanning probe microscope, SPM, AFM http://pak.info.pl/index.php?menu=artykulSzczegol&idArtykul=3967 EMRP A169: Call 2012 Metrology for Industry (II) PAK

Gliwice

30 59 No option selected N.Vorbringer-Dorozhovets E.Manske G.Jäger proceedings The EMRP Project GraphOhm - Towards Quantum Resistance Metrology Based on Graphene 2014 SIB51: GraphOhm: Quantum resistance metrology based on graphene 548-549 Measurement standards, resistance, quantum hall effect, graphene, C, Calibration, EMRP project GraphOhm, Electrical resistance measurement, Hall effect devices, JRP, Materials, Metrology, Resistance, Standards, electric resistance measurement, electrical measurement, intrinsically referenced resistance standard disse, joint research project, quantum resistance metrology standard, semiconductor quantum Hall device http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898502 EMRP A169: Call 2012 SI Broader scope (II) IEEE Rio de Janeiro 24-29 Aug. 2014 30 978-1-4799-2479-0 0589-1485 10.1109/CPEM.2014.6898502 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Ahlers J.Kučera W.Poirier B.Jeanneret A.Satrapinski A.Tzalenchuk P.Vrabček T.Bergsten C.Hwang R.Yakimova S.Kubatkin article International Journal of Thermophysics 2014 35 - SIB10: NOTED: Novel techniques for traceable temperature dissemination 1084-1096 Impurities; Raoult’s law; Water triple point cells; http://link.springer.com/article/10.1007/s10765-014-1702-5 EMRP A169: Call 2011 SI Broader Scope Springer US

-

30 ISSN: 1572-9567 10.1007/s10765-014-1702-5 1 59 No, EURAMET is never allowed to make the publication publicly available. A.Peruzzi M.Dobre J.van Geel A.Uytun M.Kalemci E.Uysa G.Strouse C.Davis article Proceedings of the 2014 International Symposium on EMC (EMC Europe) Gothenburg, Sweden 2014 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 605-610 power drive system; time variant periodic asynchronous; EFT; 150 kHz; LV-network; time-domain measurements http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=6930977 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, NJ

30 2325-0356 10.1109/EMCEurope.2014.6930977 1 59 No, EURAMET is never allowed to make the publication publicly available. B.J.A.M.van Leersum R.B.Timens F.J.K.Buesink F.B.J.Leferink article SantoniPPPMMGFDBTVV2013 Physics in Medicine and Biology 2013 11 58 22 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 8121-8133 electron beam, applicators, radiotherapy, silicon diode, diamond detector EMRP A169: Call 2011 Metrology for Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/0031-9155/58/22/8121 NA RSantoni GPrestopino FPompili MPimpinella EMilani M.Marinelli A SGuerra M DFalco CDi Venanzio PBagalà ATonnetti CVerona GVerona-Rinati proceedings 16th International Congress of Metrology 2013 10 7 - 2013 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 04003 - MAT http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_04003.pdf EMRP A169: Call 2011 Metrology for New Technologies EDP Sciences

Les Ulis & London

Paris 16th International Congress of Metrology 07-10-2013 to 10-10-2013 30 - - 10.1051/metrology/201304003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CElster KKlauenberg MBär AAllard NFischer GKok Avan der Veen PHarris MCox ISmith SCowen PWilson SEllison article AIP Conf. Proc. 1552 2013 9 11 8 958 ENG01: GAS: Characterisation of Energy Gases 958-963 Industrial high temperature measurement, radiation thermometry, high temperature thermocouples, high temperature fixed points http://www.npl.co.uk/content/ConPublication/5950 EMRP A169: Call 2009 Energy AIP Publishing LLC

1305 Walt Whitman Rd Suite 300, Melville, NY 11747, United States

30 978-0-7354-1178-4 10.1063/1.4821414 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31 GMachin KAnhalt FEdler JPearce MSadli RStrnad EVeulban article BertrandCCRLTSPRV2013 Physics in Medicine and Biology 2013 7 23 58 16 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 5363-5380 carbon ion beam, graphite to water dose conversion EMRP A169: Call 2011 Metrology for Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/0031-9155/58/16/5363 NA DBertrand GCuttone PCirrone FRomano NLee RThomas DShipley HPalmans SRossomme SVynckier article GeorgJCESPBHVA2013 Radiotherapy and Oncology 2013 7 108 1 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 99-106 Alanine; Audit; Carbon ions; Dosimetry; Protons EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 0167-8140 10.1016/j.radonc.2013.04.029 NA D.Georg O.Jäkel N.Chaudhri S.Ecker P.Sharpe H.Palmans N.Bassler R.Herrmann S.Vatnitsky A.Ableitinger article Phys. Rev. Lett. 2013 5 23 110 21 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 210503 03.67.-a, 03.65.Yz, 37.30.+i http://arxiv.org/abs/1207.3203 EMRP A169: Call 2012 Open excellence call American Physical Society

College Park, MD

30 1079-7114 10.1103/PhysRevLett.110.210503 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. TVanderbruggen RKohlhaas ABertoldi SBernon AAspect ALandragin PBouyer article MierRCV2013 2691 International Journal of Electrical Power and Energy Systems 2013 4 22 141 October 20 19ENG02: FutureEnergy: Metrology for future energy transmission Partial discharges, Calibration, PD sensors, Gas-insulated substations, Charge SEG https://authors.elsevier.com/sd/article/S0142-0615(22)00256-3 EMPIR 2019: Energy Elsevier 30 0142-0615 10.1016/j.ijepes.2022.108226 NA C.Mier A.Rodrigo Mor L.Castro P.Vaessen article AntonKKVGZM2013 Physics in Medicine and Biology 2013 3 24 58 (2013) 10 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 3259 - 3282 EPR, alanine, response, dosimetry, absorbed dose to water, megavoltage x-rays, high energy electrons A169 EMRP A169: Call 2011 Metrology for Health English 0031-9155 (print) ; 1361-6560 (online) 10.1088/0031-9155/58/10/3259 1 59 NA MathiasAnton Ralf-PeterKapsch AchimKrauss Philip vonVoigts-Rhetz GiessenGiessen-Friedberg KlemensZink MalcolmMcEwen article PHYSICS IN MEDICINE AND BIOLOGY 2013 3 12 58 7 HLT03: DUTy: Dosimetry for ultrasound therapy 2281-2304 Ultrasound, HIFU, blood vessels http://www.ncbi.nlm.nih.gov/pubmed/23478592 EMRP A169: Call 2011 Metrology for Health IOP publishing

Bristol

30 N/A 10.1088/0031-9155/58/7/2281 1 59 No, EURAMET is never allowed to make the publication publicly available. ATokarczyk IRivens EVan Bavel RSymonds-Tayler GTer Haar article BagalaFVVPMMDSP2013 Medical Physics 2013 1 24 40 2 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 021712 electron beam dosimetry, synthetic diamond detector EMRP A169: Call 2011 Metrology for Health Wiley-Blackwell 30 0094-2405 10.1118/1.4774360 NA P.Bagalà M. D.Falco G.Verona-Rinati C.Verona G.Prestopino E.Milani M.Marinelli C.Di Venanzio R.Santoni M.Pimpinella article JehlVCCRRSDDWV2013 Physical Review X 2013 3 021012 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 021012-1 - 021012-7 EMRP A169: Call 2011 SI Broader Scope English 1098-0121 10.1103/PhysRevX.3.021012 1 59 NA X.Jehl B.Voisin T.Charron P.Clapera S.Ray B.Roche M.Sanquer S.Djordjevic L.Devoille R.Wacquez M.Vinet article NowyVNBG2013 UV News: Newsletter of the Thematic Network for Ultraviolet Measurements 2013 9 ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation http://metrology.tkk.fi/uvnet/reports.htm EMRP A169: Call 2010 Environment English 1456-2537 1 59 NA S.Nowy N.Van Hung S.Nevas P.Blattner J.Gröbner proceedings AlexandrescuV2013 Proceedings of The 9th International Conference on Measurement 2013 ENG04: SmartGrid: Metrology for Smart Electrical Grids Power Quality, Photovoltaic System, Distribution Network Grid, Harmonics, Voltage Unbalance EMRP A169: Call 2009 Energy Smolenice, Slovakia The 9th International Conference on Measurement 27 - 30 May 2013 English 59 NA D.Alexandrescu P.Vrabcek proceedings IerardiFV2013 Journal of Physics: Conference Series 2013 439 012033 IND12: Vacuum: Vacuum metrology for production environments http://iopscience.iop.org/1742-6596/439/1/012033 EMRP A169: Call 2010 Industry IOP Islamabad, Pakistan 6th Vacuum and Surface Sciences Conference of Asia and Australia 9 - 13 October 2012 English 10.1088/1742-6596/439/1/012033 1 59 NA V.Ierardi G.Firpo U.Valbusa article JobbagyTVMMPG2013 Journal of Radioanalytical and Nuclear Chemistry 2013 298 ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants 345-352 238U, High-resolution alpha-spectrometry, Alpha-emission probability, Electrodeposition http://rd.springer.com/article/10.1007%2Fs10967-013-2444-8# EMRP A169: Call 2009 Energy English 0236-5731 10.1007/s10967-013-2444-8 1 59 NA V.Jobbágy M.Teresa Crespo R.Van Ammel M.Marouli A.Moens S.Pommé E.García-Toraño proceedings MerloneLABBBdDDEGGHHJKKMMMdSSSSSV2013 AIP Conference Proceedings 2013 8 1552 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 1030-1035 air humidity, air pressure, air temperature, air speed and direction, historical temperature data series, meteorological instruments calibration, traceable climate measurements http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821419 EMRP A169: Call 2010 Environment Los Angeles (USA) 9th International Temperature Symposium 19-23 March 2012 10.1063/1.4821419 1 59 NA A.Merlone G.Lopardo I.Antonsen S.Bell RBenyon N.Boese D.del Campo M.Dobre J.Drnovsek A.Elkatmis E.Georgin E.Grudniewicz M.Heinonen C.Holstein-Rathlou J.Johansson P.Klason R.Knorova C.Melvad J.Merrison K.Migaa M.de Podesta H.Saathoff D.Smorgon F.Sparasci R.Strnad A.Szmyrka-Grzebyk E.Vuillermoz article VargasNVPJ2013 Journal of Vacuum Science and Technology A 2013 32 2 IND12: Vacuum: Vacuum metrology for production environments vacuum, kinetic theory, Knudsen number, dynamic gas espansion, hybrid modeling A169 EMRP A169: Call 2010 Industry English 10.1116/1.4830283 1 59 NA ManuelVargas SteryiosNaris DimitrisValougeorgis SarantisPantazis KarlJousten article PraakZTP2013 Measurement 2013 46 IND12: Vacuum: Vacuum metrology for production environments 621-627 vacuum leak; atmospheric leak; vacuum weighing; mass comparator A169 EMRP A169: Call 2010 Industry English 0263-2241 10.1016/j.measurement.2012.08.021 1 59 NA D.Pražák J.Zůda J.Tesař LPeksa M.Vicar proceedings WintervOHSMGSMN Proc. Intl. Soc. Mag. Reson. Med. 2013 21 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI http://www.ismrm.org/13/ A169 EMRP A169: Call 2011 Metrology for Health Salt Lake City, USA ISMRM 21st Annual Meeting & Exhibition 2013 20-26 April 2013 1 59 NA LukasWinter Tessavan de Lindt CelalÖzerdem WernerHoffmann DavideSantoro AlexanderMueller AndreasGraessl ReinerSeemann JaroslavMarek ThoralfNiendorf article AIP Conference Proceedings 2013 1552 ENG01: GAS: Characterisation of Energy Gases 672-677 transfer function, size-of-source effect http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4819622 EMRP A169: Call 2009 Energy AIP Publishing

New York

30 978-0-7354-1178-4 10.1063/1.4819622 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31 E.M.Vuelban P.R.Dekker proceedings VoigtB2012 2012 10 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures Optical metrology; dimensional stability; sensor calibration; displacement interferometry http://www.congrexprojects.com/custom/icso/2012/papers/FP_ICSO-123.pdf A169 EMRP A169: Call 2010 Industry Ajaccio, France International Conference on Space Optics 2012 1 59 NA DirkVoigt Rob H.Bergmans proceedings HoutzagerRHEv2012 Proceedings of the Conference on Precision Electromagnetic Measurements 2012 2012 1 ENG07: HVDC: Metrology for High Voltage Direct Current HVDC, resistors, metrology, voltage coefficient, temperature coefficient, high-voltage techniques, resistance measurement EMRP A169: Call 2009 Energy IEEE Washington DC, USA CPEM 2012 01 - 06 July 2012 English 1 59 NA E.Houtzager G.Rietveldt J.Hällström A.-P.Elg J. H. N.van der Beek article PoglianoBVL2012 IEEE Transactions on Instrumentation and Measurement 2012 62 6 ENG04: SmartGrid: Metrology for Smart Electrical Grids 412-413 EMRP A169: Call 2009 Energy English 0018-9456 10.1109/TIM.2013.2239051 1 59 NA U.Pogliano J.Braun B.Voljc R.Lapuh article PollingerHVDAMM2012 Measurement Science and Technology 2012 23 2 T3.J3.1: Long distance: Absolute long distance measurement in air 025502-025503 http://stacks.iop.org/MST/23/025503 iMERA-Plus: Call 2007 Length English 1 59 NA F.Pollinger T.Hieta M.Vainio N. R.Doloca A.Abou-Zeid K.Meiners-Hagen M.Merimaa proceedings BosMv2012 Proceedings of the 27th Annual Meeting of the American Society for Precision Engineering 2012 54 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 85-88 EMRP A169: Call 2010 Industry San Diego, CA USA 27th Annual Meeting of the American Society for Precision Engineering 21 - 26 October 2012 English 978-1-887706-61-2 1 59 NA E.Bos A.Moers M.van Riel proceedings VolkersB2012 Proceedings of the XX IMEKO World Congress : Metrology for Green Growth 2012 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities http://www.imeko.org/publications/wc-2012/IMEKO-WC-2012-TC22-O6.pdf EMRP A169: Call 2010 Industry Busan, Republic of Korea XX IMEKO World Congress : Metrology for Green Growth 9 - 14 September 2012 978-89-9500005-2 10.21014/acta_imeko.v2i2.81 1 59 NA H.Volkers T.Bruns article BriscoeSVCWD2012 Advanced Energy Materials 2012 2 ENG02: Harvesting: Metrology for Energy Harvesting 1261-1268 EMRP A169: Call 2009 Energy English 59 NA J.Briscoe M.Stewart M.Vopson M.Cain P.Weaver S.Dunn article VillamarinFPCRHVC2012 Optica Pura y Aplicada 2012 45 2 ENG05: Lighting: Metrology for Solid State Lighting 131-136 LEDs, Gonio‐Spectro‐Photometer, Luminous Intensity, LED Angular Distribution, LED Emission, Spectral Distribution, High Brightness, White LEDs http://www.scopus.com/inward/record.url?eid=2-s2.0-84871420576&partnerID=65&md5=a928625cebaaaba8080da7225160b9ff EMRP A169: Call 2009 Energy Spanish 2171-8814 10.7149/OPA.45.2.131 1 59 NA A.Villamarin A.Ferrero A.Pons J.Campos A.Rabal M.Hernanz J.Velásquez A.Corrons inbook VelasquezCPFH2013 2012 ENG05: Lighting: Metrology for Solid State Lighting Visión mesópica, medidor mesópico, fotometría mesópica EMRP A169: Call 2009 Energy Joaquin Campos, Esther Perales and Rafael Huertas Copicentro Granada S.L. Ciencia y Tecnología del Color Spanish 978-84-15536-60-4 1 59 NA J.Velásquez J.Campos A.Pons A.Ferrero M.Hernanz proceedings VillamarinVPFCH2013 Proceedings of X Reunión Nacional de Óptica 2012 ENG05: Lighting: Metrology for Solid State Lighting EMRP A169: Call 2009 Energy Zaragoza, Spain X Reunión Nacional de Óptica 04 September 2012 English 1 59 NA A.Villamarin J.Velásquez A.Pons A.Ferrero J.Campos M.Hermanz article LopezBRVSS2012 Metrologia 2012 49 2 ENG05: Lighting: Metrology for Solid State Lighting http://iopscience.iop.org/0026-1394/49/2/S141 EMRP A169: Call 2009 Energy English ISSN 0026-1394 10.1088/0026-1394/49/2/S141 1 59 NA M.López K.Bredemeier N.Rohrbeck C.Véron F.Schmidt A.Sperling article VandeWieleMVBDD2012 Journal of Applied Physics 2012 111 5 IND08: MetMags: Metrology for Advanced Industrial Magnetics 053915 - 053915-9 Micromagnetic modelling, Magnetic nanostructures, Magnetization reversal, Patterned films, Numerical models A169 EMRP A169: Call 2010 Industry English 0021-8979 (print) 1089-7550 (online) 10.1063/1.3689846 1 59 NA B.Van de Wiele A.Manzin A.Vansteenkiste O.Bottauscio L.Dupré D.De Zutter article KipphardtSSGFDBMBRV2012 Metrologie Revue 2012 59 3/4 SIB09: ELEMENTS: Primary standards for challenging elements Primary standard, elemental calibration solutions, metrology in chemistry, traceability. http://www.inm.ro/pdf/2012-3-4-03-etaloane-primare.pdf A169 EMRP A169: Call 2011 SI Broader Scope English 1 59 NA H.Kipphardt D.Schiel M.Sargent H.Goenaga-Infante P.Fisicaro G.D’Agostino L.Bergamasch M.Máriássy M.Buzoianu S.Richter J.Vogl proceedings FluggeBJMPRSSSVV2012 2012 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures A169 EMRP A169: Call 2010 Industry Stockholm, Sweden Proceedings of the 12th euspen International Conference June 2012 978-0-9566790-0-0 1 59 NA J.Flügge E.Beckert N.Jennett T.Maxwell D.Petit S.Rudtsch J.Salgado M.Schalles R.Schödel D.Voigt M.Voigt proceedings BodermannBDBSKWKHKvYSEBS2011 AIP Conference Proceedings 2011 11 10 1395 319 (2011) IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices Scatterometry, CD metrology, AFM, reference standard, rigorous modelling, inverse diffraction problem EMRP A169: Call 2010 Industry American Institute of Physics Grenoble, France International Conference on Frontiers of Characterisation and Metrology for Nanoelectronics FCMN 2011 23-26 May 2011 30 10.1063/1.3657910 1 59 NA B.Bodermann E.Buhr H.-U.Danzebrink M.Bär F.Scholze M.Krumrey M.Wurm P.Klapetek P.-E.Hansen V.Korpelainen M.van Veghel A.Yacoot S.Siitonen O.El Gawhary S.Burger T.Saastamoinen article PramannRSGV2011 International Journal of Mass Spectrometry 2011 8 1 305 1 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram Molar mass, Silicon, MC-ICP-MS, Isotope dilution mass spectrometry, Measurement uncertainty, Avogadro constant iMERA-Plus: Call 2007 SI and Fundamental Metrology 1 59 NA A.Pramann O.Rienitz D.Schiel B.Guettler S.Valkiers article RietveldvH2011 IEEE Transactions on Instrumentation and Measurement 2011 7 60 7 T4.J01: Power & Energy: Next generation of power and energy measuring techniques 2191-2194 Current shunts , current , environmental factors , measurement standards , power coefficient , power measurements , stability , temperature coefficient SEG iMERA-Plus: Call 2007 Electricity and Magnetism 1 59 NA GertRietveld J.H.N.van der Beek ErnestHoutzager article BoscoGLPRTVN2011 IEEE Transactions on Instrumentation and Measurement 2011 7 60 7 T4.J01: Power & Energy: Next generation of power and energy measuring techniques 2359-2365 SEG iMERA-Plus: Call 2007 Electricity and Magnetism 1 59 NA Gian CarloBosco MartinGarcocz KareLind UmbertoPogliano GertRietveld ValterTarasso BostjanVoljc VeraNovakova Zachovalova article AndreasABBBBBFFFKKKMNPPRSVWZ2011 Metrologia 2011 3 22 48 2 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram Avogadro constant, kilogram redefinition, silicon, XRCD method iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0026-1394/48/2/S01 1 59 NA B.Andreas Y.Azuma G.Bartl P.Becker H.Bettin M.Borys I.Busch P.Fuchs K.Fujii H.Fujimoto E.Kessler M.Krumrey U.Kuetgens N.Mizushima A.Nicolaus A.Picard A.Pramann O.Rienitz D.Schiel S.Valkiers A.Waseda S.Zakel article PramannRSSGV2011 Metrologia 2011 3 22 48 2 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram Molar mass, Silicon, Isotope dilution mass spectrometry iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0026-1394/48/2/S03 1 59 NA A.Pramann O.Rienitz D.Schiel J.Schlote B.Guettler S.Valkiers article ValkiersMFB2011 Metrologia 2011 3 22 48 2 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram Molar mass, Silicon, isotope amount ratios iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0026-1394/48/2/S04 1 59 NA S.Valkiers G.Mana K.Fujii P.Becker article BulskaDMPRSV2011 Metrologia 2011 3 22 48 2 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram Molar mass, Silicon, isotopic composition, gas mass spectrometry, MC-ICP-MS iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0026-1394/48/2/S05 1 59 NA E.Bulska M. N.Drozdov G.Mana A.Pramann O.Rienitz P.Sennikov S.Valkiers article HughesFLSVN2011 Measurement Science and Technology 2011 3 22 045103 T3.J2.2: NIMTech: Metrology for New Industrial Measurement Technologies 12pp. iMERA-Plus: Call 2007 Length 10.1088/0957-0233/22/4/045103 1 59 NA B.Hughes A.Forbes A.Lewis W.Sun D.Veal K.Nasr article ParedisCFBWCVC2011 1224 AIP Advances 2011 2 19 9 2 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 025105 conductive AFM, organic semiconductor, nanostructure, scanning probe tomography, nanowire https://aip.scitation.org/doi/full/10.1063/1.5066458 EMPIR 2016: Energy AIP publishing 30 2158-3226 10.1063/1.5066458 NA R.C.Chintala S.Wood J.C.Blakesley P.Favia U.Celano K.Paredis W.Vandervorst F.A.Castro article AndreasABBBBBGFFFKKKKMMMMNPPRSVW2011 Physical Review Letters 2011 1 21 106 3 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram Avogadro constant, kilogram redefinition, silicon, XRCD method iMERA-Plus: Call 2007 SI and Fundamental Metrology English 1 59 NA B.Andreas Y.Azuma G.Bartl P.Becker H.Bettin M.Borys I.Busch M.Gray P.Fuchs K.Fujii H.Fujimoto E.Kessler M.Krumrey U.Kuetgens N.Kuramoto G.Mana P.Manson E.Massa S.Mizushima A.Nicolaus A.Picard A.Pramann O.Rienitz D.Schiel S.Valkiers A.Waseda article JeanneretROvH2011 Metrologia 2011 48 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 311-316 Only available as publisher's version. iMERA-Plus: Call 2007 Electricity and Magnetism English 10.1088/0026-1394/48/5/011 1 59 NA B.Jeanneret A.Ruefenacht F.Overney H.van den Brom E.Houtzager article HaldNPVP2011 Optics Express 2011 19 3 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin 2052-2063 iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1364/OE.19.002052 1 59 NA J.Hald L.Nielsen J. C.Petersen P.Varming J. E.Pedersen article StoicaYVF2011 Journal of Solution Chemistry 2011 40 ENG09: Biofuels: Metrology for Biofuels 1819-1834 EnG EMRP A169: Call 2009 Energy 1 59 NA D.Stoica Y.Yardin S.Vaslin-Reimann P.Fisicaro proceedings VillamarinFPCHC2013 Proceedings of VII Reunión Española de Optoelectrónica OPTOEL 2011 2011 ENG05: Lighting: Metrology for Solid State Lighting Gonio-spectro-photometer, radiant intensity, angular distribution, emission, spectral distribution, high brightness LEDs EMRP A169: Call 2009 Energy Santander, Spain VII Reunión Española de Optoelectrónica OPTOEL 2011 19 June 2011 Spanish 1 59 NA A.Villamarin A.Ferrero A.Pons J.Campos M.Hernanz A.Corrons article CerasoliRHRBVR2010 Molecular BioSystems 2010 8 23 6 11 T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine 2214-2217 iMERA-Plus: Call 2007 Health 1 59 NA E.Cerasoli P. D.Rakowska A.Horgan J.Ravi M.Bradley B.Vincent M.Ryadnov article FerreroAMNv2010 2794 Sensors 2010 5 22 22 10 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 3610 thermal therapies, electromagnetic hyperthermia, RF applicator, TEM mode, coaxial cable, electromagnetic modelling, thermal modelling, temperature measurements, phantoms https://www.mdpi.com/1424-8220/22/10/3610 EMPIR 2018: Health MDPI 30 10.3390/s22103610 NA R.Ferrero I.Androulakis L.Martino R.Nadar G.C.van Rhoon article ValkiersVBd2010 International Journal of Mass Spectrometry 2010 3 291 1-2 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin 41-47 no pdf available iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1016/j.ijms.2010.01.004 1 59 NA S.Valkiers D.Vandelbo M.Berglund M.de Podesta proceedings vandenBromH2010 2010 Conference on Precision Electromagnetic Measurements digest 2010 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 6-7 iMERA-Plus: Call 2007 Electricity and Magnetism Daejeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13-18 June, 2010 English 1 59 NA Helko E.van den Brom ErnestHoutzager article PersijnHv2010 Applied Physics B 2010 100 T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection 383-390 iMERA-Plus: Call 2007 Health English 10.1007/s00340-009-3875-3 1 59 NA S.Persijn F.Harren A.van der Veen article SuttonUPdV2010 International Journal of Thermophysics 2010 31 7 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin 1310-13-46 no pdf available iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1007/s10765-010-0722-z 1 59 NA G.Sutton R.Underwood L.Pitre M.de Podesta S.Valkiers proceedings TarassoZGLMPRV2010 2010 Conference on Precision Electromagnetic Measurements (CPEM) 2010 T4.J01: Power & Energy: Next generation of power and energy measuring techniques power and energy, ac-dc transfer, shunts, wideband, power coefficient SEG iMERA-Plus: Call 2007 Electricity and Magnetism Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 1 59 NA V.Tarasso V.N.Zachovalová M.Garcocz K.Lind T.Mansten U.Pogliano G.Rietveld B.Voljc article JitaruGVF2010 Analytica Chimica Acta 2010 657 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 100-107 Human serum; Speciation analysis; Selenoaminoacids and selenoproteins; High performance liquid chromatography coupled to inductively coupled plasma-mass spectrometry; Species-specific isotope dilution iMERA-Plus: Call 2007 Health English 1 59 NA PetruJitaru HeidiGoenaga-Infante SophieVaslin-Reimann article PinotMGGHLVH2010 Revue Française de Métrologie 2010 21 1 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram 9-21 flexure pivot, stiffness, gimbals, watt balance, copper-beryllium alloy iMERA-Plus: Call 2007 SI and Fundamental Metrology French 1 59 NA PatrickPinot StéphaneMacé GérardGenevès PierreGournay DarineHaddad MichelLecollinet FrancoisVillar MarcHimbert proceedings VillarGD2010 2010 Conference on Precision Electromagnetic Measurements (CPEM) 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA F.Villar G.Genevès J.David proceedings GenevesBEGJVDMPBP2010 2010 Conference on Precision Electromagnetic Measurements (CPEM) 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA G.Genevès F.Bielsa A.Eichenberger O.Gilbert P.Juncar F.Villar G.D'Agostino S.Merlet P.Pinot H.Baumann F.Pereira Dos Santos article SegoviaVMGTd2010 International Journal of Thermophysics 2010 31 7 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin 1294-1309 iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1007/s10765-010-0746-4 1 59 NA J. J.Segovia D.Vega Maza M. C.Martin E.Gomez C.Tabacaru D.del Campo article JitaruRBVF2010 Accreditation and Quality Assurance 2010 15 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 343-350 iMERA-Plus: Call 2007 Health English 1 59 NA PetruJitaru MarcoRoman C.Barbante SophieVaslin-Reimann PaolaFisicaro proceedings KazakovavPH2009 IEEE TRANSACTIONS ON MAGNETICS 2009 10 45 10 T4.J02: NanoSpin: Nanomagnetism and Spintronics No pdf received iMERA-Plus: Call 2007 Electricity and Magnetism Sacramento, CA, USA International Magnetics Conference 2009 (INTERMAG) 4 - 8 May 2009 English 10.1109/TMAG.2009.2023073 1 59 NA O.Kazakova M. I.van der Meulen N.Petkov J. D.Holmes article ManaMVW2009 International Journal of Mass Spectrometry 2009 9 11 289 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram 6-10 Isotope ratio mass spectrometry; Si molar mass; metrology; measurement uncertainty iMERA-Plus: Call 2007 SI and Fundamental Metrology English 1 59 NA G.Mana E.Massa S.Valkiers G.-D.Willenberg article BeckerFFGMPPRV2009 Measurement Science and Technology 2009 8 21 20 092002 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram 20 pages Avogadro constant determination; kilogram rede?nition; fundamental physical constants; enriched silicon-28; mass measurements; density measurements; molar mass measurements; lattice parameter measurements; volume measurements; crystal characterization; x-ray, interferometry; optical interferometry iMERA-Plus: Call 2007 SI and Fundamental Metrology English 1 59 NA P.Becker H.Friedrich K.Fujii W.Giardini G.Mana A.Picard H.-J.Pohl H.Riemann S.Valkiers article Rietveldv2009 IEEE Transactions on Instrumentation and Measurement 2009 4 58 4 T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere 967-972 Air-gap capacitor, capacitance measurement, current measurement, humidity dependence, small currents iMERA-Plus: Call 2007 SI and Fundamental Metrology English 1 59 NA GertRietveld Helko E.van den Brom article BuschVB2009 French College of Metrology 2009 2 - - T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram 6 pages iMERA-Plus: Call 2007 SI and Fundamental Metrology ISTE-Wiley English 1 59 NA I.Busch S.Valkiers P.Becker article vanderMeulenPMKHWJH2009 Nano Letters 2009 1 9 1 T4.J02: NanoSpin: Nanomagnetism and Spintronics No pdf received FIELD-EFFECT TRANSISTORS; GERMANIUM NANOWIRES; MAGNETIC-PROPERTIES; SURFACE-CHEMISTRY; GE NANOWIRES; NANOCRYSTALS; NANOPARTICLES; MN3O4; FERROMAGNETISM; SEMICONDUCTORS iMERA-Plus: Call 2007 Electricity and Magnetism English 10.1021/nl802114x 1 59 NA M. I.van der Meulen N.Petkov M. A.Morris O.Kazakova X. H.Han K. L.Wang A. P.Jacob J. D.Holmes article vandenBromHVMR2009 IEEE Transactions on Instrumentation and Measurement 2009 58 10 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 3806-3812 AC Josephson voltage standards; binary Josephson arrays; measurement standards; sampling voltmeter; voltage measurement iMERA-Plus: Call 2007 Electricity and Magnetism English 0018-9456 1 59 NA H. E.van den Brom E.Houtzager S.Verhoeckx Q. E.Martina G.Rietveld article HoutzagerBv2009 IEEE Transactions on Instrumentation and Measurement 2009 58 4 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 775-780 AC voltage standard; digital-to-analog conversion; Josephson arrays; signal synthesis; superconductor-normal-superconductor devices; voltage measurement iMERA-Plus: Call 2007 Electricity and Magnetism English 0018-9456 1 59 NA E.Houtzager S. P.Benz H. E.van den Brom article BallingKMv2009 Optics Express 2009 17 11 T3.J3.1: Long distance: Absolute long distance measurement in air 9300-9313 iMERA-Plus: Call 2007 Length English 10.1364/OE.17.009300 1 59 NA PetrBalling PetrKřen PavelMašika S.A.van den Berg proceedings KramerBvDDDKKKKPS2009 Proceedings 14th International Congress of Metrology 2009 T2.J07: EBCT: External Beam Cancer Therapy iMERA-Plus: Call 2007 Health Paris 14th International Congress of Metrology 22 - 25 June 2009 English 1 59 NA H.-M.Kramer J.-M.Bordy E.van Dijk J.Dobrovodsky S.Duane G.Durando R.-P.Kapsch B.Karaböce Ch.Koch A.Kosunen M.Pimpinella A.Shaw article TrincheroSLGFdABTBV2009 IEEE Antennas and Wireless Propagation Letters 2009 8 T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive 224-227 iMERA-Plus: Call 2007 Electricity and Magnetism English 1 59 NA D.Trinchero R.Stefanelli F.Longobardi A.Galardini B.Fiorelli G.d'Amore L.Anglesio A.Benedetto S.Trinchero M.Borsero G.Vizio article TrincheroSLGFdABTBV2009_2 IEEE Antennas and Wireless Propagation Letters 2009 8 T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive 494-497 iMERA-Plus: Call 2007 Electricity and Magnetism English 1 59 NA D.Trinchero R.Stefanelli F.Longobardi A.Galardini B.Fiorelli G.d'Amore L.Anglesio A.Benedetto S.Trinchero M.Borsero G.Vizio article AlfonsoACSKKMPRSUV2008 Medical Physics 2008 35 T2.J07: EBCT: External Beam Cancer Therapy 5179-5186 iMERA-Plus: Call 2007 Health English 10.1118/1.3005481 1 59 NA R.Alfonso P.Andreo R.Capote M.Saiful Huq W.Kilby P.Kjäll T. R.Mackie H.Palmans K.Rosser J.Seuntjens W.Ullrich S.Vatnitsky miscellaneous KuipervNV 2245 American Journal of Reproductive Immunology 85 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses e13350 extracellular vesicles, standardization, flow cytometry, calibration, data interpretation EMPIR 2018: Health John Wiley & Sons Ltd 1600-0897 10.5281/zenodo.4561815 NA M.Kuiper A.van de Nes R.Nieuwland Z.Varga article NwabohMLPLvCPQWE 1790 The Analyst 16ENG05: Biomethane: Metrology for biomethane biomethane, laser spectroscopy, TDLAS, hydrogen chloride, ion chromatography EnG EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 0003-2654, 1364-5528 10.1039/d0an01955k NA J.A.Nwaboh H.Meuzelaar J.Liu S.Persijn J.Li A.M.H.van der Veen N.Chatellier A.Papin Z.Qu O.Werhahn V.Ebert manual vanderVeen_2 1783 16ENG05: Biomethane: Metrology for biomethane biomethane, conformity assessment, test methods EnG http://empir.npl.co.uk/biomethane/wp-content/uploads/sites/28/2020/11/EMPIR-16ENG05-D11_Methods_for_biomethane_characterisation.pdf EMPIR 2016: Energy 30 NA http://empir.npl.co.uk/biomethane/wp-content/uploads/sites/28/2020/11/EMPIR-16ENG05-D11_Methods_for_biomethane_characterisation.pdf A.M.H.van der Veen miscellaneous BosnjakoviKav 2068 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards measurement uncertainty evaluation, power transformers losses, Monte Carlo method, law of propagation of uncertainty EMPIR 2017: Pre-Co-Normative NA https://zenodo.org/record/4896452 A.Bošnjakovic V.Karahožić M.Čaušević A.M.H.van der Veen miscellaneous TiainenVHH 2265 19ENG07: Met4Wind: Metrology for enhanced reliability and efficiency of wind energy systems Multi-probe roundness data, Electrical runout data, simultaneous tactile and eddy current probe measurement, Scaling EMPIR 2019: Energy 1 NA https://zenodo.org/record/5615524 T.Tiainen R.Viitala T.Holopainen B.Hemming miscellaneous Vasilatou 2148 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality Calibration, Optical particle size spectrometers, Counting efficiency, Polystyrene particles, Standardisation EMPIR 2019: Environment NA https://doi.org/10.5281/zenodo.5141907 K.Vasilatou miscellaneous PeinerVFMABLBXDBKDH 1495 Open Access Repository PTB 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements cantilever microprobe, high-speed, contact resonance, tip wear, piezo-resistive, mechanical damping, tip-testing standard, cantilevers, micromechanical devices, surface topography measurement, shape measurement https://oar.ptb.de/resources/show/10.7795/720.20200515 EMPIR 2017: Industry Physikalisch-Technische Bundesanstalt (PTB) 1 10.7795/720.20200515 NA U.Brand M.XU L.Doering J.Langfahl-Klabes H.Behle S.Bütefisch T.Ahbe B.Mickan E.Peiner S.Völlmeke T.Frank I.Kiselev M.Drexel M.Hauptmannl miscellaneous KlauiJPDGVCCK 1350 Zenodo N/A 17FUN08: TOPS: Metrology for topological spin structures N/A skyrmion, AFM, manipulation, nanomagnetism EMPIR 2017: Fundamental Zenodo 197 N/A NA https://zenodo.org/record/3601425 M.Kläui G.Jakob M.Pasquale G.Durin F.Garcia-Sanchez M.Vafaee H.Corte-León A.Casiraghi O.Kazakova miscellaneous SousaBDFPRMRv 2158 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty, Microflow, Bayesian EMPIR 2017: Pre-Co-Normative 10.5281/zenodo.5497823 NA J.A.Sousa E.Batista S.Demeyer N.Fischer O.Pelegrino A.S.Ribeiro L.L.Martins MReader-Harris A.M.Hvan der Veen miscellaneous AlKhafajiGWBV 2246 Materials 13 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses 3101 silica nanoparticle, size distribution, light scattering, small-angle X-ray scattering, microfluidic resistive pulse sensing EMPIR 2018: Health Multidisciplinary Digital Publishing Institute 1996-1944 10.5281/zenodo.4545822 NA M.Al-Khafaji A.Gaál A.Wacha A.Bóta Z.Varga miscellaneous FerreroCBVSYACMT 2164 Zenodo 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations EMPIR 2018: Health 10.5281/zenodo.5040394 NA R.Ferrero F.Celegato G.Barrera M.Vicentini H.Sözeri N.Yıldız C.Atila Dinçer M.Coïsson A.Manzin P.Tiberto miscellaneous VedurmudiGD 2171 Zenodo 17IND12: Met4FoF: Metrology for the Factory of the Future dynamic measurement, measurement uncertainty, sensor network, digital sensors, MEMS, machine learning, European Union (EU), Horizon 2020, EMPIR https://zenodo.org/record/5185953#.YUnXrn1CSUk EMPIR 2017: Industry NA https://zenodo.org/record/5185953 A.P.Vedurmudi M.Gruber T.Dorst miscellaneous VedurmudiGD0 2171 Zenodo 17IND02: SmartCom: Communication and validation of smart data in IoT-networks dynamic measurement, measurement uncertainty, sensor network, digital sensors, MEMS, machine learning, European Union (EU), Horizon 2020, EMPIR https://zenodo.org/record/5185953#.YUnXrn1CSUk EMPIR 2017: Industry 1 NA https://zenodo.org/record/5185953 A.P.Vedurmudi M.Gruber T.Dorst miscellaneous MilanoLLBRV 2237 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology effect of moisture on electroforming, electrical conductivity, memristors, nanostructures, resistive switching EMPIR 2020: Fundamental 1 10.5281/zenodo.5095263 NA G.Milano M.Luebben M.Laurenti L.Boarino C.Ricciardi I.Valov miscellaneous MierEscurraMV 2498 IEEE SENSORS JOURNAL 21, Sept 2 19ENG02: FutureEnergy: Metrology for future energy transmission 18618- 18625 Magnetic loop antenna, partial discharges, transfer function, electric circuit, GIS, broadband antenna,VHF, high voltage SEG EMPIR 2019: Energy IEEE 1 N/A NA https://zenodo.org/record/5913233 C.Mier Escurra A.R.Mor P.Vaessen miscellaneous VidiMRHAUPPM 2562 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Specific heat, High temperature, Tungsten EMPIR 2017: Industry ZENODO NA https://zenodo.org/record/6091579 S.Vidi J.Manara R.Razouk B.Hay K.Anhalt D.Urban P.Pichler G.Pottlacher N.Milosevic miscellaneous VidiMRHAUPPM_2 2561 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Specific heat, High temperature, Molybdenum EMPIR 2017: Industry ZENODO NA https://zenodo.org/record/6091492 S.Vidi J.Manara R.Razouk B.Hay K.Anhalt D.Urban P.Pichler G.Pottlacher N.Milosevic miscellaneous HohlsVSWKS 2632 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements single-electron source, control of error mechanism, non-adiabatic single-electron pump EMPIR 2017: Fundamental NA https://zenodo.org/record/6046089 F.Hohls V.Vyacheslavs Kashcheyevs F.Stein T.Wenz B.Kaestner H.W.Schumacher