This file was created by the TYPO3 extension bib --- Timezone: CEST Creation date: 2022-08-17 Creation time: 13-01-54 --- Number of references 1074 article KallioMFKNRHLGPHDCMKHS2022 2814 Journal of Power Sources 2022 9 15 542 17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications 231814 Electrochemical impedance spectroscopy, Equivalent circuit, Distribution of relaxation times, Nonlinear frequency response analysis, State-of-health prediction https://www.sciencedirect.com/science/article/pii/S0378775322008035 EMPIR 2017: Industry Elsevier BV 30 0378-7753 10.1016/j.jpowsour.2022.231814 NA T.Kallio J.Moškon E.Fedorovskaya P.Kauranen E.Napolitano V.Ruiz M.Heinrich Y.Y.Lee M.Gaberšček J.Park T.P.Heins E.J.F.Dickinson H.S.Chan S.Mousavihashemi U.Krewer G.Hinds S.Seitz article ZanovelloCBBAAZCB2022 2823 Diagnostics 2022 8 12 8 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 1873 MRI heating risk, MRI safety, orthopaedic implants, radiofrequency-induced heating, gradient-induced heating. https://www.mdpi.com/2075-4418/12/8/1873 EMPIR 2017: Industry MDPI AG 30 2075-4418 10.3390/diagnostics12081873 NA U.Zanovello M.Chiampi B.Bordini F.Baruffaldi C.Ancarani A.Arduino L.Zilberti V.Clementi O.Bottauscio proceedings CostaMPT2022 2817 IEEE 2022 7 20 1 1 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements 1-6 Low power instrument transformer, Rogowskicoil, LPCT, distorted signals, power quality, temperature, humidity, influence quantities https://ieeexplore-ieee-org.ezproxy.unibo.it/document/9808485 EMPIR 2019: Pre-Co-Normative IEEE Naples 20th International Conference on Harmonics & Quality of Power 29-05-2022 to 01-06-2022 30 978-1-6654-1639-9 2164-0610 NA https://zenodo.org/record/6867622 F.Costa A.Mingotti L.Peretto R.Tinarelli article KurizkiKOGPAVGCDG2022 2818 Physical Review Letters 2022 7 13 129 3 19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware Quantum measurements, Weak measurements https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.129.030401 EMPIR 2019: Pre-Co-Normative American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.129.030401 NA G.Kurizki A.G.Kofman T.Opatrný M.Gramegna F.Piacentini A.Avella S.Virzì S.Gherardini F.Caruso I.P.Degiovanni M.Genovese article NohCLCKKL2022 2821 Clinical and Experimental Pharmacology and Physiology 2022 6 24 2022 onlin 18HLT08: MEDDII: Metrology for drug delivery 1-10 antibiotics, concentration, infection, model, performance, pharmacokinetics EMPIR 2018: Health John Wiley & Sons Australia, Ltd. 30 10.1111/1440-1681.13695 NA G-J.Noh B-M.Choi E-K. Lee J.M.Choi K.M.Kim H-U.Kang S.H.Lee article ChenKKSA2022 2782 arXiv 2022 6 15 arXiv:2105 June 2022 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 1-16 Resonant sensor, diamagnetic levitation, mass sensor, liquid sensing https://arxiv.org/abs/2105.12444 EMPIR 2017: Fundamental Cornell University 30 arXiv:2105.12444v2 NA https://arxiv.org/abs/2105.12444 X.Chen N.Kothari A.Keskekler P.G.Steeneken F.Alijani article ChenKAS2022 2783 arXiv 2022 6 15 arXiv:2006 June 2022 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 1-6 diamagnetically levitating resonators, low-noise oscillators and sensors EMPIR 2017: Fundamental Cornell University 30 arXiv:2006.01733v3 NA https://arxiv.org/abs/2006.01733 X.Chen A.Keskekler F.Alijani P.G.Steeneken miscellaneous ColomBBKB 2775 Zenodo 2022 6 8 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology Nanophotonics, nano resonator, Riesz projection expansion EMPIR 2020: Fundamental 30 NA http://dx.doi.org/10.5281/zenodo.6565850 R.Colom F.Binkowski F.Betz Y.Kivshar S.Burger miscellaneous ColomBBKB_2 2775 Zenodo 2022 6 8 20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light Nanophotonics, nano resonator, Riesz projection expansion EMPIR 2020: Fundamental 30 NA http://dx.doi.org/10.5281/zenodo.6565850 R.Colom F.Binkowski F.Betz Y.Kivshar S.Burger article ChambersGWSMRMR2022 2754 Advances in Geosciences 2022 5 18 57 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level 63-80 Radon monitor, two-filter dual loop detector, traceRadon, calibration, activity concentration EMPIR 2019: Environment Copernicus GmbH 30 1680-7359 10.5194/adgeo-57-63-2022 NA S.D.Chambers A.D.Griffiths A.G.Williams O.Sisoutham V.Morosh S.Röttger F.Mertes A.Röttger article RubenVogtRGDKMKKSBBMPFCRVSH2022 2751 IEEE Journal of Photovoltaics 2022 5 12 3 19ENG01: Metro-PV: Metrology for emerging PV applications 844-852 Standards, Meteorology, IEC Standards, Temperature measurement, Power measurement, Photovoltaic systems, Mathematical models https://www.techrxiv.org/articles/preprint/PV_module_energy_rating_standard_IEC_61853-3_intercomparison_and_best_practice_guidelines_for_implementation_and_validation/19635333/1 EMPIR 2019: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 2156-3381, 2156-3403 10.1109/JPHOTOV.2021.3135258 NA M.Ruben Vogt S.Riechelmann A.M.Gracia-Amillo A.Driesse A.Kokka K.Maham P.Kärhä R.Kenny C.Schinke K.Bothe J.Blakesley E.Music F.Plag G.Friesen G.Corbellini N.Riedel-Lyngskar R.Valckenborg M.Schweiger W.Herrmann article VolkovaHTBCMARERBPN2022 2712 Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 color centers, optical quantum technology EMPIR 2020: Fundamental MDPI 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov article VolkovaHTBCMARERBPN2022_2 2721 Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time EMPIR 2020: Fundamental MDPI AG 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov article BriantKCLBWRMPCESTHPKKDZWMSNB2022 2714 Optics 2022 4 29 3 2 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 159-176 thermometry; photonic; optomechanic; temperature sensors; photonic integrated circuit https://doi.org/10.3390/opt3020017 EMPIR 2017: Fundamental MDPI AG 30 2673-3269 10.3390/opt3020017 NA T.Briant S.Krenek A.Cupertino F.Loubar R.Braive L.Weituschat D.Ramos M.J.Martin P.A.Postigo A.Casas R.Eisermann D.Schmid S.Tabandeh O.Hahtela S.Pourjamal O.Kozlova S.Kroker W.Dickmann L.Zimmermann G.Winzer T.Martel P.G.Steeneken R.A.Norte S.Briaudeau article RabagoQVSRICCRCFFRG2022 2671 International Journal of Environmental Research and Public Health 2022 4 19 7 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level 4213 exhalation; traceRadon; proficiency test; interlaboratory comparison EMPIR 2019: Environment MDPI AG 30 1660-4601 10.3390/ijerph19074213 NA D.Rabago L.Quindos A.Vargas C.Sainz I.Radulescu M-R.Ioan F.Cardellini M.Capogni A.Rizzo S.Celaya I.Fuente M.Fuente M.Rodriguez C.Grossi article ZibordiKMTCDG2022 2594 Remote Sensing of Environment 2022 4 272 19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system 112911 Ocean and Land Colour Instruments, Radiometry, AeroNET-OC, Copernicus Sentinel-3 EMPIR 2019: Environment Elsevier BV 30 0034-4257 10.1016/j.rse.2022.112911 NA G.Zibordi E.Kwiatkowska F.Mélin M.Talone I.Cazzaniga D.Dessailly J.I.Gossn article GogneauCSCLTHJTH2022 2666 Nanoscale 2022 3 17 19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices piezoelectric nanowires, NW, AFM, stiffness, GaN, energy, harvesting https://pubs.rsc.org/en/Content/ArticleLanding/2022/NR/D1NR07863A EMPIR 2019: Energy Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/d1nr07863a NA N.Gogneau P.Chrétien T.Sodhi L.Couraud L.Leroy L.Travers J-C.Harmand F.H.Julien M.Tchernycheva F.Houzé article LetiziaSC2022 2718 Sensors 2022 3 15 22 6 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems 2270 instrument transformers; harmonic measurements; DC transient disturbances; powerquality in AC railway systems SEG https://www.mdpi.com/1424-8220/22/6/2270 EMPIR 2016: Energy MDPI AG 30 1424-8220 10.3390/s22062270 NA P.Letizia D.Signorino G.Crotti article KronerABBBCPSSUW2022 2643 Water Supply 2022 3 14 17IND13: Metrowamet: Metrology for real-world domestic water metering cold water meters, test regime, water quality, water meter accuracy EMPIR 2017: Industry IWA Publishing 30 1606-9749, 1607-0798 10.2166/ws.2022.133 NA C.Kroner B.Akselli M.Benkova A.Borchling O.Büker N.Christoffersen J.Pavlas D.Schumann V.Seypka B.Unsal H.Warnecke article RottgerRGVKCCKRMR2022 2625 Advances in Geosciences 2022 3 10 57 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level 37-47 Radon, climate observation, radon monitor, radiation protection, radon tracer method (RTM), radon emanation source, activity concentration, traceability EMPIR 2019: Environment Copernicus GmbH 30 1680-7359 10.5194/adgeo-57-37-2022 NA S.Röttger A.Röttger C.Grossi A.Vargas U.Karstens G.Cinelli E.Chung D.Kikaj C.Rennick F.Mertes I.Radulescu article SalekCWSSPKSW2022 2798 IEEE Transactions on Instrumentation and Measurement 2022 3 71 N/A 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 1-9 D-Band, bolometric, power sensor, WR 6.5 waveguide flange, millimeter-wave, metrology, characterization https://research.birmingham.ac.uk/en/publications/design-fabrication-and-characterization-of-a-d-band-bolometric-po EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2022.3159009 NA M.Salek M.Celep T.Weimann D.Stokes X.Shang G.N.Phung K.Kuhlmann J.Skinner Y.Wang article ChaeKKPTKPGYSCCS2022 2653 Measurement Science and Technology 2022 3 33 6 18SIB07: GIQS: Graphene impedance quantum standard 065012 quantum Hall effect, quantized Hall resistance, graphene, impedance standard,F4-TCNQ doping, stability https://iopscience.iop.org/article/10.1088/1361-6501/ac4a1a EMPIR 2018: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac4a1a NA D-H.Chae M.Kruskopf J.Kucera J.Park N.T.M.Tran D.B.Kim K.Pierz M.Götz Y.Yin P.Svoboda P.Chrobok F.Couëdo F.Schopfer article WarneckeKOKCBBHHU2022 2574 Metrologia 2022 2 17 17IND13: Metrowamet: Metrology for real-world domestic water metering dynamic liquid flow rates, test rigs with dynamic measurement capabilities, validation through inter-facility intercomparison EMPIR 2017: Industry IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ac566e NA H.Warnecke C.Kroner F.Ogheard J.B.Kondrup N.Christoffersen M.Benkova O.Büker S.Haack M.Huovinen B.Unsal article BergCG2022 2664 Atmospheric Measurement Techniques 2022 2 16 15 3 20IND06: PROMETH2O: Metrology for trace water in ultra-pure process gases 819-832 Humidity, trace moisture, permeation tube, metrology https://amt.copernicus.org/articles/15/819/2022/ EMPIR 2020: Industry Copernicus GmbH 30 1867-8548 10.5194/amt-15-819-2022 NA R.F.Berg N.Chiodo E.Georgin article MingottiCPT2022_2 2717 Sensors 2022 2 11 22 4 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements 1397 accuracy, type test, low-power instrument transformer, Rogowski coil, temperature, humidity, positioning, measurements https://www.mdpi.com/1424-8220/22/4/1397 EMPIR 2019: Pre-Co-Normative MDPI AG 30 1424-8220 10.3390/s22041397 NA A.Mingotti F.Costa L.Peretto R.Tinarelli article JuradoCLLVdM2022 2544 Journal of the Association for Research in Otolaryngology 2022 2 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources loudness, DPOAE, infrasound EMPIR 2015: Health Springer Science and Business Media LLC 30 1525-3961, 1438-7573 10.1007/s10162-021-00830-2 NA C.Jurado M.Y.P.Chow K.M.L.Leung M.Larrea J.Vizuete A.de Cheveigné T.Marquardt proceedings SunCGLJBB2022 2584 Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022, 2022 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry calibration, X-ray computed tomography, additive manufacturing, Reference standard, surface texture, areal https://www.ndt.net/search/docs.php3?id=26568 EMPIR 2017: Industry Wels, Austria 11th Conference on Industrial Computed Tomography (iCT) 2022 08-02-2022 to 11-02-2022 30 NA https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id260.pdf W.Sun X.Chen C.Giusca S.Lou C.Jones H.Boulter S.Brown article SunGLYCFJWBB2022 2588 Additive Manufacturing 2022 2 50 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 102558 Additive manufacturing, Surface texture, Reference standard, X-ray computed tomography https://www.sciencedirect.com/science/article/pii/S2214860421007053?via%3Dihub EMPIR 2017: Industry Elsevier BV 30 2214-8604 10.1016/j.addma.2021.102558 NA W.Sun C.Giusca S.Lou X.Yang X.Chen T.Fry X.Jiang A.Wilson S.Brown H.Boulter article PalaciosAlvarezGCZMM2022 2741 Proceedings of the National Academy of Sciences 2022 2 119 6 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems BEC, Magnetometer https://acris.aalto.fi/ws/portalfiles/portal/79762019/Single_domain_Bose_condensate_magnetometer_achieves_energy_resolution_per_bandwidth_below_.pdf EMPIR 2017: Fundamental Proceedings of the National Academy of Sciences 30 0027-8424, 1091-6490 NA https://arxiv.org/abs/2108.11716 S.Palacios Alvarez P.Gomez S.Coop R.Zamora-Zamora C.Mazzinghi M.W.Mitchell article KuckLHGCRPSGBFLTTCMDTRR2022 2486 Applied Physics B 2022 1 23 128 2 17FUN06: SIQUST: Single-photon sources as new quantum standards Single photon sources, quantum radiometry, quantum metrology https://doi.org/10.1007/s00340-021-07734-2 EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 0946-2171, 1432-0649 10.1007/s00340-021-07734-2 NA S.Kück M.López H.Hofer H.Georgieva J.Christinck B.Rodiek G.Porrovecchio M.Smid S.Götzinger C.Becher P.Fuchs P.Lombardi C.Toninelli M.Trapuzzano M.Colautti G.Margheri I.P.Degiovanni P.Traina S.Rodt S.Reitzenstein article KuckLHGCRPSGBFLTTCMDTRR2022_2 2752 Applied Physics B 2022 1 23 128 2 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology Single-photon sources, quantum radiometry, calibration, single photon detectors. defect centres, (nano-)diamonds, molecule semiconductor quantum dots, photon flux, single-photon purity, spectral power distribution EMPIR 2020: Fundamental Springer Science and Business Media LLC 30 0946-2171, 1432-0649 10.1007/s00340-021-07734-2 NA S.Kück M.López H.Hofer H.Georgieva J.Christinck B.Rodiek G.Porrovecchio M.Smid S.Götzinger C.Becher P.Fuchs P.Lombardi C.Toninelli M.Trapuzzano M.Colautti G.Margheri I.P.Degiovanni P.Traina S.Rodt S.Reitzenstein article TongBKRGGGCHC2022 2570 Nanotechnology 2022 1 22 33 18 19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices 185704 nanowires, GaAs, doping, cathodoluminescence https://iopscience.iop.org/article/10.1088/1361-6528/ac4d58 EMPIR 2019: Energy IOP 30 NA https://hal.archives-ouvertes.fr/hal-03539939 C.Tong T.Bidaud E.Koivusalo M.Rizzo Piton M.Guina H.Galeti Y.Galvao Gobato A.Cattoni T.Hakkarainen S.Collin article KellerSKFCVCOBHMMNORBCNCDDGLVWZK2022 2778 PLOS ONE 2022 1 20 17 1 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis e0262656 SARS-CoV-2, RNA, PCR EMPIR 2018: Health Public Library of Science (PLoS) 30 1932-6203 NA https://zenodo.org/record/6637818 T.Keller I.Schellenberg A.Kummrow S.Falak M.H.Cleveland P.M.Vallone S.Cowen D.O’Sullivan E.Busby J.Huggett M.Mielke J.Michel A.Nitsche M.Obermeier H.F.Rabenau A.Berger S.Ciesek D.Niemeyer V.Corman U.Duehring C.Drosten H-P.Grunert V.Lindig L.Vierbaum N.Wojtalewicz H.Zeichhardt M.Kammel article DuKJMYCOMZ2022 2748 Physical Review Letters 2022 1 20 128 3 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems SU(1,1) interferometry, spin squeezing, entanglement EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 NA https://arxiv.org/abs/2004.14266 W.Du J.Kong . . . . J.Jia S.Ming C-H.Yuan J.F.Chen Z.Y.Ou M.W.Mitchell W.Zhang article ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022 2567 Neuromorphic Computing and Engineering 2022 1 12 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology neuromorphic computing, neuromorphic engineering https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83 EMPIR 2020: Fundamental IOP Publishing 30 2634-4386 10.1088/2634-4386/ac4a83 NA D.V.Christensen R.Dittmann B.Linares-Barranco A.Sebastian M.Le Gallo A.Redaelli S.Slesazeck T.Mikolajick S.Spiga S.Menzel I.Valov G.Milano C.Ricciardi S-J.Liang F.Miao M.Lanza T.J.Quill S.T.Keene A.Salleo J.Grollier D.Markovic A.Mizrahi P.Yao J.J.Yang G.Indiveri J.P.Strachan S.Datta E.Vianello A.Valentian J.Feldmann X.Li W.H.P.Pernice H.Bhaskaran S.Furber E.Neftci F.Scherr W.Maass S.Ramaswamy J.Tapson P.Panda Y.Kim G.Tanaka S.Thorpe C.Bartolozzi T.A.Cleland C.Posch S-C.Liu G.Panuccio M.Mahmud A.N.Mazumder M.Hosseini T.Mohsenin E.Donati S.Tolu R.Galeazzi M.E.Christensen S.Holm D.Ielmini N.Pryds article ClivatiMDVGLMPYSLDC2022 2524 Nature Communications 2022 1 10 13 1 19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware s41467-021-27808-1 QKD, Single photons and quantum effects, Optical metrology, Fibre optics and optical communications, Optoelectronic devices and components, Quantum information EMPIR 2019: Pre-Co-Normative Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-021-27808-1 NA C.Clivati A.Meda S.Donadello S.Virzì M.Genovese F.Levi A.Mura M.Pittaluga Z.Yuan A.J.Shields M.Lucamarini I.P.Degiovanni D.Calonico article PearceTICFWC2022 2429 International Journal of Thermophysics 2022 1 10 43 N/A 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 35 Insulation resistance breakdown, Mineral insulated metal sheathedthermocouple, Temperature, Thermocouple, Thermoelectric https://link.springer.com/content/pdf/10.1007/s10765-021-02967-x.pdf EMPIR 2017: Industry Springer

London

30 0195-928X NA https://doi.org/10.1007/s10765-021-02967-x J.Pearce D.Tucker C.G.Izquierdo R.Caballero T.Ford P.Williams P.Cowley article CelikovicPVNiCGBQR2022 2428 International Journal of Environmental Research and Public Health 2022 1 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level outdoor radon concentrations; literature overview; radiation risk; indoor radonconcentrations; radon priority areas EMPIR 2019: Environment 30 NA https://doi.org/10.3390/ijerph19020662 I.Čeliković G.Pantelić I.Vukanac J.K.Nikolić M.Živanović G.Cinelli V.Gruber S.Baumann L.S.Quindos Poncela D.Rabago article RadulescuCLRGDI2022 2290 Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment 2022 1 1021 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level 165927 Radon monitoringTransfer standardMetrological traceability EMPIR 2019: Environment Elsevier BV 30 0168-9002 10.1016/j.nima.2021.165927 NA I.Radulescu M.R.Calin A.Luca A.Röttger C.Grossi L.Done M.R.Ioan article ChristinckRLGHGK2022 2506 Journal of Physics: Conference Series 2022 1 2149 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 012014 nitrogen vacancy center, nanodiamond, CdSe/CdS quantum dots, back focal imaging https://iopscience.iop.org/article/10.1088/1742-6596/2149/1/012014 EMPIR 2017: Fundamental IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/2149/1/012014 NA J.Christinck B.Rodiek M.López H.Georgieva H.Hofer S.Götzinger S.Kück article MingottiCPT2022 2520 Sensors 2022 1 22 1 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements 397 low-power instrument transformer, Rogowski coil, position, burden, proximity, accuracy, harmonic, power quality https://www.mdpi.com/1424-8220/22/1/397 EMPIR 2019: Pre-Co-Normative MDPI AG 30 1424-8220 10.3390/s22010397 NA A.Mingotti F.Costa L.Peretto R.Tinarelli article ChavelSLSHO2022 2684 Journal of Physics: Conference Series 2022 1 2149 1 18SIB03: BxDiff: New quantities for the measurement of appearance 012013 BRDF, metrology, spectrophotometry, speckle https://iopscience.iop.org/article/10.1088/1742-6596/2149/1/012013 EMPIR 2018: SI Broader Scope IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/2149/1/012013 NA P.Chavel Y.Sortais T.Labardens L.Simonot M.Hebert G.Obein article OanceaBPGJCOC2022 2657 Journal of Instrumentation 2022 1 17 01 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates C01003 MiniPIX Timepix3, Particle fluxes, Dose rates, FLASH electron beams, UHDpulse, electronradiotherapy https://doi.org/10.48550/arXiv.2201.13171 EMPIR 2018: Health IOP Publishing 30 1748-0221 10.1088/1748-0221/17/01/C01003 NA C.Oancea C.Bălan J.Pivec C.Granja J.Jakubek D.Chvatil V.Olsansky V.Chiș article LeviCTB2022 2725 IEEE Transactions on Instrumentation and Measurement 2022 71 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 1-9 Atomic spectroscopy, laser stabilization, opticalfrequency metrology, optical frequency standard, optical latticeclock, strontium. EMPIR 2017: Fundamental Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2022.3165292 NA F.Levi D.Calonico M.G.Tarallo M.Barbiero article LeviCTB2022_2 2725 IEEE Transactions on Instrumentation and Measurement 2022 71 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 1-9 Atomic spectroscopy, laser stabilization, opticalfrequency metrology, optical frequency standard, optical latticeclock, strontium. EMPIR 2017: Fundamental Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2022.3165292 NA F.Levi D.Calonico M.G.Tarallo M.Barbiero article HrabinaHRCPZLC2022 2785 Optics Letters 2022 TBD TBD 17IND03: LaVA: Large Volume Metrology Applications TBD saturated spectroscopy, hydrogen cyanide, scanning laser EMPIR 2017: Industry Optica 30 1539-4794 NA https://arxiv.org/abs/2206.09232 J.Hrabina M.Hošek S.Rerucha M.Čížek Z.Pilat M.Zucco J.Lazar O.Číp article CelepSSSW2022 2800 IEEE Transactions on Instrumentation and Measurement 2022 71 N/A 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 1-7 Microwave measurement, Microwave theory and techniques, Temperature measurement, Microwave sensors,Electromagnetic heating, Power measurement, Temperature sensors https://research.birmingham.ac.uk/en/publications/power-sensor-characterization-from-110-ghz-to-170-ghz-using-a-wav EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2022.3144209 NA M.Celep M.Salek D.Stokes J.Skinner Y.Wang article MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022 2764 Nanoscale 2022 14 12 18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration 4690-4704 nanoparticle, concentration, standardization, VAMAS, interlaboratory EMPIR 2018: Support for Impact Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/D1NR07775A NA C.Minelli M.Wywijas D.Bartczak S.Cuello-Nuñez H.G.Infante J.Deumer C.Gollwitzer M.Krumrey K.E.Murphy M.E.Johnson A.R.Montoro Bustos I.H.Strenge B.Faure P.Høghøj V.Tong L.Burr K.Norling F.Höök M.Roesslein J.Kocic L.Hendriks V.Kestens Y.Ramaye M.C.Contreras Lopez G.Auclair D.Mehn D.Gilliland A.Potthoff K.Oelschlägel J.Tentschert H.Jungnickel B.C.Krause Y.U.Hachenberger P.Reichardt A.Luch T.E.Whittaker M.M.Stevens S.Gupta A.Singh F-h.Lin Y-H.Liu A.L.Costa C.Baldisserri R.Jawad S.E.L.Andaloussi M.N.Holme T.G.Lee M.Kwak J.Kim J.Ziebel C.Guignard S.Cambier S.Contal A.C.Gutleb J.“Kuba” Tatarkiewicz B.J.Jankiewicz B.Bartosewicz X.Wu J.A.Fagan E.Elje E.Rundén-Pran M.Dusinska I.P.Kaur D.Price I.Nesbitt S.O′ Reilly R.J.B.Peters G.Bucher D.Coleman A.J.Harrison A.Ghanem A.Gering E.McCarron N.Fitzgerald G.Cornelis J.Tuoriniemi M.Sakai H.Tsuchida C.Maguire A.Prina-Mello A.J.Lawlor J.Adams C.L.Schultz D.Constantin N.T.K.Thanh L.D.Tung L.Panariello S.Damilos A.Gavriilidis I.Lynch B.Fryer A.Carrazco Quevedo E.Guggenheim S.Briffa E.Valsami-Jones Y.Huang A.A.Keller V-T.Kinnunen S.Perämäki Z.Krpetic M.Greenwood A.G.Shard article ColomBBKB2022 2774 Physical Review Research 2022 4 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 023189 Nanoantennas, nanophotonics, near field optics, nanodisks, optical microcavities, electromagnetic wave theory, finite-element method EMPIR 2020: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.4.023189 NA R.Colom F.Binkowski F.Betz Y.Kivshar S.Burger article ColomBBKB2022_2 2774 Physical Review Research 2022 4 20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light 023189 Nanoantennas, nanophotonics, near field optics, nanodisks, optical microcavities, electromagnetic wave theory, finite-element method EMPIR 2020: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.4.023189 NA R.Colom F.Binkowski F.Betz Y.Kivshar S.Burger article MelinCDH2022 2591 IEEE Transactions on Geoscience and Remote Sensing 2022 19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system 1-1 Ocean color, uncertainties, SeaWiFS,Image color analysis, Sensitivity, Remote sensing, Distributed databases, Satellites, Aerosols EMPIR 2019: Environment Institute of Electrical and Electronics Engineers (IEEE) 30 0196-2892, 1558-0644 10.1109/TGRS.2022.3150400 NA F.Mélin P.Colandrea P.De Vis S.E.Hunt article FasoloBBCCCCCDEFFFFGGGGKLLLMMMMMMMNOPPPRRRSUV2022 2612 IEEE Transactions on Applied Superconductivity 2022 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology Physics, Gain, Microwave amplifiers, Noise figure, Superconducting microwave devices, Microwave photonics, Bandwidth EMPIR 2017: Fundamental Institute of Electrical and Electronics Engineers (IEEE) 30 1051-8223, 1558-2515, 2378-707 10.1109/TASC.2022.3148692 NA L.Fasolo C.Barone M.Borghesi G.Carapella A.P.Caricato I.Carusotto W.Chung A.Cian D.Di Gioacchino E.Enrico P.Falferi M.Faverzani E.Ferri G.Filatrella C.Gatti A.Giachero D.Giubertoni A.Greco C.Kutlu A.Leo C.Ligi P.Livreri G.Maccarone B.Margesin G.Maruccio A.Matlashov C.Mauro R.Mezzena A.G.Monteduro A.Nucciotti L.Oberto S.Pagano V.Pierro L.Piersanti M.Rajteri A.Rettaroli S.Rizzato Y.K.Semertzidis S.V.Uchaikin A.Vinante article ArrheniusBSCGBB2021 2487 Processes 2021 12 24 10 1 19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2 20 sensors, hydrogen quality, FCEV, testing protocols EMPIR 2019: Energy MDPI AG 30 2227-9717 10.3390/pr10010020 NA K.Arrhenius T.Bacquart K.Schröter M.Carré B.Gozlan C.Beurey C.Blondeel article WooldridgeAZZCCB2021 2546 Physics in Medicine & Biology 2021 12 21 66 24 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 245024 MRI; finite element modelling; implant heating https://iopscience.iop.org/article/10.1088/1361-6560/ac3eab EMPIR 2017: Industry IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ac3eab NA J.Wooldridge A.Arduino L.Zilberti U.Zanovello M.Chiampi V.Clementi O.Bottauscio article DieudonneSHCL2021 2400 A Study of Experiment-based Radio Frequency Electromagnetic Field 2021 12 17 1 1 18SIP02: 5GRFEX: Metrology for RF exposure from massive MIMO 5G base station: Impact on 5G network deployment 1-5 exposure, radiofrequency, electromagnetic field, massive mimo, stochastic nature, measurements. https://arxiv.org/abs/2112.09637 EMPIR 2018: Support for Impact Tian Hong Loh 30 arXiv:2112.09637v1 10.23919/EuCAP51087.2021.9411325 NA M.Dieudonne A.Sunday F.Heliot D.Cheadle T.Loh article BassottiSC2021 2437 IEEE Magnetic Letters 2021 12 16 17FUN08: TOPS: Metrology for topological spin structures Micromagnetic simulations, skyrmiond, magnetic crystals, DMI https://arxiv.org/ftp/arxiv/papers/2112/2112.04967.pdf EMPIR 2017: Fundamental IEEE 30 NA https://ieeexplore.ieee.org/document/9653803 M.Bassotti R.Silvani G.Carlotti article GollwitzerDSTCMPDFCH2021 2389 Nanomaterials 2021 12 10 11 12 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements 3359 nanoparticle; complex‐shape; bipyramid; electron microscopy; atomic force microscopy;size measurements; TKD; STEM‐in‐SEM; SAXS; nanoparticle concentration; correlative analysis https://www.mdpi.com/2079-4991/11/12/3359 EMPIR 2017: Pre-Co-Normative MDPI 30 2079-4991 10.3390/nano11123359 NA C.Gollwitzer J.Deumer C.Salzmann T.Tokarski G.Cios V.Maurino F.Pellegrino A.Delvallée N.Feltin L.Crouzier V-D.Hodoroaba article ZjawinBCLZW2021 2745 Europhysics Letters 2021 12 136 5 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 58001 variation of alpha, EMPIR 2017: Fundamental IOP Publishing 30 0295-5075, 1286-4854 10.1209/0295-5075/ac3da3 NA B.Zjawin M.Bober R.Ciuryło D.Lisak M.Zawada P.Wcisło article DegiovanniGBSC2021 2760 Measurement: Sensors 2021 12 18 19NET02: EMN-Quantum: Support for a European Metrology Network on quantum technologies 100348 Quantum Metrology, Metrology for Quantum Technologies, Quantum Technologies, Quantum Clocks, Atomic Sensors, Quantum Electronics, Quantum Photonics, Quantum Computing, Quantum Sensing, Quantum Imaging https://www.sciencedirect.com/science/article/pii/S2665917421003111 EMPIR 2019: Support for Networks Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100348 NA I.P.Degiovanni M.Gramegna S.Bize H.Scherer C.Chunnilall article SudTSBSDSSWZZRCKKC2021 2383 Scientific Reports 2021 12 11 23626 17FUN08: TOPS: Metrology for topological spin structures Spintronics, Nano magnetism, Magnetic skyrmions, Dzyaloshinskii–Moriya interaction https://www.nature.com/articles/s41598-021-02902-y.pdf EMPIR 2017: Fundamental Springer Nature 30 10.1038/s41598-021-02902-y NA A. Sud S.Tacchi D. Sagkovits C.Barton M.Sall L.H. Diez E. Stylianidis N.Smith L.Wright S. Zhang X.Zhang D. Ravelosona G.Carlotti H. Kurebayashi O.Kazakova M. Cubukcu article LieberherrACCCGKMMMOSSTV2021 2368 Atmospheric Measurement Techniques 2021 12 14 12 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 7693-7706 bioaerosol monitors, calibration, counting efficiency, fluorescence https://amt.copernicus.org/articles/14/7693/2021/ EMPIR 2019: Environment Copernicus GmbH 30 1867-8548 10.5194/amt-14-7693-2021 NA G. Lieberherr K.Auderset B.Calpini B.Clot B.Crouzy M.Gysel-Beer T.Konzelmann J.Manzano A.Mihajlovic A.Moallemi D.O'Connor B.Sikoparija E.Sauvageat F.Tummon K.Vasilatou article HirtCHRK2021 2505 Engineering Research Express 2021 12 3 4 17FUN06: SIQUST: Single-photon sources as new quantum standards 045038 nitrogen vacancy center, nanodiamond, single-photon source, fabrication https://iopscience.iop.org/article/10.1088/2631-8695/ac34c2 EMPIR 2017: Fundamental IOP Publishing 30 2631-8695 10.1088/2631-8695/ac34c2 NA F.Hirt J.Christinck H.Hofer B.Rodiek S.Kück article MelinCFGW2021 2307 Measurement: Sensors 2021 12 18 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 100290 Cognition, Entropy, Metrology, Rasch, Person ability, Task difficulty EMPIR 2018: Health Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100290 NA J.Melin S.J.Cano A.Flöel L.Göschel WillWebster article MelinCGFLHFP2021 2306 Measurement: Sensors 2021 12 18 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 100289 Alzheimer's, Cognition, Construct specification equations, Memory metrology, Rasch, Person ability EMPIR 2018: Health Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100289 NA J.Melin S.J.Cano L.Göschel A.Fillmer S.Lehmann C.Hirtz A.Flöel L.R.Pendrill article GrecoFMCE2021 2342 Physical Review B 2021 11 24 104 18 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology Superconductivity, Josephson junctions, Josephson metamaterials, Parametric amplifiers https://arxiv.org/abs/2009.01002 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.104.184517 NA A.Greco L.Fasolo A.Meda L.Callegaro E.Enrico article ChenV2021 2452 Advanced Materials 2021 11 21 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 2105022 capping layers, electrode materials, redox reactions, resistive switching, thicknesses https://onlinelibrary.wiley.com/doi/full/10.1002/adma.202105022 EMPIR 2020: Fundamental Wiley 30 0935-9648, 1521-4095 10.1002/adma.202105022 NA S.Chen I.Valov article ChretienGST2021 2471 Mathematics 2021 11 19 9 22 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 2960 XCT reconstruction, sparsity enforcing penalties, hyperparameter selection, Bayesian optimisation, virtual planted reference image EMPIR 2017: Industry MDPI AG 30 2227-7390 10.3390/math9222960 NA S.Chretien C.Giampiccolo W.Sun J.Talbott article ChenYG2021 2319 Journal of Physics D: Applied Physics 2021 11 12 55 12 17FUN08: TOPS: Metrology for topological spin structures 123001 magnonics, spin waves, unidirectionality EMPIR 2017: Fundamental IOP Publishing 30 0022-3727, 1361-6463 10.1088/1361-6463/ac31f4 NA J.Chen H.Yu G.Gubbiotti article CorteSDLPTDMOMGF2021 2503 Advanced Photonics Research 2021 11 3 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 2100148 tin vacancy centers, single-photon sources, nanodiamond https://onlinelibrary.wiley.com/doi/epdf/10.1002/adpr.202100148 EMPIR 2017: Fundamental Wiley 30 2699-9293, 2699-9293 10.1002/adpr.202100148 NA E.Corte S.Sachero S.Ditalia Tchernij T.Lühmann S.Pezzagna P.Traina I.P.Degiovanni E.Moreva P.Olivero J.Meijer M.Genovese J.Forneris article CorteSDLPTDMOMGF2021_2 2678 Advanced Photonics Research 2021 11 3 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 2100148 color centers, confocal microscopy https://onlinelibrary.wiley.com/doi/full/10.1002/adpr.202100148 EMPIR 2017: Fundamental Wiley 30 2699-9293, 2699-9293 10.1002/adpr.202100148 NA E.Corte S.Sachero S.Ditalia Tchernij T.Lühmann S.Pezzagna P.Traina I.P.Degiovanni E.Moreva P.Olivero J.Meijer M.Genovese J.Forneris article CorteSDLPTDMOMGF2021_20 2678 Advanced Photonics Research 2021 11 3 1 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 2100148 color centers, confocal microscopy https://onlinelibrary.wiley.com/doi/full/10.1002/adpr.202100148 EMPIR 2020: Industry Wiley 30 2699-9293, 2699-9293 10.1002/adpr.202100148 NA E.Corte S.Sachero S.Ditalia Tchernij T.Lühmann S.Pezzagna P.Traina I.P.Degiovanni E.Moreva P.Olivero J.Meijer M.Genovese J.Forneris article CorteSDLPTDMOMGF2021_21 2678 Advanced Photonics Research 2021 11 3 1 20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology 2100148 color centers, confocal microscopy https://onlinelibrary.wiley.com/doi/full/10.1002/adpr.202100148 EMPIR 2020: Industry Wiley 30 2699-9293, 2699-9293 10.1002/adpr.202100148 NA E.Corte S.Sachero S.Ditalia Tchernij T.Lühmann S.Pezzagna P.Traina I.P.Degiovanni E.Moreva P.Olivero J.Meijer M.Genovese J.Forneris article HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021 2336 NeuroImage 2021 11 241 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 118430 Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site EMPIR 2018: Health Elsevier BV 30 1053-8119 10.1016/j.neuroimage.2021.118430 NA S.C.N.Hui M.Mikkelsen H.J.Zöllner V.Ahluwalia S.Alcauter L.Baltusis D.A.Barany L.R.Barlow R.Becker J.I.Berman A.Berrington P.K.Bhattacharyya J.U.Blicher W.Bogner M.S.Brown V.D.Calhoun R.Castillo K.M.Cecil Y.B.Choi W.C.W.Chu W.T.Clarke A.R.Craven K.Cuypers M.Dacko C.de la Fuente-Sandoval P.Desmond A.Domagalik J.Dumont N.W.Duncan U.Dydak K.Dyke D.A.Edmondson G.Ende L.Ersland C.J.Evans A.S.R.Fermin A.Ferretti A.Fillmer T.Gong I.Greenhouse J.T.Grist M.Gu A.D.Harris K.Hat S.Heba E.Heckova J.P.Hegarty K-F.Heise S.Honda A.Jacobson J.F.A.Jansen C.W.Jenkins S.J.Johnston C.Juchem A.Kangarlu A.B.Kerr K.Landheer T.Lange P.Lee S.R.Levendovszky C.Limperopoulos F.Liu W.Lloyd D.J.Lythgoe M.G.Machizawa E.L.MacMillan R.J.Maddock A.V.Manzhurtsev M.L.Martinez-Gudino J.J.Miller H.Mirzakhanian M.Moreno-Ortega P.G.Mullins S.Nakajima J.Near R.Noeske W.Nordhøy G.Oeltzschner R.Osorio-Duran M.C.G.Otaduy E.H.Pasaye R.Peeters S.J.Peltier U.Pilatus N.Polomac E.C.Porges S.Pradhan J.J.Prisciandaro N.A.Puts C.D.Rae F.Reyes-Madrigal T.P.L.Roberts C.E.Robertson J.T.Rosenberg D-G.Rotaru R.L.O'Gorman Tuura M.G.Saleh K.Sandberg R.Sangill K.Schembri A.Schrantee N.A.Semenova D.Singel R.Sitnikov J.Smith Y.Song C.Stark D.Stoffers S.P.Swinnen R.Tain C.Tanase S.Tapper M.Tegenthoff T.Thiel M.Thioux P.Truong P.van Dijk N.Vella R.Vidyasagar A.Vovk G.Wang L.T.Westlye T.K.Wilbur W.R.Willoughby M.Wilson H-J.Wittsack A.J.Woods Y-C.Wu J.Xu M.Y.Lopez D.K.W.Yeung Q.Zhao X.Zhou G.Zupan R.A.E.Edden article CervantesDBDB2021 2315 Physics in Medicine & Biology 2021 11 66 22 19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy 225004 magnetic fields, small fields, perturbation factors, quality correction factors, MRgRT, ionization chambers, solid-state detectors EMPIR 2019: Pre-Co-Normative IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ac3344 NA Y.Cervantes J.Duchaine I.Billas S.Duane H.Bouchard article CarratuDDLP2021 2267 Sensors 2021 10 30 21 21 17IND13: Metrowamet: Metrology for real-world domestic water metering 13 water leak detection; IoT; smart water meter; smart city; EMPIR EMPIR 2017: Industry MDPI 30 1424-8220 10.3390/s21217251 NA M.Carratù S.Dello Iacono G.Di Leo C.Liguori A.Pietrosanto article ZeichhardtFDBHSHIVHVMCGSOEBHK2021 2777 Clinical Chemistry 2021 10 22 68 1 18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis 153-162 SARS-CoV-2, RT-qPC, EQA https://academic.oup.com/clinchem/article/68/1/153/6385233#325300656
https://zenodo.org/record/6637873/files/18HLT03%20Septimet%20Supplementary%20Funding%20Acknowledgement%20CLIN%20CHEM.pdf?download=1 EMPIR 2018: Health Oxford University Press (OUP) 30 0009-9147, 1530-8561 NA https://zenodo.org/record/6637873 H.Zeichhardt C.A.Foy U.Dühring Y-K.Bae S.Hingley-Wilson N.Storey K.H.Hong J.In J.Vandesompele K.Harris J.Verwilt J.Moran-Gilad S.Cowen H-P.Grunert G.Stewart D.M.O’Sullivan D.Evans J.Braybrook Ji.F.Huggett M.Kammel article DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021 2365 Frontiers in Remote Sensing 2021 10 19 2 19ENV04: MAPP: Metrology for aerosol optical properties GRASP, Radiative Transfer, Inversion model https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full EMPIR 2019: Environment Frontiers Media SA 30 2673-6187 10.3389/frsen.2021.706851 NA O.Dubovik D.Fuertes P.Litvinov A.Lopatin T.Lapyonok I.Doubovik F.Xu F.Ducos C.Chen B.Torres Y.Derimian L.Li M.Herreras-Giralda M.Herrera Y.Karol C.Matar G.L.Schuster R.Espinosa A.Puthukkudy Z.Li J.Fischer R.Preusker J.Cuesta A.Kreuter A.Cede M.Aspetsberger D.Marth L.Bindreiter A.Hangler V.Lanzinger C.Holter C.Federspiel proceedings HosekRHCC2021 2703 Conference IEEE EFTF IFCS 2021 2021 10 19 17IND03: LaVA: Large Volume Metrology Applications hydrogen cyanide, linear absorption spectroscopy, optical frequency comb, frequency reference, frequency stabilized lasers, SI unit meter https://zenodo.org/record/6497486 EMPIR 2017: Industry IEEE Service Center Online Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS) 07-07-2021 to 17-07-2021 30 978-1-6654-3935-0 2327-1949 10.1109/EFTF/IFCS52194.2021.9604261 NA M.Hošek S.Rerucha J.Hrabina M.Čížek O.Číp proceedings HrabinaHRPLCP2021 2704 Conference IEEE EFTF IFCS 2021 2021 10 19 17IND03: LaVA: Large Volume Metrology Applications saturated spectroscopy, optical frequency standard, hydrogen cyanide https://zenodo.org/record/6497501 EMPIR 2017: Industry IEEE Service Center Online Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS) 07-07-2021 to 17-07-2021 30 978-1-6654-3935-0 2327-1949 10.1109/EFTF/IFCS52194.2021.9604272 NA J.Hrabina M.Hošek S.Rerucha L.Pravdova J.Lazar O.Číp Z.Pilat article deGrootCSCL2021 2432 Optical Engineering 2021 10 18 60 10 20IND07: TracOptic: Traceable industrial 3D roughness and dimensional measurement using optical 3D microscopy and optical distance sensors 104106 interferometry, interferometer, metrology, topography, coherence scanning interferometry,Fourier optics https://www.spiedigitallibrary.org/journals/optical-engineering/volume-60/issue-10/104106/Modeling-of-coherence-scanning-interferometry-using-classical-Fourier-optics/10.1117/1.OE.60.10.104106.full EMPIR 2020: Industry 30 10.1117/1.OE.60.10.104106 NA P.de Groot X.Colonna de Lega R.Su J.Coupland R.Leach article ArrheniusABMBWBGLCSBNR2021 2482 International Journal of Hydrogen Energy 2021 10 11 46 70 19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2 34839-34853 Hydrogen,Refuelling stations,Sampling device,Fuel quality assessment https://www.sciencedirect.com/science/article/pii/S0360319921031694 EMPIR 2019: Energy Elsevier 30 0360-3199 10.1016/j.ijhydene.2021.08.043 NA K.Arrhenius T.A.Aarhaug T.Bacquart A.Morris S.Bartlett L.Wagner C.Blondeel B.Gozlan Y.Lescornes N.Chramosta C.Spitta E.Basset Q.Nouvelot M.Rizand article SantafeGabardaFTC2021 2273 Optics Express 2021 10 29 21 18SIB03: BxDiff: New quantities for the measurement of appearance 34175 BSSRDF, translucency, reflectance, measurement, gonispectrophotometry EMPIR 2018: SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.439108 NA P.Santafé-Gabarda A.Ferrero N.Tejedor-Sierra J.Campos article CorderoVALPP2021 2259 Phys. Rev. A 2021 10 104 4 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 042401 Quantum Optics, non-classical correlations, quantum metrology EMPIR 2017: Fundamental American Physical Society 30 2469-9934 NA https://arxiv.org/abs/2107.14265 O.Cordero A.Villegas J.R.Alvarez R. de J.Leon Montiel M.H.M. Passos JuanP. Torres article VidakoviKochMiCKP2021 2305 Current Opinion in Electrochemistry 2021 10 17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications 100851 Harmonic analysis, Diagnosis, Kinetics, MModel discrimination, Battery EMPIR 2017: Industry Elsevier BV 30 2451-9103 10.1016/j.coelec.2021.100851 NA T.Vidaković-Koch T.Miličić L.A.Živković H.S.Chan U.Krewer M.Petkovska proceedings MingottiCPT2021 2575 Workshop AMPS 2021 2021 10 1 1 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements 1-6 instrument transformer EMPIR 2019: Pre-Co-Normative IEEE Cagliari Workshop on Applied Measurement for Power Systems 29-09-2021 to 01-10-2021 30 978-1-7281-6923-1 2475-2304 NA https://zenodo.org/record/5946938 A.Mingotti F.Costa L.Peretto R.Tinarelli proceedings ChenCDLMLB2021 2327 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems 2021 9 29 - - 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 6 Power quality, substation automation, smart grids, measurement techniques, instrument transformers https://ieeexplore.ieee.org/document/9586040 EMPIR 2017: Industry IEEE Cagliari, Italy 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 Electronic ISBN:978-1-7281-692 Electronic ISSN: 2475-2304 Pri NA https://doi.org/10.5281/zenodo.5717933 Y.Chen G.Crotti A.Dubowik P.S.Letizia E.Mohns M.Luiso J.Bruna proceedings vandenBromMLLLCD2021 2565 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 2021 9 29 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements Instrument Transformer, Power Quality, Power System Measurements, Calibration, Uncertainty, Standard EMPIR 2019: Pre-Co-Normative IEEE Virtual Conference 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 NA https://zenodo.org/record/6093507 H.van den Brom F.Munoz M.Luiso P.S.Letizia C.Landi G.Crotti G.D'Avanzo proceedings ChenMSd2021 2309 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems 2021 9 29 - - 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 6 digital, current transformer, merging unit, standalone merging unit, traceability, calibration, sampled values https://zenodo.org/record/5704497 EMPIR 2017: Industry IEEE Cagliari, Italy 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 Electronic ISBN:978-1-7281-692 Electronic ISSN: 2475-2304 Pri NA Electronic ISBN:978-1-7281-6923-1 Print on Demand(PoD) ISBN:978-1-7281-6924-8 Y.Chen E.Mohns M.Seckelmann S.de Rose proceedings SeferiCB2021 2268 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 2021 9 29 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 6 Algorithms, frequency, phasor measurement unit, real-time operation, ROCOF, sample value data, synchrophasor https://strathprints.strath.ac.uk/78316/ EMPIR 2017: Industry IEEE Online IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 978-1-7281-6923-1 2475-2304 10.1109/AMPS50177.2021.9586034 NA Y.Seferi R.G.Q.Cetina S.M.Blair proceedings OlivanMBC2021 2313 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 2021 9 29 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation Power quality,substation automation, smart grids, measuremen ttechniques, instrument transformers EMPIR 2017: Industry IEEE Cagliari, Italy 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 978-1-7281-6923-1 2475-2304 NA https://zenodo.org/record/5703000 M.A.Oliván A.Mareca J.Bruna D.Cervero article CzompolyBGPO2021 2484 Atmospheric Pollution Research 2021 9 25 12 11 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 101214 Atmospheric aerosols, TXRF, XANES, Elemental size distribution, Elemental speciation, Cascade impactor EMPIR 2019: Environment Elsevier B.V. 30 1309-1042 10.1016/j.apr.2021.101214 NA O.Czömpöly E.Börcsök V.Groma S.Pollastri J.Osán article FogliettaGBCBFDSC2021 2263 Pharmaceuticals 2021 9 25 14 10 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 972 ultrasound; sonodynamic therapy; breast cancer EMPIR 2018: Health MDPI AG 30 1424-8247 10.3390/ph14100972 NA F.Foglietta G.Gola E.Biasibetti M.T.Capucchio I.Bruni A.Francovich G.Durando L.Serpe R.Canaparo article RottgerRGVCOHCCBIRKCAYFMM2021 2224 Measurement Science and Technology 2021 9 23 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level radon, metrology, tracer, environmental measurements EMPIR 2019: Environment IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac298d NA A.Röttger S.Röttger C.Grossi A.Vargas R.Curcoll P.Otáhal M.Á.Hernández-Ceballos G.Cinelli S.Chambers S.A.Barbosa M-R.Ioan I.Radulescu D.Kikaj E.Chung T.Arnold C.Yver Kwok M.Fuente F.Mertes V.Morosh article TangSJHCMT2021 2730 Physical Review Research 2021 9 17 3 3 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems superradiance EMPIR 2017: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.3.033258 NA M.Tang S.A.Schäffer A.A.Jørgensen M.R.Henriksen B.T.R.Christensen J.H.Müller J.W.Thomsen article LainelaLHCACS2021 2180 Water 2021 9 15 13 18 17FUN09: UnipHied: Realisation of a Unified pH Scale 2522 acidity;seawater;pH scales; unified scaleabsolute pHdifferential potentiometric measurementsminimization of liquid junction potential ionic liquid salt bridgesresidual liquid junction potential EMPIR 2017: Fundamental MDPI AG 30 2073-4441 10.3390/w13182522 NA S.Lainela I.Leito A.Heering G.Capitaine B.Anes F.Camões D.Stoica article LainelaLHCACS2021_2 2288 Water 2021 9 15 13 18 17FUN09: UnipHied: Realisation of a Unified pH Scale 2522 acidity; seawater; pH scales; unified scale; absolute pH; differential potentiometric measurements; minimization of liquid junction potential; ionic liquid salt bridges; residual liquid junction potential EMPIR 2017: Fundamental MDPI AG 30 2073-4441 10.3390/w13182522 NA S.Lainela I.Leito A.Heering G.Capitaine B.Anes F.Camões D.Stoica article CrottiGDLL2021 2563 Measurement 2021 9 182 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements 109674 Voltage transformer, Power system measurements, SINDICOMP-LV, Harmonics, Frequency response, Non-linearity. https://www.sciencedirect.com/science/article/pii/S0263224121006436?via%3Dihub EMPIR 2019: Pre-Co-Normative Elsevier BV 30 0263-2241 10.1016/j.measurement.2021.109674 NA G.Crotti D.Giordano G.D'Avanzo P.S.Letizia M.Luiso article DollemanCLvSS2021 2244 Nano Letters 2021 8 30 21 18 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 7617-7624 graphene, nanoelectromechanical systems (NEMS), pressure sensor, gas damping EMPIR 2017: Fundamental American Chemical Society (ACS) 30 1530-6984, 1530-6992 10.1021/acs.nanolett.1c02237 NA R.J.Dolleman D.Chakraborty D.R.Ladiges H.S.J.van der Zant J.E.Sader P.G.Steeneken article FerreroBCVHYACMT2021 2146 Nanomaterials 2021 8 25 11 9 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 2179 nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations EMPIR 2018: Health MDPI 30 2079-4991 10.3390/nano11092179 NA R.Ferrero G.Barrera F.Celegato M.Vicentini H.Hüseyin N.Yıldız C.Atila Dinçer M.Coïsson A.Manzin P.Tiberto proceedings deGrootCSCL2021_2 2433 Applied Optical Metrology IV - Proc. of SPIE 2021 8 11817 20IND07: TracOptic: Traceable industrial 3D roughness and dimensional measurement using optical 3D microscopy and optical distance sensors 118170M Interferometry, interferometer, metrology, topography, CSI, Fourier optics https://repository.lboro.ac.uk/articles/conference_contribution/Fourier_optics_modelling_of_coherence_scanning_interferometers/16948690 EMPIR 2020: Industry San Diego, California SPIE Optical Engineering + Applications 01-08-2021 to 05-08-2021 30 10.1117/12.2595668 NA P.de Groot X.Colonna de Lega R.Su J.Coupland R.Leach article CorcolesYK2021 2190 Applied Mathematical Modelling 2021 8 96 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 177-188 MR safety, implant safety, RF induced heating EMPIR 2017: Industry Elsevier BV 30 0307-904X 10.1016/j.apm.2021.02.036 NA J.Córcoles A.Yao N.Kuster article GallianaCR2021 2333 Electrical Engineering 2021 8 19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes Voltage divider · Composite and combined voltages · Traceability · Scale factor calibration · Step response ·Measurement uncertainty EMPIR 2019: Pre-Co-Normative Springer Science and Business Media LLC 30 0948-7921, 1432-0487 10.1007/s00202-021-01368-5 NA F.Galliana S.E.Caria P.E.Roccato article BarrattRCSKE2021 2167 Physical Review B 2021 7 30 104 3 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 035436 single electrons, electron interferometry, quantum transport, electron quantum optics https://arxiv.org/abs/2104.01653 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.104.035436 NA C.J.Barratt S.Ryu L.A.Clark H.-S.Sim M.Kataoka C.Emary article RadtkeCKLSDAHNVRQLDBUL2021 2285 Pure and Applied Chemistry 2021 7 30 93 9 17FUN09: UnipHied: Realisation of a Unified pH Scale 1049-1060 Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability EMPIR 2017: Fundamental Walter de Gruyter GmbH 30 0033-4545, 1365-3075 10.1515/pac-2019-0504 NA V.Radtke F.Camões I.Krossing I.Leito D.Stoica L.Deleebeeck B.Anes A.Heering T.Näykki S.Veltzé M.Roziková R.Quendera L.Liv N.Dániel F.Bastkowski E.Uysal N.Lawrence article FogliettaPGBPDTSC2021 2264 Cancers 2021 7 30 13 15 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 3852 ultrasound; sonodynamic therapy; cancer cells; membrane fluidity EMPIR 2018: Health MDPI AG 30 2072-6694 10.3390/cancers13153852 NA F.Foglietta V.Pinnelli F.Giuntini N.Barbero P.Panzanelli G.Durando E.Terreno L.Serpe R.Canaparo article GoncalvesMC2021 2749 Physical Review A 2021 7 29 104 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems Single atom, quantum correlation EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9926, 2469-9934 NA https://arxiv.org/abs/2004.01993 D. Goncalves M.W.Mitchell D.E. Chang article SilvaniKTC2021 2426 Journal of Magnetism and magnetic Materials 2021 7 27 539 17FUN08: TOPS: Metrology for topological spin structures 168342 Magnonic Crystals, spin waves, DMI https://doi.org/10.1016/j.jmmm.2021.168342 EMPIR 2017: Fundamental Elsevier 30 0304-8853 NA https://arxiv.org/abs/2112.05360 R.Silvani M.Kuepferling S.Tacchi G.Carlotti article TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021 2260 EJNMMI Physics 2021 7 23 8 1 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom EMPIR 2015: Health Springer Science and Business Media LLC 30 2197-7364 10.1186/s40658-021-00397-0 NA J.Tran-Gia A.M.Denis-Bacelar K.M.Ferreira A.P.Robinson N.Calvert A.J.Fenwick D.Finocchiaro F.Fioroni E.Grassi W.Heetun S.J.Jewitt M.Kotzassarlidou M.Ljungberg D.R.McGowan N.Scott J.Scuffham K.S.Gleisner J.Tipping J.Wevrett M.Bardiès S.Berenato I.Bilas C.Bobin M.Capogni M.Chauvin S.COLLINS M.Cox J.Dabin M.D’Arienzo J.Gustafsson A.Hallam T.Kalathas G.Kayal G.Lorusso F-J.Maringer D.Morgan V.Smyth J.Solc L.Štemberková L.Struelens A.Vergara-Gil H.Wiedner M.Lassmann article RibeiroACSMLBSS2021 2198 Metrologia 2021 7 23 58 4 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards 044001 measurement uncertainty, rainfall, precipitation, estimating, arithmetic mean method, Thiessen polygon method, isohyetal method EMPIR 2017: Pre-Co-Normative IOP Publishing

Bristol, United Kingdom

30 0026-1394, 1681-7575 10.1088/1681-7575/ac0d49 NA A.S.Ribeiro M.C.Almeida M.G.Cox J.A.Sousa L.Martins D.Loureiro R.Brito M.Silva A.C.Soares article ChinchellaCSL2021 2393 Sensors 2021 7 17 21 14 18NRM03: INCIPIT: Calibration and accuracy of non-catching instruments to measure liquid/solid atmospheric precipitation 4880 precipitation, measurement, non-catching gauges, wind induced bias, computational fluid dynamics, wind tunnel, disdrometer https://www.mdpi.com/1424-8220/21/14/4880 EMPIR 2018: Pre-Co-Normative MDPI 30 14248220 10.3390/s21144880 NA E.Chinchella A.Cauteruccio M.Stagnaro L.G.Lanza article CrouzierDDASH2021 2045 Ultramicroscopy 2021 7 226 July 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements 113300 SEMElectron landing energyNanoparticlesDimensional propertiesMetrology https://reader.elsevier.com/reader/sd/pii/S0304399121000875?token=909C79CE3C3F38B3A66DB9C19F03753326F07A8C27AA6D2752B29C970B6044F466C12F79E394D396CE7598E6F1497E2E&originRegion=eu-west-1&originCreation=20210517160957 EMPIR 2017: Pre-Co-Normative Elsevier BV 30 0304-3991 10.1016/j.ultramic.2021.113300 NA L.Crouzier A.Delvallée L.Devoille S.Artous F.Saint-Antonin N.Feltin article VargasCMRPLNSL2021 2114 Radiation Measurements 2021 7 145 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 106595 Airborne radiological detectorUnmanned aerial systemEnvironmental radioactivity mappingSource localization EMPIR 2016: Environment Elsevier BV 30 1350-4487 10.1016/j.radmeas.2021.106595 NA A.Vargas D.Costa M.Macias P.Royo E.Pastor M.Luchkov S.Neumaier U.Stöhlker R.Luff article KruskopfBPCPREPPGS2021 2113 IEEE Transactions on Electron Devices 2021 7 68 7 18SIB07: GIQS: Graphene impedance quantum standard 3672-3677 Alternating current, dissipation factor,double-shield, epitaxial graphene, magnetocapacitance,magnetotransport, precision measurements, quantized Hallresistance (QHR) standards, quantum Hall effect (QHE),superconducting contacts https://ieeexplore.ieee.org/document/9446081 EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9383, 1557-9646 10.1109/TED.2021.3082809 NA M.Kruskopf S.Bauer Y.Pimsut A.Chatterjee D.K.Patel A.F.Rigosi R.E.Elmquist K.Pierz E.Pesel M.Götz J.Schurr article ZhangWLLWYLSC2021 2737 Chinese Physics Letters 2021 7 38 7 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 073201 Floquet, lattice clock, Rabi spectroscopy EMPIR 2017: Fundamental IOP Publishing 30 0256-307X, 1741-3540 NA https://arxiv.org/pdf/2007.00851.pdf X-F.Zhang Y-B.Wang T.Li X-T.Lu T.Wang M-J.Yin W-D.Li A.Smerzi H.Chang article ZhangWLLWYLSC2021_2 2737 Chinese Physics Letters 2021 7 38 7 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 073201 Floquet, lattice clock, Rabi spectroscopy EMPIR 2017: Fundamental IOP Publishing 30 0256-307X, 1741-3540 NA https://arxiv.org/pdf/2007.00851.pdf X-F.Zhang Y-B.Wang T.Li X-T.Lu T.Wang M-J.Yin W-D.Li A.Smerzi H.Chang article MarzanoTDSEOPKC2021 2115 ACTA IMEKO 2021 6 29 10 2 18SIB07: GIQS: Graphene impedance quantum standard 24 Quantum Hall effect, Metrology, Impedance, Graphene, Cryogenic probe https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-10%20%282021%29-02-05 EMPIR 2018: SI Broader Scope IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v10i2.925 NA M.Marzano N.T.M.Tran V.D'Elia D.Serazio E.Enrico M.Ortolano K.Pierz J.Kucera L.Callegaro article PrzyklenkBOEYAFPZCMRB2021 2104 Measurement Science and Technology 2021 6 21 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing Advance Manufacturing, Metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), Stakeholder EMPIR 2019: Support for Networks IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac0d25 NA A.Przyklenk A.Balsamo D.O'Connor A.Evans T.Yandayan A.Akgöz O.Flys D.Phillips V.Zelený D.Czułek F.Meli C.Ragusa H.Bosse article euchaHSHOiL2021 1981 Optics and Lasers in Engineering 2021 6 141 17IND03: LaVA: Large Volume Metrology Applications 106568 Laser interferometryOptical metrologyDimensional measurementCommon path interferometerDifferential interferometerTilt compensationLarge volume metrology EMPIR 2017: Industry Elsevier BV 30 0143-8166 10.1016/j.optlaseng.2021.106568 NA S.Rerucha M.Hola M.Sarbort J.Hrabina J.Oulehla O.Číp J.Lazar article DeleebeeckSNSRVHBLQCS2021 2183 Sensors 2021 6 21 11 17FUN09: UnipHied: Realisation of a Unified pH Scale 3935 pHabs; ionic liquid salt bridge; commercial glass electrodes; water–alcohol mixture;non-aqueous pH EMPIR 2017: Fundamental MDPI AG 30 1424-8220 10.3390/s21113935 NA L.Deleebeeck A.Snedden D.Nagy Z.Szilágyi Nagyné M.Roziková M.Vičarová A.Heering F.Bastkowski I.Leito R.Quendera V.Cabral D.Stoica article VeenC2021 2070 Accreditation and Quality Assurance 2021 6 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards measurement uncertainty, Monte Carlo method, GUM, propagation of distributions, law of propagation of uncertainty, sensitivity coefficient EMPIR 2017: Pre-Co-Normative Springer Science and Business Media LLC 30 0949-1775, 1432-0517 10.1007/s00769-021-01469-5 NA A.M.H. van derVeen M.G.Cox proceedings ZaniniSC2021 2611 euspen’s 21st International Conference & Exhibition, Copenhagen, DK, June 2021 2021 6 17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry X-ray computed tomography, Additive manufacturing, Lattice structures, Dimensional metrology, uncertainty https://www.euspen.eu/knowledge-base/ICE21306.pdf EMPIR 2017: Pre-Co-Normative Virtual Conference - Copenhagen, Denmark euspen’s 21st International Conference & Exhibition 07-06-2021 to 10-06-2021 30 10.5281/zenodo.6323598 NA F.Zanini E.Savio S.Carmignato article FahrbachFBXCBP2021 2255 Measurement: Sensors 2021 6 15 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 100042 Cantilever microprobe, Piezoresistive, Atomic force microscopy, Force–distance curves, Contact resonance, Lubricants EMPIR 2017: Industry Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100042 NA M.Fahrbach S.Friedrich H.Behle M.XU B.Cappella U.Brand E.Peiner article DitaliaTchernijCLTPDPMMOGF2021 2261 New Journal of Physics 2021 6 23 6 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 063032 diamond, ion implantation, single photon emitters, luminescent centers, Pb-related color center EMPIR 2017: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ac038a NA S.Ditalia Tchernij E.Corte T.Lühmann P.Traina S.Pezzagna I.P.Degiovanni G.Provatas E.Moreva J.Meijer P.Olivero M.Genovese J.Forneris article DitaliaTchernijCLTPDPMMOGF20210 2261 New Journal of Physics 2021 6 23 6 17FUN06: SIQUST: Single-photon sources as new quantum standards 063032 diamond, ion implantation, single photon emitters, luminescent centers, Pb-related color center EMPIR 2017: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ac038a NA S.Ditalia Tchernij E.Corte T.Lühmann P.Traina S.Pezzagna I.P.Degiovanni G.Provatas E.Moreva J.Meijer P.Olivero M.Genovese J.Forneris article DitaliaTchernijCLTPDPMMOGF20211 2261 New Journal of Physics 2021 6 23 6 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 063032 diamond, ion implantation, single photon emitters, luminescent centers, Pb-related color center EMPIR 2020: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ac038a NA S.Ditalia Tchernij E.Corte T.Lühmann P.Traina S.Pezzagna I.P.Degiovanni G.Provatas E.Moreva J.Meijer P.Olivero M.Genovese J.Forneris proceedings PrzyklenkBOEYAFZCPMRB2021 2123 Proceedings 21st euspen International Conference and Exhibition 2021 6 2021 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing advanced manufacturing, metrology, European metrology networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0 EMPIR 2019: Support for Networks Online Conference 21st euspen International Conference and Exhibition 07-06-2021 to 10-06-2021 30 NA https://www.euspen.eu/knowledge-base//ICE21292.pdf A.Przyklenk A.Balsamo D.O’Connor A.Evans T.Yandayan S.Akgöz O.Flys V.Zelený D.Czułek D.Phillips F.Meli C.Ragusa H.Bosse article KnotekBCKHUKS2021 2369 Flow Measurement and Instrumentation 2021 6 79 - 17IND13: Metrowamet: Metrology for real-world domestic water metering 101963 water consumption, consumption measurement, water meters, dynamic loads, billing EMPIR 2017: Industry Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2021.101963 NA S.Knotek M.Benkova N.Christophersen J.B.Kondrup S.Haack B.Unsal C.Kroner D.Schumann article RebufelloPASGDCVDG2021 2446 Light: Science & Applications 2021 5 25 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Quantum Measurement, Weak Values, Single Photons, Quantum Metrology EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2047-7538 10.1038/s41377-021-00539-0 NA E.Rebufello F.Piacentini A.Avella M.A. deSouza M.Gramegna J.Dziewior E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article LanzaMCCSDGNKRCMBP2021 2392 Meteorological Applications 2021 5 25 28 3 18NRM03: INCIPIT: Calibration and accuracy of non-catching instruments to measure liquid/solid atmospheric precipitation e2002 calibration, hydro-meteorology, meteomet, non-catching gauges, precipitation, precipitation measurement and analysis, uncertainty analysis, verification https://onlinelibrary.wiley.com/doi/10.1002/met.2002 EMPIR 2018: Pre-Co-Normative RMets 30 14698080 10.1002/met.2002 NA L.G.Lanza A.Merlone A.Cauteruccio E.Chinchella M.Stagnaro M.Dobre M.C.Garcia Izquierdo J.Nielsen H.Kjeldsen Y.A.Roulet G.Coppa C.Musacchio C.Bordianu M.Parrondo article PetryDSCCD2021 2072 Measurement Science and Technology 2021 5 19 32 8 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards 085008 AFM,mixed model,uncertainty calculation,Bayesian statistics,design of experiment EMPIR 2017: Pre-Co-Normative IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/abe47f NA J.Pétry B.De Boeck N.Sebaïhi M.Coenegrachts T.Caebergs M.Dobre article LombardiCDMMT2021 2509 Applied Physics Letters 2021 5 17 118 20 17FUN06: SIQUST: Single-photon sources as new quantum standards 204002 single-photon source, indistinguishability, molecule single-photon source https://aip.scitation.org/doi/10.1063/5.0048567 EMPIR 2017: Fundamental AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0048567 NA P.Lombardi M.Colautti R.Duquennoy G.Murtaza P.Majumder C.Toninelli article RebufelloPALVTGBCVDG2021 2447 Applied Sciences 2021 5 11 9 17FUN06: SIQUST: Single-photon sources as new quantum standards 4260 Quantum Measurement, Weak Measurement, Quantum Metrology, Single Photons EMPIR 2017: Fundamental MDPI AG 30 2076-3417 10.3390/app11094260 NA E.Rebufello F.Piacentini A.Avella R.Lussana F.Villa A.Tosi M.Gramegna G.Brida E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article RousselCFD2021 2219 PRX Quantum 2021 5 2 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 020314 Edge states, Integer quantum Hall effect, Mesoscopics, Quantum information processing, Quantum transport, Quasiparticles & collective excitations EMPIR 2017: Fundamental American Physical Society (APS) 30 2691-3399 10.1103/PRXQuantum.2.020314 NA B.Roussel C.Cabart G.Fève P.Degiovanni techreport CoxJR2021 2192 National Physical Laboratory 2021 4 28 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations implant safety, magnetic resonance imaging, MR safety EMPIR 2017: Industry National Physical Laboratory 30 10.47120/npl.MS28 NA M.Cox K.Jagan S.Rajan article SzulcMCBG2021 2394 Phys. Rev. B 2021 4 103 13 17FUN08: TOPS: Metrology for topological spin structures 134404 Spin Waves, Brillouin light scattering, interfacial Dzyaloshinskii-Moriya interaction https://arxiv.org/abs/2112.11206 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.103.134404 NA K. Szulc S. Mendisch F.Casoli M.Becherer G.Gubbiotti article ChaudharyMAOMPB2021 2656 Frontiers in Physics 2021 4 9 1 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates protontherapy, cancer, radiobiology, laser-driven ions, particle accelerator, ultra-high dose rate EMPIR 2018: Health Frontiers Media SA 30 2296-424X 10.3389/fphy.2021.624963 NA P.Chaudhary G.Milluzzo H.Ahmed B.Odlozilik A.McMurray K.M.Prise M.Borghesi article GruberBALBPCPDTCFSQ2021 2028 Journal of the European Radon Association 2021 3 31 2 2021 16ENV10: MetroRADON: Metrology for radon monitoring 1-14 radon, mapping, prediction, interpolation, radon priority areas, risk, hazard https://radonjournal.net/index.php/radon/article/view/5755 EMPIR 2016: Environment European Radon Association 30 2736-2272 10.35815/radon.v2.5755 NA V.Gruber S.Baumann O.Alber C.Laubichler P.Bossew E.Petermann G.Ciotoli A.Pereira F.Domingos F.Tondeur G.Cinelli A.Fernandez C.Sainz L.Quindos-Poncela article SilvaniATC2021 2021 Applied Sciences 2021 3 25 11 7 17FUN08: TOPS: Metrology for topological spin structures 2929 Micromagnetism, DMI, Magnetic dots EMPIR 2017: Fundamental MDPI AG 30 2076-3417 10.3390/app11072929 NA R.Silvani M.Alunni S.Tacchi G.Carlotti article CrottiDGLL2021 2139 Energies 2021 3 19 14 6 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements 1715 voltage transformer (VT); instrument transformer (IT); power system measurement; voltage measurement; harmonics; power quality (PQ); frequency response SEG https://www.mdpi.com/1996-1073/14/6/1715 EMPIR 2019: Pre-Co-Normative MDPI AG 30 1996-1073 10.3390/en14061715 NA G.Crotti G.D’Avanzo D.Giordano P.S.Letizia M.Luiso article CliffordMFHHKPRSP2021 2013 Nature Reviews Physics 2021 3 15 3 4 19NRM04: ISO-G-SCoPe: Standardisation of structural and chemical properties of graphene 233-235 graphene, standards, ISO, IEC, 2D materials, standardisation https://www.nature.com/articles/s42254-021-00278-6.epdf?sharing_token=_RIs5V6Xm7w_YnHU36ykhtRgN0jAjWel9jnR3ZoTv0NPpzni0dDHfaSDxkLVCOVw58FsyO6wELZUo5O32Eh0l-PBSDtirSTDnDrgEzBq40IQw69h7pcwLtLVCw2MuYIUVmHN0-WNNYkKy_jgkRmTZPKe2I2wUTrJd-QYBiq-ZrQ%3D EMPIR 2019: Pre-Co-Normative Springer Science and Business Media LLC 30 2522-5820 dx.doi.org/10.1038/s42254-021-00278-6 NA C.A.Clifford E.H.Martins Ferreira T.Fujimoto J.Herrmann A.R.Hight Walker D.Koltsov C.Punckt L.Ren G.J.Smallwood A.J.Pollard article IurlaroBCBFKMMMNNSVWi2021 2018 Radiation Measurements 2021 3 142 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 106543 Passive dosimetry systems, Uncertainty budget, Decision threshold, Detection limitEnvironmental radiation monitoring, Emergency preparedness EMPIR 2016: Environment Elsevier BV 30 1350-4487 10.1016/j.radmeas.2021.106543 NA G.Iurlaro Z.Baranowska L.Campani O.C.Bjelac P.Ferrari Ž.Knežević M.Majer F.Mariotti B.Morelli S.Neumaier M.Nodilo L.Sperandio F.A.Vittoria K.Wołoszczuk M.Živanović article DiCapuaMSDVCFFV2021 1927 Sustainability 2021 2 26 13 5 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 2556 behavioral modeling; inductive coupling; mutual inductance; wireless power transfer https://www.mdpi.com/2071-1050/13/5/2556 EMPIR 2016: Energy MDPI AG 30 2071-1050 10.3390/su13052556 NA G.Di Capua A.Maffucci K.Stoyka G.Di Mambro S.Ventre V.Cirimele F.Freschi N.Femia F.Villone article ZuccaCBSLCTFP2021 1918 Sustainability 2021 2 24 13 5 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 2436 electric vehicles; inductive charging; measurement uncertainty; power system measurements EMPIR 2016: Energy MDPI AG 30 2071-1050 10.3390/su13052436 NA M.Zucca V.Cirimele J.Bruna D.Signorino E.Laporta J.Colussi M.A.A.Tejedor F.Fissore U.Pogliano article SeegerOCGSSOALGFGKB2021 2069 Atmosphere 2021 2 21 12 3 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 309-326 TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS EMPIR 2019: Environment MDPI 30 EISSN 2073-4433 10.3390/atmos12030309 NA S.Seeger J.Osán O.Czömpöly A.Gross H.Stoßnach L.Stabile M.Ochsenkuehn-Petropoulou L.Areti Tsakanika T.Lymperopoulou S.Goddard M.Fiebig F.Gaie-Levrel Y.Kayser B.Beckhoff article SeegerOCGSSOALGFGKB20210 2069 Atmosphere 2021 2 21 12 3 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 309-326 TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS EMPIR 2016: Environment MDPI 30 EISSN 2073-4433 10.3390/atmos12030309 NA S.Seeger J.Osán O.Czömpöly A.Gross H.Stoßnach L.Stabile M.Ochsenkuehn-Petropoulou L.Areti Tsakanika T.Lymperopoulou S.Goddard M.Fiebig F.Gaie-Levrel Y.Kayser B.Beckhoff article SeegerOCGSSOALGFGKB20211 2069 Atmosphere 2021 2 21 12 3 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 309-326 TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS EMPIR 2019: Environment MDPI 30 EISSN 2073-4433 10.3390/atmos12030309 NA S.Seeger J.Osán O.Czömpöly A.Gross H.Stoßnach L.Stabile M.Ochsenkuehn-Petropoulou L.Areti Tsakanika T.Lymperopoulou S.Goddard M.Fiebig F.Gaie-Levrel Y.Kayser B.Beckhoff manual BrunaRomeroPLHFCBAZZG2021 1907 2021 2 17 16ENG08: MICEV: Metrology for inductive charging of electric vehicles Dosimetry, Guidelines, Magnetic field measurements, Magnetic field calculation, Numerical models, Uncertainty, Wireless Power Transfer, Electric Vehicle https://www.micev.eu/theme/inrim/assets/doc/BPG_Micev_2021.pdf EMPIR 2016: Energy INRIM 30 NA ISBN: 978-88-945324-1-8 J.Bruna Romero L.Pichon E.Laporta S.Harmon F.Freschi B.Clarke O.Bottauscio P.Ankarson L.Zilberti M.Zucca R.Guilizzoni article FernandezScarioniBCSHALRCKS2021 2055 Physical Review Letters 2021 2 16 126 7 17FUN08: TOPS: Metrology for topological spin structures 1-6/077202 Magnetism, Nernst effect, Skyrmions, Thermomagnetic effects EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.126.077202 NA A.Fernández Scarioni C.Barton H.Corte-León S.Sievers X.Hu F.Ajejas W.Legrand N.Reyren V.Cros O.Kazakova H.W.Schumacher article BuonincontriKKMGCDCCMFMGSRZ2021 1697 NeuroImage 2021 2 226 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers 117573 MRI, Quantitation, Relaxometry, Brain, MR fingerprinting, Three dimensional, 3D https://www.sciencedirect.com/science/article/pii/S1053811920310582?via%3Dihub EMPIR 2018: Health Elsevier BV 30 1053-8119 10.1016/j.neuroimage.2020.117573 NA G.Buonincontri J.W.Kurzawski J.D.Kaggie T.Matys F.A.Gallagher M.Cencini G.Donatelli P.Cecchi M.Cosottini N.Martini F.Frijia D.Montanaro P.A.Gómez R.F.Schulte A.Retico L.Zilberti article MelinCW2021 1908 Entropy 2021 2 23 2 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 212 entropy, information, metrology, measurement system analysis, Rasch, cognition, memory, task difficulty, person ability, neurodegenerative diseases, cognitive neuroscience EMPIR 2018: Health MDPI AG 30 1099-4300 10.3390/e23020212 NA J.Melin S.Cano W.Webster article ModiniCBIBPFEHMLMG2021 2010 Atmospheric Measurement Techniques 2021 2 14 2 16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols 819-851 miniCAST 5201 black carbon (BC) generator; particle morphology; nanostructure; optical properties; photoacoustic absorption coefficient EMPIR 2016: Environment Copernicus GmbH 30 1867-8548 10.5194/amt-14-819-2021 NA R.L.Modini J.C.Corbin B.T.Brem M.Irwin M.Bertò R.E.Pileci P.Fetfatzis K.Eleftheriadis B.Henzing M.M.Moerman F.Liu T.Müller M.Gysel-Beer article LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021 2093 Nanotechnology 2021 2 32 16 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 162003 Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap EMPIR 2017: Fundamental IOP Publishing 30 0957-4484, 1361-6528 10.1088/1361-6528/abb333 NA A.Laucht F.Hohls N.Ubbelohde M.Fernando Gonzalez-Zalba D.J.Reilly S.Stobbe T.Schröder P.Scarlino J.V.Koski A.Dzurak C-H.Yang J.Yoneda F.Kuemmeth H.Bluhm J.Pla C.Hill J.Salfi A.Oiwa J.T.Muhonen E.Verhagen M.D.LaHaye H.H.Kim A.W.Tsen D.Culcer A.Geresdi J.A.Mol V.Mohan P.K.Jain J.Baugh article ChenSDOLHCC2021 2425 Phys. Rev. Applied 2021 2 15 19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices 024006 GaAs, thin films, CL, doping, nanostructures EMPIR 2019: Energy 30 NA https://arxiv.org/abs/1909.05598 H.-L.Chen A.Scaccabarozzi R.De Lépinau F.Oehler A.Lemaıtre J.-C.Harmand A.Cattoni S.Collin article ChenDSOHCC2021 2475 Phys. Rev. Applied 2021 2 15 19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices 024007 GaAs nanowires, high-resolution cathodoluminescence (CL) mapping https://journals.aps.org/prapplied/pdf/10.1103/PhysRevApplied.15.024007 EMPIR 2019: Energy 30 NA https://arxiv.org/abs/1909.05602 H.-L.Chen R.De Lépinau A.Scaccabarozzi F.Oehler J.-C.Harmand A.Cattoni S.Collin article ArduinoZHZBCB2021 1867 Magnetic Resonance in Medicine 2021 1 22 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations gradient coil heating, hip prosthesis, MRI safety, numerical simulation, radiofrequency heating EMPIR 2017: Industry Wiley 30 0740-3194, 1522-2594 10.1002/mrm.28666 NA A.Arduino U.Zanovello J.Hand L.Zilberti R.Brühl M.Chiampi O.Bottauscio proceedings SimonotHSCLO2021 2396 Electronic Imaging 2021 1 18 2021 140-1-140- 18SIB03: BxDiff: New quantities for the measurement of appearance 1-6 BRDF MeasurementsSpeckleBRDF SimulationsMetrology of appearanceGloss https://www.ingentaconnect.com/content/ist/ei/2021/00002021/00000005/art00006 EMPIR 2018: SI Broader Scope Society for Imaging Science and Technology Electronic Imaging 2021 Electronic Imaging 2021 16-01-2021 to 29-01-2021 30 2470-1173 NA L.Simonot M.Hebert Y.Sortais P.Chavel T.Labardens G.Obein article LohvitheeSCS2021 2409 Sensors 2021 1 15 21 591 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry hyperparameter tuning, total variation (TV) regularization, iterative reconstruction, ant colony optimization, limited data X-ray CT, computer-aided hyperparameter selection, X-ray computed tomography, image reconstruction EMPIR 2017: Industry MDPI 30 10.3390/s21020591 NA M.Lohvithee W.Sun S.Chretien M.Soleimani article SteierDBTOCC2021 1871 Advanced Energy Materials 2021 1 14 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 2003446 CIGS, transient absorption spectroscopy EMPIR 2016: Energy Wiley 30 1614-6832, 1614-6840 10.1002/aenm.202003446 NA L.Steier J.R.Durrant C.Bozal‐Ginesta A.N.Tiwari M.Ochoa R.Carron Y‐H.Chang article MinutoliCCDPV2021 2344 Notiziario dell'Istituto Superiore di Sanità 2021 1 34 1 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 13-16 biomedical research, open science, hyperthermia, radiotherapy, Zenodo https://www.iss.it/documents/20126/0/Open+Science+Progetto+europeo+RaCHy.pdf/bebb34b6-0b8e-d0e0-c23b-5a3227bd9b7e?t=1613031471672 EMPIR 2018: Health Istituto Superiore di Sanità 59 1827-6296 NA https://doi.org/10.5281/zenodo.5728941 D.Minutoli B.CACCIA A.Campa G.Durando S.Pozzi S.Valentini article PietrosantoCL2021 1802 Measurement 2021 1 168 - 17IND13: Metrowamet: Metrology for real-world domestic water metering 108479 Smart water meter, Embedded system, Starting flow rate, Leakage detection, AMI, EMPIR EMPIR 2017: Industry Elsevier BV 30 0263-2241 10.1016/j.measurement.2020.108479 NA A.Pietrosanto M.Carratù C.Liguori article OrtolanoMDMRKKMCCKP2021 2054 IEEE Transactions on Instrumentation and Measurement 2021 70 17RPT04: VersICaL: A versatile electrical impedance calibration laboratory based on digital impedance bridges 1-14 Impedance measurement, bridge circuits, measurement errors, measurement uncertainty, calibration EMPIR 2017: Research Potential Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2020.3034115 NA M.Ortolano M.Marzano V.D'Elia N.T.Mai Tran R.Rybski J.Kaczmarek M.Koziol K.Musiol A.E.Christensen L.Callegaro J.Kucera O.Power article CrottiDLL2021 2564 IEEE Transactions on Instrumentation and Measurement 2021 70 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements 1-13 Harmonics, instrument transformer (IT), low-frequency oscillations, power quality (PQ), power system measurements, subharmonics, uncertainty, voltage transformer (VT) https://ieeexplore.ieee.org/document/9547226 EMPIR 2019: Pre-Co-Normative Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2021.3111995 NA G.Crotti G.D'Avanzo P.S.Letizia P.Letizia proceedings CrottiMVMCTL2021 2572 CIRED 2021 - The 26th International Conference and Exhibition on Electricity Distribution 2021 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements Instrument Transformers, Power Quality Measurements, Calibration, Measurement Technique, Measurement Uncertainty EMPIR 2019: Pre-Co-Normative Institution of Engineering and Technology Virtual Conference CIRED 2021 20-09-2021 to 23-09-2021 30 NA https://zenodo.org/record/6136940 G.Crotti J.Meyer H.van den Brom E.Mohns Y.Chen R.Tinarelli M.Luiso proceedings ClivatiRRTBCL2021 2740 Proceedings EFTF 2021 2021 1 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems OLC, Sr, 2D-MOT EMPIR 2017: Fundamental on line Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS) 07-07-2022 to 16-07-2022 30 NA https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip C.Clivati M.Risaro F.Rullo M.G.Tarallo M.Barbiero D.Calonico F.Levi proceedings ClivatiRRTBCL2021_2 2740 Proceedings EFTF 2021 2021 1 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems OLC, Sr, 2D-MOT EMPIR 2017: Fundamental on line Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS) 07-07-2022 to 16-07-2022 30 NA https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip C.Clivati M.Risaro F.Rullo M.G.Tarallo M.Barbiero D.Calonico F.Levi article RehbehnRBBSKMGMSC2021 2408 Physical Review A 2021 103 4 17FUN07: CC4C: Coulomb Crystals for Clocks L040801 research areas, dark matter, electronic transitions, particle interactions, techniques, spectroscopy, nuclear physics, atomic, molecular and optical EMPIR 2017: Fundamental American Physical Society 30 ISSN 2469-9934 (online), 2469- 10.1103/PhysRevA.103.L040801 NA N-H.Rehbehn M.K.Rosner H.Bekker J.C.Berengut P.O.Schmidt S.A.King P.Micke M.F.Gu R.Müller A.Surzhykov J.R.Crespo López-Urrutia article StarkWBCDKRGNOSSLSKLMSPC2021 2407 AIP Review of Scientific Instruments 2021 92 8 17FUN07: CC4C: Coulomb Crystals for Clocks 083203 Radio frequency cavities, radio-frequency quadrupole EMPIR 2017: Fundamental 30 10.1063/5.0046569 NA J.Stark C.Warnecke S.Bogen S.Chen E.A.Dijck S.Kühn M. K.Rosner A.Graf J.Nauta J-H.Oelmann L.Schmöger M.Schwarz D.Liebert L.J.Spieß S.A.King T.Leopold P.Micke P.O.Schmidt T.Pfeifer J.R.Crespo López-Urrutia article CelepS2021 2095 IEEE Transactions on Instrumentation and Measurement 2021 70 N/A 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 1008007 Calibration, measurement uncertainty, microcalorimeter, microwave power measurement, thermal isolation section (TIS) EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2021.3084306 NA M.Celep D.Stokes thesis Condio2021 2247 2021 18SIB05: ROCIT: Robust Optical Clocks for International Timescales Optical lattice clock, SI second https://sia.unito.it/studenti/intesi/Ricerca_tesi_libera/ricerca_tesi_dettaglio.asp?id_upload=209134&cdl_tesi=&cdl=&matricola=815511 EMPIR 2018: SI Broader Scope University of Torino 30 10.5281/zenodo.5566671 NA S.Condio proceedings KhanbabaeeRBRFHZTLdBGGCA2021 2377 RAD Conference Proceedings 2021 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation Activity standards, new operational quantities in radiation protection, type testing, calibration, radon,reference field, pulsed radiation, dosimetry, standards, radiological emergency response EMPIR 2019: Support for Networks RAD Centre Herceg Novi, Montenegro 9th international conference on Radiation in various fields of research 14-06-2021 to 18-06-2021 30 10.21175/RadProc.2021.04 NA B.Khanbabaee A.Röttger R.Behrens S.Röttger S.Feige O.Hupe H.Zutz P.Toroi P.Leonard L.de la Fuente Rosales P.Burgess V.Gressier J–L.Gutiérrez Villanueva R.Cruz Suárez D.Arnold proceedings FurtadoPQSLMAARLBCLA2020 1898 ACTA IMEKO 2020 12 31 9 5 17RPT02: rhoLiq: Establishing traceability for liquid density measurements 79 EMPIR rhoLiq Project; oscillation-type density meter; viscoelasticity; comparison EMPIR 2017: Research Potential IMEKO International Measurement Confederation - IMEKO TC3, TC5, TC16 and TC2 16-11-2020 to 18-11-2020 30 2221-870X 10.21014/acta_imeko.v9i5.943 NA A.Furtado J.Pereira R.Quendera M.Schiebl E.Lenard E.Malejczyk A.Alic S.Alisic J.Rauch F.Lorenz A.Bescupschii A.Ciubara B.Laky R.Amsüss article ZelenkaASHKPPDZCM2020 2108 ACTA IMEKO 2020 12 31 9 5 19RPT02: RealMass: Improvement of the realisation of the mass scale 4 Mass realisation, kilogram, multiplies and sub-multiplies, subdivision and multiplication, OIML R111 https://acta.imeko.org/index.php/acta-imeko/index EMPIR 2019: Research Potential IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i5.928 NA Z.Zelenka S.Alisic B.Stoilkovska R.Hanrahan I.Kolozinsky G.Popa D.Pantic V.Dikov J.Zůda M.Coenegrachts A.Malengo article ChouhanJHBGSBH2020 2033 Nano Select 2020 12 30 2 4 16ENV01: MercOx: Metrology for oxidised mercury 712-743 sorbent traps, tri‐s‐triazine‐based graphitic carbon nitride, nanostructured material, sonsors, mercury EMPIR 2016: Environment Wiley 30 2688-4011, 2688-4011 10.1002/nano.202000228 NA R.S.Chouhan I.Jerman D.Heath S.Bohm S.Gandhi V.Sadhu S.Baker M.Horvat article MarzanoODMC2020 1847 Metrologia 2020 12 22 58 18SIB07: GIQS: Graphene impedance quantum standard 015002 digital impedance bridges, impedance metrology, quantum hall effect https://iopscience.iop.org/article/10.1088/1681-7575/abba86 EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/abba86 NA M.Marzano M.Ortolano V.D’Elia A.Müller L.Callegaro article FerreroFSSSCH2020 1778 Optics Express 2020 12 22 29 1 18SIB03: BxDiff: New quantities for the measurement of appearance 219 BRDF, BSSRDF, reflectance, transmittance EMPIR 2018: SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.410225 NA A.Ferrero J.R.Frisvad L.Simonot P.Santafé A.Schirmacher J.Campos M.Hebert article ChenMSd2020 2065 Sensors 2020 12 21 20 24 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 7345 resampling algorithm; sampled values; SV-based instrumentation; SV-based calibration; phase synchronisation; sinc interpolation https://www.mdpi.com/1424-8220/20/24/7345 EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s20247345 NA Y.Chen E.Mohns M.Seckelmann S.de Rose article GabrischDLWCGFKPP2020 1844 Biomedical Physics & Engineering Express 2020 12 18 7 1 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 015012 ultra-high pulse dose rates, dosimetry, metrology, ionization chamber EMPIR 2018: Health IOP Publishing 30 2057-1976 10.1088/2057-1976/abcae5 NA L.Gabrisch B.Delfs H.K.Looe V.Wyrwoll R.Corsini A.Gilardi W.Farabolini R.Kranzer D.Poppinga B.Poppe article DitaliaTchernijLCSPTBCPPDMAOSMGF2020 1730 Scientific Reports 2020 12 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 21537 Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-78436-6 NA S.Ditalia Tchernij T.Lühmann E.Corte F.Sardi F.Picollo P.Traina M.Brajković A.Crnjac S.Pezzagna Ž.Pastuović I.P.Degiovanni E.Moreva P.Aprà P.Olivero Z.Siketić J.Meijer M.Genovese J.Forneris article DitaliaTchernijLCSPTBCPPDMAOSMGF2020_2 1806 Scientific Reports 2020 12 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-78436-6 NA S.Ditalia Tchernij T.Lühmann E.Corte F.Sardi F.Picollo P.Traina M.Brajković A.Crnjac S.Pezzagna Ž.Pastuović I.P.Degiovanni E.Moreva P.Aprà P.Olivero Z.Siketić J.Meijer M.Genovese J.Forneris article SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020 1841 Physica Medica 2020 12 80 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 134-150 Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project EMPIR 2018: Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2020.09.020 NA A.Schüller S.Heinrich C.Fouillade A.Subiel L.De Marzi F.Romano P.Peier M.Trachsel C.Fleta R.Kranzer M.Caresana S.Salvador S.Busold A.Schönfeld M. McEwen F.Gomez J.Solc C.Bailat V.Linhart J.Jakubek J.Pawelke M.Borghesi R-P.Kapsch A.Knyziak A.Boso V.Olsovcova C.Kottler D.Poppinga I.Ambrozova C-S.Schmitzer S.Rossomme M-C.Vozenin article PetrovRCG2020 2037 Atmospheric Environment: X 2020 12 8 16ENV01: MercOx: Metrology for oxidised mercury 100090 gaseous oxidized mercury, validation, ICP-MS EMPIR 2016: Environment Elsevier BV 30 2590-1621 10.1016/j.aeaoa.2020.100090 NA P.Petrov T.Rajamaki W.T.Corns H.Goenaga-Infante article PiliaSRGDKCL2020 2455 APL Bioengineering 2020 12 4 4 18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management 041501 Electrolytes, Medical diagnosis, Computational models, Wearable technology, Medical tests, Artificial neural networks, Artificial intelligence, Machine learning, Dialysis EMPIR 2018: Health AIP Publishing 30 2473-2877 10.1063/5.0018504 NA N.Pilia S.Severi J.G.Raimann S.Genovesi O.Dössel P.Kotanko C.Corsi A.Loewe article LopezMPSGBSCDK2020 1731 EPJ Quantum Technology 2020 11 25 7 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 14 Quantum technologyQuantum radiometryDetection efficiencySingle-photon detectorsSingle-photon sourcesMetrology EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2662-4400, 2196-0763 10.1140/epjqt/s40507-020-00089-1 NA M.López A.Meda G.Porrovecchio R.A.Starkwood M.Genovese G.Brida M.Smid C.J.Chunnilall I.P.Degiovanni S.Kück article FerreroC2020 1741 Coatings 2020 11 21 10 11 16NRM08: BiRD: Bidirectional reflectance definitions 1128 BRDF measurements; goniochromatism; special effect coatings; colour EMPIR 2016: Pre-Co-Normative MDPI AG

Postfach Basel CH-4005 Switzerland

30 2079-6412 10.3390/coatings10111128 NA A.Ferrero J.Campos article FriedrichC2020 1748 Beilstein Journal of Nanotechnology 2020 11 12 11 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 1714-1727 atomic force microscopy, contact resonance, mechanical properties, polymers; wear EMPIR 2017: Industry Beilstein Institut 30 2190-4286 10.3762/bjnano.11.154 NA S.Friedrich B.Cappella article FerreroBCPPPSSVM2020 1740 Metrologia 2020 11 11 57 6 16NRM08: BiRD: Bidirectional reflectance definitions 065029 sparkle, texture, reflectance, contrast threshold, gonio-spectrophotometry EMPIR 2016: Pre-Co-Normative IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/abb0a3 NA A.Ferrero N.Basic J.Campos M.Pastuschek E.Perales G.Porrovecchio M.Smid A.Schirmacher J.L. Velázquez F.Martínez-Verdú miscellaneous ArduinoPZKC 1667 2020 11 6 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Electric Properties Tomography; Magnetic Resonance Imaging; Variance-covariance matrix; Shrinkage estimation; Law of propagation of uncertainty EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.4248879 NA A.Arduino F.Pennecchi LZilberti U.Katscher M.G.Cox miscellaneous auseviCG 1660 2020 11 3 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Pressure drop measurement, measurement uncertainty, leak test, correlations EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.4243049 NA M.Čaušević M.G.Cox J.Greenwood article MitevCPGDMS2020 1836 Applied Radiation and Isotopes 2020 11 165 16ENV10: MetroRADON: Metrology for radon monitoring 109259 Thoron (220Rn), Thoron calibration, Thoron homogeneity, LSC, Nuclear track detectors https://zenodo.org/record/4160815 EMPIR 2016: Environment Elsevier BV 30 0969-8043 10.1016/j.apradiso.2020.109259 NA K.Mitev P.Cassette D.Pressyanov S.Georgiev C.Dutsov N.Michielsen B.Sabot miscellaneous auseviCv 1645 2020 10 21 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards gas flow measurement, measurement uncertainty, master meter, meter under test, calibration EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.4114438 NA M.Čaušević M.G.Cox A.M.H.van der Veen article HanZGPCSLHKSPLP2020 1868 Metrologia 2020 10 19 57 6 18SIB02: Real-K: Realising the redefined kelvin 065006 SPRIGT, Cryostat, Resonator.thermodynamic temperature, SEG https://iopscience.iop.org/article/10.1088/1681-7575/ab84ca/pdf EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab84ca NA D.Han H.Zhang B.Gao C.Pan H.Chen Y.Song W.Liu J.Hu X.Kong F.Sparasci M.Plimmer E.Luo L.Pitre article ClarkKE2020 1686 New Journal of Physics 2020 10 15 22 10 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 103031 electron quantum optics,mesoscopics,electron transport, quantum Hall effect,electron interferometry EMPIR 2017: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/abb9e5 NA L.A.Clark M.Kataoka C.Emary miscellaneous auseviMvC 1638 2020 10 13 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards permeation, calibration gas mixtures, uncertainty evaluation EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.4084956 NA M.Čaušević H.Meuzelaar A.M.H.van der Veen M.G.Cox article CzachorowskiPLPJ2020 2710 Physical Review A 2020 10 12 102 4 18SIB02: Real-K: Realising the redefined kelvin coefficient, Second virial https://arxiv.org/abs/2007.09767 EMPIR 2018: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.102.042810 NA P.Czachorowski M.Przybytek M.Lesiuk M.Puchalski B.Jeziorski article SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI2020 1664 Nature Physics 2020 10 18SIB05: ROCIT: Robust Optical Clocks for International Timescales Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology http://hdl.handle.net/11696/64130 EMPIR 2018: SI Broader Scope Springer Science and Business Media LLC 30 1745-2473, 1745-2481 10.1038/s41567-020-01038-6 NA M.Sekido K.Takefuji H.Ujihara H.Hachisu N.Nemitz M.Tsutsumi T.Kondo E.Kawai R.Ichikawa K.Namba Y.Okamoto R.Takahashi J.Komuro C.Clivati F.Bregolin P.Barbieri A.Mura E.Cantoni G.Cerretto F.Levi G.Maccaferri M.Roma C.Bortolotti M.Negusini R.Ricci G.Zacchiroli J.Roda J.Leute G.Petit F.Perini D.Calonico M.Pizzocaro T.Ido article SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI20200 1664 Nature Physics 2020 10 17IND14: WRITE: Precision Time for Industry Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology http://hdl.handle.net/11696/64130 EMPIR 2017: Industry Springer Science and Business Media LLC 30 1745-2473, 1745-2481 10.1038/s41567-020-01038-6 NA M.Sekido K.Takefuji H.Ujihara H.Hachisu N.Nemitz M.Tsutsumi T.Kondo E.Kawai R.Ichikawa K.Namba Y.Okamoto R.Takahashi J.Komuro C.Clivati F.Bregolin P.Barbieri A.Mura E.Cantoni G.Cerretto F.Levi G.Maccaferri M.Roma C.Bortolotti M.Negusini R.Ricci G.Zacchiroli J.Roda J.Leute G.Petit F.Perini D.Calonico M.Pizzocaro T.Ido article JandaGOPUHRSMRNCHWEACDMORONJKZ2020 1683 Physical Review Materials 2020 9 28 4 9 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 094413-1 to 094413-9 - https://arxiv.org/abs/2004.05460 EMPIR 2016: Energy American Physical Society (APS)

1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States

30 2475-9953 10.1103/PhysRevMaterials.4.094413 NA T.Janda J.Godinho T.Ostatnicky E.Pfitzner G.Ulrich A.Hoehl S.Reimers Z.Šobáň T.Metzger H.Reichlová V.Novák R. P.Campion J.Heberle P.Wadley K. W.Edmonds O. J.Amin J. S.Chauhan S. S.Dhesi F.Maccherozzi R. M.Otxoa P. E.Roy K.Olejník P.Němec T.Jungwirth B.Kaestner FrancoisZiade article WelshvBCHLLLvNTWWJ2020 1707 Journal of Extracellular Vesicles 2020 9 24 9 1 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses 1816641 Calibration; exosomes; extracellular vesicles; microvesicles; optical analysis; reference materials; standardization; quality control; validation EMPIR 2018: Health 30 2001-3078 10.1080/20013078.2020.1816641 NA J.A. Welsh E.van der Pol B.A. Bettin D.R.F. Carter A.Hendrix M.Lenassi M-A. Langlois A.Llorente A.S.van de Nes R.Nieuwland V.Tang L.Wang K.W. Witwer J.C. Jones article EckmannvCLvKR2020 1605 International Journal of Thermophysics 2020 9 23 41 11 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 1-19/156 Cryogenic state · Density measurement · Liquefied binary mixtures ·Magnetic-suspension coupling · Single-sinker densimeter EnG EMPIR 2016: Energy Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-020-02728-2 NA P.Eckmann N.von Preetzmann G.Cavuoto J.Li A.van der Veen R.Kleinrahm M.Richter article ChristinckRLHGK2020 1880 Applied Physics B 2020 9 18 126 10 17FUN06: SIQUST: Single-photon sources as new quantum standards Single-photon sources EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 0946-2171, 1432-0649 10.1007/s00340-020-07508-2 NA J.Christinck B.Rodiek M.López H.Hofer H.Georgieva S.Kück article CrottiGLDL2020 2131 Proceedings of the 24th IMEKO TC-4 International Symposium, September 14-16, 2020 2020 9 14 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements Power system measurement, Instrument Transformer, Harmonics, Voltage Measurement SEG EMPIR 2019: Pre-Co-Normative 30 10.5281/zenodo.5136702 NA G.Crotti D.Giordano P.S.Letizia A.Delle Femine M.Luiso miscellaneous CarulloCV 1597 2020 9 14 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Data acquisition systems; Electrical quantities: Measurement uncertainty; Cross Talk EMPIR 2017: Pre-Co-Normative 30 NA https://zenodo.org/record/4028283 ACarullo S.Corbellini A.Vallan proceedings CrottiDGGLLS2020 1962 IEEE 2020 9 10 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Voltage measurement, Uncertainty, Current measurement, Transducers, Phantoms, Calibration, Rail transportation, Combined Transducers, Power Measurement, Phantom Power, DC Railway, Energy Meter SEG https://zenodo.org/record/4569831 EMPIR 2016: Energy IEEE Denver, CO, USA 2020 Conference on Precision Electromagnetic Measurements 24-08-2020 to 28-08-2020 30 978-1-7281-5898-3 2160-0171 10.1109/CPEM49742.2020.9191718 NA G.Crotti A.Delle Femine D.Gallo D.Giordano M.Luiso C.Landi D.Signorino proceedings Chen2020 1746 316. PTB-Seminar, Aktuelle Fortschritte von Kalibrierverfahren im Nieder- und Hochfrequenzbereich 2020 2020 9 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 7 Breitband, Stromwandler, Kalibrierung, Referenzwandler, Messwandler, Messwiderstand http://doi.org/10.7795/810.20201113 EMPIR 2017: Industry Physikalisch-Technische Bundesanstalt (PTB) Physikalisch-Technische Bundesanstalt (PTB), Braunschweig, Germany 316. PTB-Seminar, Aktuelle Fortschritte von Kalibrierverfahren im Nieder- und Hochfrequenzbereich 2020 03-09-2020 to 03-09-2020 43 NA http://doi.org/10.7795/810.20201113 Y.Chen article LuisoLLFCL2020 1743 IEEE Transactions on Instrumentation and Measurement 2020 9 69 9 18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods 6667-6676 High-frequency (HF) distortion,LED lamps,power quality,power system harmonics,power system measurements SEG https://ieeexplore.ieee.org/document/9094688 EMPIR 2018: Pre-Co-Normative Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2020.2992824 NA M.Luiso R.Langella C.Landi A.D.Femine A.J.Collin M.Luiso proceedings CascettaCDGGS2020 1940 IMEKO TC-4 2020 PROCEEDINGS 2020 9 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Railway braking energy, reversible substation, energy efficiency, voltage-current measurements https://www.imeko.org/publications/tc4-2020/IMEKO-TC4-2020-24.pdf EMPIR 2016: Energy Palermo, Italy 24th IMEKO TC4 International Symposium 22nd International Workshop on ADC and DAC Modelling and Testing 14-09-2020 to 16-09-2020 30 978-92-990084-7-8 NA 978-92-990084-7-8 F.Cascetta G.Cipolletta A.Delle Femine D. Gallo D.Giordano D.Signorino article GeorgievaLHCRSKHRRK2020 1881 Metrologia 2020 9 57 5 17FUN06: SIQUST: Single-photon sources as new quantum standards 055001 quantum radiometry, quantum metrology, single-photon source, single-photondetector, quantum dot EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab9db6 NA H.Georgieva M.López H.Hofer J.Christinck B.Rodiek P.Schnauber A.Kaganskiy T.Heindel S.Rodt S.Reitzenstein S.Kück article CultreraC2020 1657 IOP SciNotes 2020 8 28 1 2 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics 025004 L-curve, regularization, numerical problems, inverse problems, ill-posed problems, iterative, easy implementation https://iopscience.iop.org/article/10.1088/2633-1357/abad0d EMPIR 2016: Pre-Co-Normative IOP Publishing 30 2633-1357 10.1088/2633-1357/abad0d NA A.Cultrera L.Callegaro article CrottivMTLSACMMA2020 2130 Conference on Precision Electromagnetic Measurements CPEM 2020 Proceedings 2020 8 24 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements Instrument transformers, calibration, measurement standards, measurement techniques, measurementuncertainty, precision measurements SEG EMPIR 2019: Pre-Co-Normative 30 10.5281/zenodo.5136547 NA G.Crotti H.E.van den Brom E.Mohns R.Tinarelli M.Luiso R.Styblikova M.Agazar H.Çaycı P.Mazza J.Meyer M. Almutairi proceedings ChenMBR2020 1765 2020 Conference on Precision Electromagnetic Measurements 2020 8 24 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation Wideband, current transformers, calibration, measurement uncertainty, instrument transformer SEG EMPIR 2017: Industry Zenodo Denver (Aurora), CO, USA, USA 2020 Conference on Precision Electromagnetic Measurements 24-08-2020 to 28-08-2020 30 NA https://zenodo.org/record/4348461 Y.Chen E.Mohns H.Badura P.Raether article ClivatiABBDDMMMNLPRRSSSTC2020 1773 Optica 2020 8 20 7 8 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 1031 fiber links, coherent phase transfer, frequency dissemination with fibers, VLBI EMPIR 2018: SI Broader Scope The Optical Society 30 2334-2536 10.1364/OPTICA.393356 NA C.Clivati R.Aiello G.Bianco C.Bortolotti P.De Natale V.Di Sarno P.Maddaloni G.Maccaferri A.Mura M.Negusini F.Levi F.Perini R.Ricci M.Roma L.Santamaria Amato M.Siciliani de Cumis M.Stagni A.Tuozzi C.Clivati article CainSTLWKBLF2020 1615 Crystals 2020 8 20 10 9 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 728 - https://electrosciences.co.uk/2020/08/27/grazing_incidence/ EMPIR 2016: Energy MDPI AG 30 2073-4352 10.3390/cryst10090728 NA M.G.Cain M.Staruch P.Thompson C.Lucas D.Wermeille Y.Kayser B.Beckhoff S.E.Lofland P.Finkel article deKromBZEvvvvHvDCE2020 1994 Measurement 2020 8 16 169 2021 16ENV01: MercOx: Metrology for oxidised mercury 108351 Mercury, Metrology, Primary gas standard, Calibration, SI-traceability, Environmental EMPIR 2016: Environment Elsevier 30 0263-2241 10.1016/j.measurement.2020.108351 NA I.de Krom W.Bavius R.Ziel E.Efremov D.van Meer P.van Otterloo I.van Andel D.van Osselen M.Heemskerk A.M.H.van der Veen M.A.Dexter W.T.Corns H.Ent article GomezCGSPHFPTMB2020 1698 Scientific Reports 2020 8 13 10 1 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers Magnetic Resonance Imaging (MRI)Quantitative MRIMagnetic Resonance Fingerprinting https://www.nature.com/articles/s41598-020-70789-2 EMPIR 2018: Health Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-70789-2 NA P.A.Gómez M.Cencini M.Golbabaee R.F.Schulte C.Pirkl I.Horvath G.Fallo L.Peretti M.Tosetti B.H.Menze G.Buonincontri proceedings CrottiFGGLLL2020 1726 2020 Conference on Precision Electromagnetic Measurements (CPEM) 2020 8 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation Low power instrument transformer, power grid, power quality, phasor measurement unit, uncertainty SEG EMPIR 2017: Industry IEEE Denver (Aurora), CO, USA, USA 2020 Conference on Precision Electromagnetic Measurements (CPEM) 24-08-2020 to 28-08-2020 30 10.5281/zenodo.4153819 NA G.Crotti A.D.Femine D.Gallo D.Giordano C.Landi P.S.Letizia P.Letizia article LiuACA2020 1608 International Journal of Environmental Research and Public Health 2020 7 24 17 15 16NRM07: Vector SAR: SAR measurement using vector probes 5355 specific absorption rate; fast SAR measurement; field reconstruction; plane-wave expansion; traditional SAR measurement; measurement discrepancy EMPIR 2016: Pre-Co-Normative MDPI AG 30 1660-4601 10.3390/ijerph17155355 NA Z.Liu D.Allal M.Cox D.Allal article FerreroBCRFM2020 1858 Journal of the Optical Society of America A 2020 7 22 37 8 IND52: xDReflect: Multidimensional reflectometry for industry 1266 Color, gray scale, goniochromatism https://digital.csic.es/bitstream/10261/227636/1/Goniochromatic%20assessment.pdf EMRP A169: Call 2012 Metrology for Industry (II) The Optical Society 30 1084-7529, 1520-8532 10.1364/JOSAA.394170 NA A.Ferrero B.Bernad J.Campos N.Richard C.Fernández-Maloigne M.Melgosa miscellaneous CoxS 1538 2020 7 16 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Key comparison, calibration and measurement capability (CMC), measurement uncertainty, Bayesian estimation EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3948342 NA M.Cox K.Shirono article CalderonFC2020 1779 Metrologia 2020 7 13 57 4 18SIB03: BxDiff: New quantities for the measurement of appearance 045003 BRDF, polarization, reflectance. EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab804f NA A.Calderón A.Ferrero J.Campos article HeeringSCANNQRBBNSLLURVSDRKL2020 1554 Symmetry 2020 7 12 7 17FUN09: UnipHied: Realisation of a Unified pH Scale 1150 unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid EMPIR 2017: Fundamental MDPI AG 30 2073-8994 10.3390/sym12071150 NA AgnesHeering DanielaStoica FilomenaCamões BárbaraAnes DánielNagy ZsófiaNagyné Szilágyi RaquelQuendera LuisRibeiro FrankBastkowski RasmusBorn JaakNerut JaanSaame SilvieLainela LokmanLiv EmrahUysal MatildaRoziková MartinaVičarová AlanSnedden LisaDeleebeeck ValentinRadtke IngoKrossing IvoLeito article FahrbachFCP2020 1651 Journal of Sensors and Sensor Systems 2020 7 9 2 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 179-187 piezoresistive microprobes, AFM https://jsss.copernicus.org/articles/9/179/2020/#section11 EMPIR 2017: Industry Copernicus GmbH 30 2194-878X 10.5194/jsss-9-179-2020 NA M.Fahrbach S.Friedrich B.Cappella E.Peiner article BogoalecKosirCKGZM2020 2145 Journal of Virological Methods 2020 7 281 / 15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance 113864 Digital PCR, Antimicrobial-Drug resistance, HCMV, Polymerase chain reaction, Viruses EMPIR 2015: Health Elsevier BV 30 0166-0934 10.1016/j.jviromet.2020.113864 NA A.Bogožalec Košir T.Cvelbar M.Kammel H-P.Grunert H.Zeichhardt M.Milavec miscellaneous ElsterECNKM 1527 2020 6 28 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Measurement model; GUM; Straight-line regression; Correlation; Weighted total least-squares; Method comparison; Haemoglobin; AHD; HiCN EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3911584 NA C.Elster S.Ellison S.Cowen J.Neukammer K.Klauenberg S.Martens article BossewCCCDEGPT2020 1837 International Journal of Environmental Research and Public Health 2020 6 10 17 11 16ENV10: MetroRADON: Metrology for radon monitoring 4134 geogenic radon hazard index, geogenic radon potential, European map of geogenic radon EMPIR 2016: Environment MDPI 30 EISSN 1660-4601 10.3390/ijerph17114134 NA P.Bossew G.Cinelli G.Ciotoli Q.G.Crowley M.De Cort J.Elío Medina V.Gruber E.Petermann T.Tollefsen article BoudaoudCO2020 1493 Flow Measurement and Instrumentation 2020 6 73 18HLT08: MEDDII: Metrology for drug delivery 101746 Optical Method, volume, microflow EMPIR 2018: Health Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101746 NA F.Ogheard P.Cassette A.Boudaoud article KolovouGCBL2020 1524 Radiation Protection Dosimetry 2020 6 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident electret ion chambers,ambient dose equivalent rates EMPIR 2016: Environment Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncaa061 NA F.Leontaris A.Boziari A.Clouvas M.Kolovou J.Guilhot article ColauttiLTPPTNCWT2020 1882 Advanced Quantum Technologies 2020 6 3 7 17FUN06: SIQUST: Single-photon sources as new quantum standards 2000004 direct laser writingintegrated opticsquantum emitters single molecules single photon sources EMPIR 2017: Fundamental Wiley 30 2511-9044, 2511-9044 10.1002/qute.202000004 NA M.Colautti P.Lombardi M.Trapuzzano F.S.Piccioli S.Pazzagli B.Tiribilli S.Nocentini F.S.Cataliotti D.S.Wiersma C.Toninelli article LucasCTDABLYSMPF2020 1611 Applied Physics Letters 2020 6 116 22 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 222903 - https://livrepository.liverpool.ac.uk/3091334/ EMPIR 2016: Energy AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0007820 NA C.A.Lucas M.G.Cain P.B.J.Thompson D.Damjanovic L.Antonelli F.Blackmon S.E.Lofland S.Young M.Staruch B.R.Matis E.A.Patterson P.Finkel proceedings BosseEZCBOYBMRF2020 1665 Proceedings 20th euspen International Conference and Exhibition 2020 6 2020 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing Advanced Manufacturing, Key Enabling Technology (KET), Strategic Research Agenda (SRA), European Metrology Network (EMN) EMPIR 2019: Support for Networks Online Conference 20th euspen International Conference and Exhibition 08-06-2020 to 12-06-2020 30 978-0-9957751-7-6 NA https://www.euspen.eu/knowledge-base/ICE20374.pdf H.Bosse A.Evans V.Zelený D.Czulek A.Balsamo D.O'Connor T.Yandayan D.Billington F.Meli C.Ragusa O.Flys article HarrisLXWZYBWKCBSM2020 1578 Atmospheric Measurement Techniques 2020 5 28 13 - 16ENV06: SIRS: Metrology for stable isotope reference standards 2797–2831 nitrous oxide, isotopic composition, laser spectroscopy, spectral interference, matrix effect https://www.dora.lib4ri.ch/empa/islandora/object/empa%3A22186 EMPIR 2016: Environment Copernicus Gesellschaft mbH

Göttingen

30 10.5194/amt-13-2797-2020 NA Stephen J.Harris JesperLiisberg LonglongXia JingWei KerstinZeyer LongfeiYu MattiBarthel BenjaminWolf Bryce F. J.Kelly Dioni I.Cendón ThomasBlunier JohanSix JoachimMohn article CiobanuOTOZLI2020 1771 Romanian Journal of Physics 2020 5 25 65 3-4 16ENV10: MetroRADON: Metrology for radon monitoring 808 “MetroMC”, Monte Carlo, ionizing radiation metrology EMPIR 2016: Environment Editura Academiei Romane 30 NA http://www.nipne.ro/rjp/2020_65_3-4/RomJPhys.65.808.pdf S.Ciobanu G.Ormenisan L.C.Tugulan C.Olaru M.Zadehrafi A.Luca M.R.Ioan proceedings CrottiGDFGLLLBMP2020 1727 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 2020 5 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation Instrument transformers, power grid, power quality, phasor measurement unit, uncertainty SEG https://zenodo.org/record/4154617#.X9DyOthKguU EMPIR 2017: Industry IEEE Dubrovnik, Croatia, Croatia 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 25-05-2020 to 28-05-2020 30 10.5281/zenodo.4154617 NA G.Crotti D.Giordano G.D'Avanzo A.D.Femine D.Gallo C.Landi M.Luiso P.S.Letizia L.Barbieri P.Mazza D.Palladini article CouplandPBDLTSL2020 1523 Optics and Lasers in Engineering 2020 5 128 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 106015 Lens aberration interference microscopy EMPIR 2015: SI Broader Scope Elsevier BV

Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands

30 0143-8166 10.1016/j.optlaseng.2020.106015 NA R.Su M.Thomas M.Liu J.Drs Y.Bellouard C.Pruss J.Coupland R.Leach proceedings CipollettaFGLLGPBFGG2020 1939 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 2020 5 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Railway system, DC Reversible Substations, Inverting Substations, DC Power Quality, Energy measurement, Energy Savings, Power System Measurement https://zenodo.org/record/4570008#.YESU4WhKiCo EMPIR 2016: Energy IEEE Dubrovnik, Croatia 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 25-05-2020 to 28-05-2020 30 978-1-7281-4461-0 2642-2077 10.1109/I2MTC43012.2020.9128644 NA G.Cipolletta A.D.Femine D.Gallo C.Landi M.Luiso A.Gallo L.Pastena F.Balic J.Q.Fernandez D.Giordano DomenicoGiordano article FrisvadJMCYGMH2020 1849 Computer Graphics Forum 2020 5 39 2 18SIB03: BxDiff: New quantities for the measurement of appearance 729-755 Appearance, graphics, BRDF, BTDF, BSSRDF, https://diglib.eg.org/handle/10.1111/cgf14023 EMPIR 2018: SI Broader Scope Wiley 30 0167-7055, 1467-8659 10.1111/cgf.14023 NA J.R.Frisvad S.A.Jensen J.S.Madsen A.Correia L.Yang S.K.S.Gregersen Y.Meuret P‐E.Hansen article OsanBCDGSH2020 1569 Spectrochimica Acta Part B: Atomic Spectroscopy 2020 5 167 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 105852 Atmospheric aerosols, Ultrafine particles, Cascade impactor, TXRF, Elemental size distribution EMPIR 2016: Environment Elsevier BV

Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands

30 0584-8547 10.1016/j.sab.2020.105852 NA JánosOsán EndreBörcsök OttóCzömpöly CsengeDian VeronikaGroma LucaStabile GarryHensey manual CultreraCF2020 1507 2020 4 30 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics graphene, electrical, characterization, standardization EMPIR 2016: Pre-Co-Normative INRIM 30 978-88-945324-2-5 NA https://arxiv.org/abs/2007.14047 A.Fabricius A.Cultrera A.Catanzaro manual CultreraCF2020_2 1506 2020 4 30 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics graphene, eletrical, characterisation, standardization EMPIR 2016: Pre-Co-Normative INRIM, Torino, Italy 30 978-88-945324-0-1 NA https://arxiv.org/abs/2007.13348 A.Fabricius A.Catanzaro A.Cultrera miscellaneous SilvaALSCRMBS_2 1486 2020 4 18 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Calibration; Mobile optical measurement system EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3756658 NA M.A.Silva M.C.Almeida D.Loureiro J.A.Sousa M.G.Cox A.S.Ribeiro L.L.Martins R.Brito A.C.Soares article ObsilSiiLP2020 1832 Optics Express 2020 4 16 28 9 17FUN07: CC4C: Coulomb Crystals for Clocks 13091 Optical frequency analysis, dark state of a single trapped ion EMPIR 2017: Fundamental The Optical Society 30 1094-4087 10.1364/OE.389411 NA P.Obšil L.Slodička O.Číp M.Čížek A.Lešundák T.M.Pham miscellaneous SilvaALSCRMBS 1484 2020 4 1 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Measurement model; SBI – Single Burning Item; Reaction to fire test EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3736602 NA M.A.Silva M.C.Almeida D.Loureiro J.A.Sousa M.G.Cox A.S.Ribeiro L.L.Martins R.Brito A.C.Soares article ChretienLSS2020 1756 Mathematics 2020 4 8 4 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 493 hyper-parameter selection, image reconstruction, limited data reconstruction, total variation regularisation, cone-beam computed tomography https://www.mdpi.com/2227-7390/8/4/493 EMPIR 2017: Industry MDPI AG 30 2227-7390 10.3390/math8040493 NA S.Chretien M.Lohvithee W.Sun M.Soleimani miscellaneous RibeiroCSM 1485 2020 3 30 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Thermal comfort; Implicit model formulation; Monte Carlo model EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3733403 NA A.S.Ribeiro M.G.Cox J.A.Sousa L.L.Martins article GalloDCLL2020 2308 ACTA IMEKO 2020 3 30 9 1 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 40 power system measurement, power system diagnostics, stand-alone merging unit, time synchronisation, analogue-to-digital converter EMPIR 2017: Industry IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i1.753 NA D.Gallo A.Delle Femine G.Cipolletta C.Landi M.Luiso miscellaneous SousaPvCFDBKE 1467 2020 3 25 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Bayesian statistics, measurement uncertainty, prior knowledge, calibration EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3726908 NA J.A.Sousa O.Pellegrino A.M.H.van der Veen M.G.Cox N.Fischer S.Demeyer A.Bošnjakovic V.Karahodžić C.Elster article WiartCAL2020 1529 International Journal of Environmental Research and Public Health 2020 3 22 17 6 16NRM07: Vector SAR: SAR measurement using vector probes 2111 specific absorption rate; fast SARmeasurement; field reconstruction; plane-wave expansion;traditional SAR measurement; measurement discrepancy; uncertainty analysis EMPIR 2016: Pre-Co-Normative MDPI AG 30 1660-4601 10.3390/ijerph17062111 NA Z.Liu D.Allal M.Cox J.Wiart miscellaneous vanderVeenHCPE 1459 2020 3 22 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Conformity assessment; Multicomponent material; Measurement uncertainty; Risk of false decision; Correlated test results EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3723507 NA A.M.Hvan der Veen PHarris M.GCox FPennecchi S.L.REllison article GaudinoCASCPC2020 1537 Optics Express 2020 3 10 28 6 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 8494 Frequency dissemination, optical fiber, polarization EMPIR 2018: SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.378602 NA C.Clivati P.Savio S.Abrate V.Curri R.Gaudino M.Pizzocaro D.Calonico article ChaeKP2004 1451 Applied Physics Letters 2020 3 4 116 - 18SIB07: GIQS: Graphene impedance quantum standard 093102 Quantum Hall effect, quantum Hall array resistance standard, graphene EMPIR 2018: SI Broader Scope American Institute of Physics 30 0003-6951 (print) 1077-3118 (w 10.1063/1.5139965 NA J.Park W.-S.Kim D.-H.Chae article LohHCF2020 1556 2020 14th European Conference on Antennas and Propagation (EuCAP) 2020 3 18SIP02: 5GRFEX: Metrology for RF exposure from massive MIMO 5G base station: Impact on 5G network deployment 1-5 radio frequency, electromagnetic fieldexposure, software defined radio, massive mimo, testbed https://arxiv.org/abs/2008.04345 EMPIR 2018: Support for Impact IEEE 30 10.23919/EuCAP48036.2020.9135291 NA T. H.Loh F.Heliot D.Cheadle T.Fielder article SalmiCVWVYKHS2020 1354 Journal of Vacuum Science & Technology A 2020 3 38 2 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 022401 Spatial Atomic Layer Deposition, aluminum oxide, surface passivation, light soaking, damp heat EMPIR 2016: Energy American Vacuum Society 30 0734-2101, 1520-8559 10.1116/1.5133896 NA I.T.S.Heikkinen G. Koutsourakis S.Virtanen M.Yli-Koski S.Wood V.Vähänissi E.Salmi F.A.Castro H.Savin article RabagoFCFFQPCQS2020 2029 International Journal of Environmental Research and Public Health 2020 3 17 5 16ENV10: MetroRADON: Metrology for radon monitoring 1780 radon, proficiency test, quality assurance, metrology, interlaboratory comparison https://www.mdpi.com/1660-4601/17/5/1780 EMPIR 2016: Environment MDPI AG 30 1660-4601 10.3390/ijerph17051780 NA D.Rabago I.Fuente S.Celaya A.Fernandez E.Fernandez J.Quindos R.Pol G.Cinelli L.Quindos C.Sainz article LucasTECSZ2020 1449 APL Materials 2020 3 8 3 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 031109 multiferroic, X-ray absorption spectroscopy, magnetic measurements https://aip.scitation.org/doi/10.1063/5.0002863 EMPIR 2016: Energy AIP Publishing 30 2166-532X 10.1063/5.0002863 NA M.Staruch H.ElBidweihy M.G.Cain P.Thompson C.A.Lucas P.Finkel article TangSLKNBMSCKMKBNMKKSSDPvM2020 1473 Nature Reviews Cardiology 2020 2 24 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion cardiac imaging, myocardial ischaemia EMPIR 2015: Health Springer Science and Business Media LLC 30 1759-5002, 1759-5010 10.1038/s41569-020-0341-8 NA M.Dewey M.Siebes M.Kachelrieß K.F.Kofoed P.Maurovich-Horvat K.Nikolaou W.Bai A.Kofler R.Manka S.Kozerke A.Chiribiri T.Schaeffter F.Michallek F.Bengel S.Nekolla P.Knaapen M.Lubberink R.Senior M-X.Tang J.J.Piek T.van de Hoef J.Martens L.Schreiber article TxoperenaRLFERAPCCCCHMZK2020 1505 Scientific Reports 2020 2 21 10 1 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics 3223 Characterization and analytical techniques,Electronic properties and devices,Imaging techniques,Materials science,Nanoscience and technology,Physics,Graphene https://www.nature.com/articles/s41598-020-59851-1 EMPIR 2016: Pre-Co-Normative Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-59851-1 NA C.Melios N.Huang L.Callegaro A.Centeno A.Cultrera A.Cordon V.Panchal I.Arnedo A.Redo-Sanchez D.Etayo M.Fernandez A.Lopez S.Rozhko O.Txoperena A.Zurutuza O.Kazakova proceedings ZaniniSSC2020 2609 Proceeding - 10th Conference on Industrial Computed Tomography, Wels, Austria (iCT 2020), www.ict-conference.com/2020 2020 2 17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry X-ray computed tomography, additive manufacturing, lattice structures, dimensional metrology, uncertainty https://www.ndt.net/search/docs.php3?id=25084 EMPIR 2017: Pre-Co-Normative Wels, Austria 10th Conference on Industrial Computed Tomography 2020 04-02-2020 to 07-02-2020 30 NA https://zenodo.org/record/4746036 F.Zanini M.Sorgato E.Savio S.Carmignato article CaraFFDTGSH2020 1568 Nanomaterials 2020 2 10 2 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 280 directed self-assembly; nanospheres lithography; colloidal nanospheres; directlaser-writing https://www.researchgate.net/publication/339105418_Directed_Self-Assembly_of_Polystyrene_Nanospheres_by_Direct_Laser-Writing_Lithography/link/5e3d9bbd458515072d88c1ab/download EMPIR 2016: Environment MDPI AG

Postfach Basel CH-4005 Switzerland

30 2079-4991 10.3390/nano10020280 NA EleonoraCara FedericoFerrarese Lupi MatteoFretto NatasciaDe Leo MauroTortello RenatoGonnelli KatiaSparnacci GarryHensey proceedings ObatonKRMBACD2020 1759 Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020 2020 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 152 X-ray computed tomography (XCT), dimensional metrology, reference standards, additive manufacturing https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf EMPIR 2017: Industry Wels, Austria 10th Conference on Industrial Computed Tomography (iCT 2020) 04-02-2020 to 07-02-2020 30 NA https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf A.Obaton C. Klingaa C.Rivet K.Mohaghegh S.Baier J.Andreasen L.Carli L.De Chiffre proceedings IurlaroSMIBMCFMIPD2020 2019 EUROSAFE 2020 2 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident dose rate, measuring instruments, non-governmental networks, preparedness http://www.etson.eu/sites/default/files/eurosafes/2019/EUROSAFE2019_Proceedings.pdf EMPIR 2016: Environment Cologne EUROSAFE 2019 04-11-2019 to 05-11-2019 30 978-3-947685-51-6 NA 978-3-947685-51-6 G.Iurlaro L.Sperandio V.Morosh M.ŽIivanovic S.Bell F.Mariotti L.Campani P.Ferrari B.Morelli S.Ioannidis G.Pantelić M.De Cort article SchwarzSSBKLMCS2020 1540 Nature 2020 1 29 578 7793 17FUN07: CC4C: Coulomb Crystals for Clocks 60-65 spectroscopy highly charged ions atomic clocks3 https://arxiv.org/abs/2010.15984 EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 0028-0836, 1476-4687 10.1038/s41586-020-1959-8 NA M.Schwarz L.Schmöger L.J.Spieß E.Benkler S.A.King T.Leopold P.Micke J.R.Crespo López-Urrutia P.O.Schmidt article LeviBTCLL2020 1397 Physical Review Applied 2020 1 13 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 014013 Optical Lattice Clock,cold atomic sources EMPIR 2017: Fundamental American Physical Society (APS)

1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States

30 2331-7019 10.1103/PhysRevApplied.13.014013 NA https://arxiv.org/abs/1909.05810 M.Barbiero M.G.Tarallo D.Calonico F.Levi G.Lamporesi G.Ferrari article D039ArienzoPDCFMIUS2020 1548 Physica Medica 2020 1 69 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy 127-133 Absorbed dose measurements from a 90Y EMPIR 2015: Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2019.11.010 NA M.D'Arienzo M.Pimpinella V.De Coste M.Capogni P.Ferrari F.Mariotti G.Iaccarino S.Ungania L.Strigari article SantosCMGPAMI2020 1338 X-Ray Spectrometry 2020 1 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters X-ray K-shell transition yields EMPIR 2017: Fundamental Wiley 30 0049-8246, 1097-4539 10.1002/xrs.3123 NA L.Martins P.Amaro S.Pessanha M.Guerra J.Machado M. L.Carvalho J. P.Santos P.Indelicato article ChristensenJHTS2020 1498 Physical Review A 2020 1 101 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems superradiant laser, optical clock, ultra narrow laser EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.101.013819 NA S.A.Schäffer M.Tang M.R.Henriksen A.A.Jørgensen B.T.R.Christensen article CavuotoLGS2020 1591 The Journal of Chemical Thermodynamics 2020 1 142 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 106007 Speed of soundMethaneLngNatural gasCryogenic conditions EnG EMPIR 2016: Energy Elsevier BV 30 0021-9614 10.1016/j.jct.2019.106007 NA G.Cavuoto S.Lago P.A.Giuliano Albo D.Serazio article CaraMSGRCDHKBMZCLBF2020 1829 Journal of Materials Chemistry C 2020 8 46 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 16513-16519 Raman spectroscopy (SERS) EMPIR 2016: Environment Royal Society of Chemistry (RSC) 30 2050-7526, 2050-7534 10.1039/D0TC04364H NA E.Cara L.Mandrile A.Sacco A.M.Giovannozzi A.M.Rossi F.Celegato N.De Leo P.Honicke Y.Kayser B.Beckhoff D.Marchi A.Zoccante M.Cossi M.Laus L.Boarino F.Ferrarese Lupi article ZilbertiKLGCBAZ2020 1334 IEEE Transactions on Electromagnetic Compatibility 2020 ea ea 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 1-12 Basic restrictions, electric vehicles, electro-magnetic fields, inductive charging, numerical dosimetry, safety EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9375, 1558-187X 10.1109/TEMC.2019.2954111 NA A.Arduino O.Bottauscio M.Chiampi L.Giaccone I.Liorni N.Kuster L.Zilberti M.Zucca proceedings GiordanoSLLDC2020 1963 IMEKO Proceedings 2020 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems DC power quality, DC railway system, electric arcs https://www.imeko.org/publications/tc4-2020/IMEKO-TC4-2020-22.pdf EMPIR 2016: Energy Palermo, Italy International Measurement Confederation 2020 14-09-2020 to 16-09-2020 30 NA https://zenodo.org/record/4589149 D.Giordano D.Signorino C.Landi M.Luiso A.Delle Femine G.Crotti article LinYCWGCLXSHCFCTYC2020 1760 Physical Review Letters 2020 124 21 17FUN08: TOPS: Metrology for topological spin structures 217202 DMI, spin waves https://arxiv.org/abs/2006.14268 EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007 10.1103/PhysRevLett.124.217202 NA W.Lin B.Yang A.P.Chen X.Wu R.Guo S.Chen L.Liu Q.Xie X.Shu Y.Hui G.M.Chow Y. Feng G.Carlotti S.Tacchi H.Yang J.Chen article OchoaBTC2020 1870 Energy & Environmental Science 2020 13 7 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 2047-2055 CIGS, metrology EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 1754-5692, 1754-5706 10.1039/D0EE00834F NA M.Ochoa S.Buecheler A.N.Tiwari R.Carron article HertwigNOYFGTC2020 2016 EPJ Photovoltaics 2020 11 12 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 12 Thin film solar cells Cu(In,Ga)Se2 bufferZnMgO ALDsurface treatment EMPIR 2016: Energy EDP Sciences 30 2105-0716 10.1051/epjpv/2020010 NA R.Hertwig S.Nishiwaki M.Ochoa S-C.Yang T.Feurer E.Gilshtein A.N.Tiwari R.Carron article PetriniMBTTCDG2020 1713 Advanced Quantum Technologies 2020 17FUN06: SIQUST: Single-photon sources as new quantum standards 2000066 color centers, diamond, biosensing EMPIR 2017: Fundamental Wiley 30 10.1002/qute.202000066 NA G.Petrini E.Moreva E.Bernardi P.Traina G.Tomagra V.Carabelli I.P.Degiovanni M.Genovese article GoenagaInfantePRdBAC2020 1417 Journal of Analytical Atomic Spectrometry 2020 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements nanoparticles, nanoparticle number concentration, spICP-MS, inorganic nanoparticles, Au nanoparticles, TiO2 nanoparticles https://pubs.rsc.org/en/content/articlepdf/2020/ja/c9ja00415g EMPIR 2017: Pre-Co-Normative Royal Society of Chemistry (RSC) 30 10.1039/c9ja00415g NA S.Cuello-Nuñez I.Abad-Álvaro D.Bartczak M.E. del Castillo Busto D.A.Ramsay F.Pellegrino H.Goenaga-Infante article CuelloNunezABdRPG2020 1848 Journal of Analytical Atomic Spectrometry 2020 35 9 18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration 1832-1839 number concentration, spICP-MS, nanoparticle EMPIR 2018: Support for Impact Royal Society of Chemistry (RSC) 30 0267-9477, 1364-5544 10.1039/C9JA00415G NA S.Cuello-Nuñez I.Abad-Álvaro D.Bartczak M.E.Del Castillo Busto D.A.Ramsay F.Pellegrino H.Goenaga-Infante article TummonLKCCCAZSV2020 1472 Atmospheric Measurement Techniques 2020 13 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 1539–1550 pollen monitoring, digital holography, https://www.atmos-meas-tech.net/13/1539/2020/ EMPIR 2016: Environment Copernicus Publications 30 10.5194/amt-13-1539-2020 NA E.Sauvageat Y.Zeder K.Auderset B.Calpini B.Clot B.Crouzy T.Konzelmann G. Lieberherr F.Tummon K.Vasilatou article BinkowskiBCHZB2020 1557 Physical Review B 2020 102 3 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 035432 near field to far field transformation, numerical simulation https://arxiv.org/abs/2003.11305 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.102.035432 NA F.Binkowski F.Betz R.Colom M.Hammerschmidt L.Zschiedrich S.Burger article HodoroabaCTMOMPM2020 1717 Microscopy and Microanalysis 2020 26 S2 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements 260 nanoparticles, 3D, Transmission Kikuchi Diffraction (TKD), TiO2, electron microscopy, size, shape EMPIR 2017: Pre-Co-Normative Cambridge University Press

Cambridge

30 1435-8115 10.1017/S1431927620013999 NA V.-D.Hodoroaba G.Cios T.Tokarski U.Mansfeld E.Ortel J.Mielke F.Pellegrino V.Maurino article FidelusC2020 1788 ACTA IMEKO 2020 9 5 18SIB08: ComTraForce: Comprehensive traceability for force metrology services creep tests, compressive and tensile forces, HBM Z4A force transducer, Force Standard Machine (FSM) https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09%20%282020%29-05-30 EMPIR 2018: SI Broader Scope 30 NA http://dx.doi.org/10.21014/acta_imeko.v9i5.956 J.Fidelus K.Cybul article CalinALSSR2019 1770 Romanian Reports in Physics 2019 12 20 71 4 16ENV10: MetroRADON: Metrology for radon monitoring 906 Radon measurement, 222Rn standard system, Radon chamber, Indoor and outdoor radon, education and training, ANNETTE, EU project EMPIR 2016: Environment Editura Academiei Romane 30 NA http://www.rrp.infim.ro/2019/AN71906.pdf M.R.Calin A.Antohe A.Luca G.Stanescu M.Sahagia I.Radulescu article BrunoGCBPL2019 1400 Optics Express 2019 12 18 27 26 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 38463 Parametric Down-conversion, Photon correlation, photon entnglement EMPIR 2017: Fundamental The Optical Society 30 1094-4087 10.1364/OE.382474 NA V.Prakash Lorena C.Bianchet M.T.Cuairan P.Gomez N.Bruno M.W.Mitchell article ZilbertiCBBA2019 1328 Physics in Medicine & Biology 2019 12 13 64 24 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 245006 dosimetry, magnetic resonance imaging (MRI), MR safety, gradient coils, medical implants, prostheses, numerical simulation EMPIR 2017: Industry IOP Publishing 30 1361-6560 10.1088/1361-6560/ab5428 NA A.Arduino O.Bottauscio R.Brühl M.Chiampi L.Zilberti article PottieAQCLRWKKG2019 1393 New Journal of Physics 2019 12 13 21 . 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 123017 optical frequency dissemination https://iopscience.iop.org/article/10.1088/1367-2630/ab5d95 EMPIR 2018: SI Broader Scope IOPscience 30 1367-2630 10.1088/1367-2630/ab5d95 NA S.Koke A.Kuhl T.Waterholter S.M.F.Raupach O.Lopez E.Cantin N.Quintin A.Amy-Klein P.-E.Pottie G.Grosche article KlenovskyCSRCLHR2019 1360 Physical Review B 2019 12 13 100 23 17FUN06: SIQUST: Single-photon sources as new quantum standards GaAs, quantum dot https://journals.aps.org/prb/pdf/10.1103/PhysRevB.100.235425 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.100.235425 NA D.Huber B.U.Lehner D.Csontosová M.Reindl S.Schuler S.F.Covre Da Silva P.Klenovský A.Rastelli article JeneiPZTRTCSMD2019 1545 Physical Review Research 2019 12 10 1 3 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere Waiting time distributions in a two-level fluctuator coupled to a superconducting charge detector EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2643-1564 10.1103/physrevresearch.1.033163 NA M.Jenei E.Potanina R.Zhao K.Y.Tan A.Rossi T.Tanttu K.W.Chan V.Sevriuk M.Möttönen A.Dzurak article GomezFGLDBMFMMGARPABCDH2019 1260 Journal of Power Sources 2019 12 444 15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications 227170 Fuel cell electrical vehicles, ISO14687, Gas analysis, Hydrogen production, Hydrogen quality https://www.sciencedirect.com/science/article/pii/S0378775319311632 EMPIR 2015: Pre-Co-Normative Elsevier BV 30 0378-7753 10.1016/j.jpowsour.2019.227170 NA T.Bacquart K.Arrhenius S.Persijn A.Rojo F.Auprêtre B.Gozlan N.Moore A.Morris A.Fischer A.Murugan S.Bartlett G.Doucet F.Laridant E.Gernot T. E.Fernández C.Gómez M.Carré G.De Reals F.Haloua article BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019 2340 International Journal of Environmental Research and Public Health 2019 11 21 16ENV10: MetroRADON: Metrology for radon monitoring radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability EMPIR 2016: Environment 30 10.3390/ijerph182212150 NA T.R.Beck A.Antohe F.Cardellini A.Cucoş E.Fialova C.Grossi K.Hening J.Jensen D.Kastratović M.Krivošík P.Lobner A.Luca F.J.Maringer N.Michielsen P.P.S.Otahal L.Quindos D.Rabago C.Sainz L.Szücs T.Teodorescu C.Tolinsson C.L.Tugulan T.Turtiainen A.Vargas J.Vosahlik G.Vukoslavovic H.Wiedner K.Wołoszczuk article SchneiderHHCFKRSTR2019 1362 Optics Express 2019 11 18 27 24 17FUN06: SIQUST: Single-photon sources as new quantum standards 35290 single quantum emitter, GaAs and In(Ga)As quantum dots https://www.osapublishing.org/DirectPDFAccess/0872F4C8-F64C-1DD3-BF83A9359A9A78C7_423274/oe-27-24-35290.pdf?da=1&id=423274&seq=0&mobile=no EMPIR 2017: Fundamental The Optical Society 30 1094-4087 10.1364/OE.27.035290 NA C.Schimpf M.Reindl P.Klenovský T.Fromherz S.F.Covre Da Silva J.Hofer C.Schneider S.Höfling R.Trotta A.Rastelli article KlauiJPDGVCC2019 1308 Communications Physics 2019 11 15 2 1 17FUN08: TOPS: Metrology for topological spin structures 145 Skyrmion, MFM https://www.nature.com/articles/s42005-019-0242-5#article-info EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2399-3650 10.1038/s42005-019-0242-5 NA A.Casiraghi H.Corte-León M.Vafaee F.Garcia-Sanchez G.Durin M.Pasquale G.Jakob M.Kläui article KlauiJPDGVCC20190 1308 Communications Physics 2019 11 15 2 1 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 145 Skyrmion, MFM https://www.nature.com/articles/s42005-019-0242-5#article-info EMPIR 2015: SI Broader Scope Springer Science and Business Media LLC 30 2399-3650 10.1038/s42005-019-0242-5 NA A.Casiraghi H.Corte-León M.Vafaee F.Garcia-Sanchez G.Durin M.Pasquale G.Jakob M.Kläui article CidadePNGFF2019 1300 Journal of Physics: Conference Series 2019 11 1379 Joint IMEK 17RPT02: rhoLiq: Establishing traceability for liquid density measurements 012020 density, harmonic oscillator, viscoelasticity, damping https://iopscience.iop.org/article/10.1088/1742-6596/1379/1/012020/pdf EMPIR 2017: Research Potential IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1379/1/012020 NA A.Furtado A.Furtado J.Gavina A.Napoleão J.Pereira M.T.Cidade article ProdromakisKKPCK2019 1479 Materials 2019 11 12 23 15SIB09: 3DNano: Traceable three-dimensional nanometrology 3972 Resistive Random Access Memory (ReRAM); Line Edge Roughness (LER); variability; uniformity; modeling; lithography EMPIR 2015: SI Broader Scope MDPI AG 30 1996-1944 10.3390/ma12233972 NA V.Constantoudis G.Papavieros P.Karakolis A.Khiat T.Prodromakis P.Dimitrakis article SantosCMGPAM2019 1337 X-Ray Spectrometry 2019 10 29 49 1 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters 192-199 Dirac–Fock method, Zn K‐shell EMPIR 2017: Fundamental Wiley 30 0049-8246, 1097-4539 10.1002/xrs.3089 NA L.Martins P.Amaro S.Pessanha M.Guerra J.Machado M. L.Carvalho J. P.Santos article CalonicoLRBBP2019 1443 Metrologia 2019 10 24 18SIB05: ROCIT: Robust Optical Clocks for International Timescales optical lattice clock, SI second, frequency metrology EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab50e8 NA M.Pizzocaro F.Bregolin P.Barbieri .Rauf F.Levi D.Calonico article KuckLDMCTLT2019_2 1444 Advanced Quantum Technologies 2019 10 22 3 2 17FUN06: SIQUST: Single-photon sources as new quantum standards 1900083 quantum radiometrysingle moleculessingle‐photon detectorssingle‐photon sources EMPIR 2017: Fundamental Wiley 30 2511-9044, 2511-9044 10.1002/qute.201900083 NA P.Lombardi M.Trapuzzano M.Colautti G.Margheri I.P.Degiovanni M.López S.Kück C.Toninelli article LombardiTCMDLKT2019 1807 Advanced Quantum Technologies 2019 10 22 3 2 17FUN06: SIQUST: Single-photon sources as new quantum standards 1900083 quantum radiometry single molecules single‐photon detectors single‐photon sources EMPIR 2017: Fundamental Wiley 30 2511-9044, 2511-9044 10.1002/qute.201900083 NA P.Lombardi M.Trapuzzano M.Colautti G.Margheri I.P.Degiovanni M.López S.Kück C.Toninelli article MarcqMHGFCBBTBMWW2019 1248 Remote Sensing 2019 10 16 11 2401 16ENV03: MetEOC-3: Further metrology for earth observation and climate 20 RadCalNet, CEOS, radiometric calibration, SI-traceable, surface reflectance, network, instrument https://doi.org/10.3390/rs11202401  EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs11202401 NA M.Bouvet K.Thome B.Berthelot A.Bialek J.Czapla-Myers N.Fox P.Goryl P.Henry L.Ma S.Marcq A.Meygret B.Wenny E.Woolliams article GiordanoLGCDL2019 1335 IEEE Transactions on Instrumentation and Measurement 2019 10 68 10 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems 3850-3860 Calibration, current transducer, dc railway system, dynamic conditions, energy measurement, power measurement, stationary conditions, voltage transducer. EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2019.2912232 NA G.Crotti A.Delle Femine D.Gallo D.Giordano C.Landi M.Luiso proceedings FortuneCRSPA2019 1198 Proceedings of CIM 2019 2019 9 24 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients Pulsed X-ray tube, KVp meters, Metrology, Dose. https://www.cim2019.com EMPIR 2015: Pre-Co-Normative Paris, France The 19st Congrès Internationla de Métrologie 24-09-2019 to 26-09-2019 30 10.1051/metrology/201902002 NA 10.5281/zenodo.3335340 M.Agazar D.Perrillat H.Saadeddine C.Robert L.Casteignau D.Fortune proceedings CucciaSBLvAMCVSBPCT2019 1781 19th International Congress of Metrology (CIM2019) 2019 9 23 16ENG05: Biomethane: Metrology for biomethane biomethane, terpenes, amines, ammonia EnG EMPIR 2016: Energy EDP Sciences Paris 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201906001 NA L.Cuccia B.Sanz D.Ballestas Castro J.Li A.M.H.van der Veen E.Amico di Meane S.Moreno L.P.Culleton D.Vorin C.Senné F.Bougueroua L.Pyrée Y.Courtois C.Tastard article SanmamedSDGC2019 2151 Proceedings 23rd IMEKO TC 4 International Symposium 2019 9 20 17RPT03: DIG-AC: A digital traceability chain for AC voltage and current Analog to Digital Converter, temperature coefficient, aperture time, digital sampling, digitizer EMPIR 2017: Research Potential 30 NA https://www.imeko.org/publications/tc4-2019/IMEKO-TC4-2019-042.pdf Y.A.Sanmamed J.R.Salinas J.Diaz de Aguilar F.García-Lagos R.Caballero article GomezMMCPM2019 2735 Physical Review A 2019 9 10 100 3 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems BEC, Interferometry, interhyperfine scattering EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9926, 2469-9934 NA https://arxiv.org/abs/1904.07617 P.Gomez C.Mazzinghi F.Martin S.Coop S.Palacios M.W.Mitchell proceedings ChiampiBAZ2019 1271 2019 International Conference on Electromagnetics in Advanced Applications (ICEAA) 2019 9 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers magnetic resonance imaging (MRI), phaseless contrast source inversion (CSI), electric properties tomography (EPT), uncertainty propagation, Monte Carlo method https://arxiv.org/abs/1911.02809 EMPIR 2018: Health IEEE Granada 2019 International Conference on Electromagnetics in Advanced Applications 09-09-2019 to 13-09-2019 30 10.1109/ICEAA.2019.8879147 NA AlessandroArduino O.Bottauscio M.Chiampi L.Zilberti proceedings LuisoLGFSGCBD2019 1946 2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS) 2019 9 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Power and Energy measurement, Railway system, Energy saving, Reversible Substation, DC Power Quality https://zenodo.org/record/4598462 EMPIR 2016: Energy IEEE Dubrovnik, Croatia 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 25-05-2020 to 28-05-2020 30 978-1-7281-0075-3 2475-2304 10.1109/AMPS.2019.8897794 NA M.Luiso C.Landi D.Gallo A.D.Femine D.Signorino D.Giordano G.Crotti A.Biancucci L.Donadio proceedings SeferiCBMS2019 1964 2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS) 2019 9 1 1 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems Railway transportation power systems, power quality, power system transients, voltage interruption https://strathprints.strath.ac.uk/70058/ EMPIR 2016: Energy IEEE Aachen, Germany International Workshop on Applied Measurements for Power Systems (AMPS) 25-09-2019 to 27-09-2012 30 978-1-7281-0075-3 2475-2304g 10.1109/AMPS.2019.8897765 NA Y.Seferi P.Clarkson S.M.Blair A.Mariscotti B.G. Stewart proceedings LuisoRBCM2019 1295 2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS) 2019 9 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 64-69 wideband, current transformers, calibration, measurement uncertainty, instrument transformers, power quality SEG https://doi.org/10.1109/AMPS.2019.8897759 EMPIR 2017: Industry IEEE Aachen, Germany 2019 IEEE 10th International Workshop on Applied Measurements for Power Systems 25-09-2019 to 27-09-2019 30 978-1-7281-0075-3, 978-1-7281- 2475-2304, 2473-1315 NA https://doi.org/10.1109/AMPS.2019.8897759 M.Luiso P.Rather H.Badura Y.Chen E.Mohns proceedings MarrowsKGDCCBSK2019 1428 Proceedings 2019 9 26 1 17FUN08: TOPS: Metrology for topological spin structures 41 Dzyaloshinskii-Moriya interaction EMPIR 2017: Fundamental MDPI AG Ferrara XXXVII International Symposium on Dynamical Properties of Solids 08-09-2019 to 12-09-2019 30 2504-3900 10.3390/proceedings2019026041 NA C.Back G.Carlotti A.Casiraghi G.Durin F.Garcia-Sanchez M.Kuepferling C.Marrows G.Soares S.Tacchi article KellmanMRSBXORNIRMGNPC2019 1474 European Journal of Hybrid Imaging 2019 9 3 1 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion myocardial perfusion, hybrid PET-MR EMPIR 2015: Health Springer Science and Business Media LLC 30 2510-3636 10.1186/s41824-019-0062-6 NA M.S.Nazir S-M.Gould X.Milidonis E.Reyes T.F.Ismail R.Neji S.Roujol J.O’Doherty H.Xue S.F.Barrington T.Schaeffter R.Razavi P.Marsden P.Kellman S.Plein A.Chiribiri proceedings LandiGDCL2019 1345 IMEKO TC10 2019 Conference Proceedings 2019 9 1 1 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 107-112 Power System Measurement,Power System Diagnostics,Stand Alone Merging Unit,Time Synchronization,Analog To Digital Converter SEG EMPIR 2017: Industry IMEKO Berlin 16th IMEKO TC10 Conference “Testing, Diagnostics & Inspection as a comprehensive value chain for Quality & Safety” 03-09-2019 to 04-09-2019 30 978-92-990084-1-6 978-92-990084-1-6 NA https://zenodo.org/record/3600469 C.Landi D.Gallo A.Delle Femine G.Cipolletta M.Luiso article Carlotti2019 1352 Applied Physics Reviews 2019 9 6 3 17FUN08: TOPS: Metrology for topological spin structures 031304 spin waves, confined modes, patterned magnetic media, magnonic crystals https://arxiv.org/abs/1908.11098v1 EMPIR 2017: Fundamental AIP Publishing 30 1931-9401 10.1063/1.5110434 NA G.Carlotti proceedings CastroVWKHS2019 1202 AIP Conference Proceedings 2019 8 27 2147 1 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 050003 Aluminium oxide, surface passivation, damp heat exposure, atomic layer deposition, degradation https://aip.scitation.org/doi/pdf/10.1063/1.5123852?class=pdf EMPIR 2016: Energy AIP Publishing Leuven, Belgium SiliconPV 2019, THE 9TH INTERNATIONAL CONFERENCE ON CRYSTALLINE SILICON PHOTOVOLTAICS 08-04-2019 to 10-04-2019 30 978-0-7354-1892-9 1551-7616 10.1063/1.5123852 NA I.T.S.Heikkinen G. Koutsourakis S.Wood V.Vähänissi F.A.Castro H.Savin inbook RuttingerPGCPSKBJSBSWWS2019 1193 2019 8 23 Advances i 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 316-326 magnetic nanoparticles, standardisation European research https://arxiv.org/abs/1905.08791 EMPIR 2016: Pre-Co-Normative Springer International Publishing

Cham

Current Trends in Biomedical Engineering and Bioimages Analysis. PCBEE 2019. 30 978-3-030-29884-5 10.1007/978-3-030-29885-2_29 NA PeterSchier CraigBarton SimoSpassov ChristerJohansson DanielBaumgarten OlgaKazakova PaulSouthern QuentinPankhurst MarcoCoisson CordulaGrüttner AlexPrice RomanRüttinger FrankWiekhorst JamesWells UweSteinhoff proceedings VentreMDBCFPPRSTBASSGHBZFDKL2019 1200 2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE) 2019 8 19 Electrical 2019 AEIT 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 6 pages Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety SEG http://arxiv.org/abs/1908.11108 EMPIR 2016: Energy IEEE Turin (Italy) 2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE) 02-07-2019 to 04-07-2019 30 978-8-8872-3743-6 0018-9219 10.23919/EETA.2019.8804498 NA M.Zucca O.Bottauscio S.Harmon R.Guilizzoni F.Schilling M.Schmidt P.Ankarson T.Bergsten K.Tammi P.Sainio J.B.Romero E.L.Puyal L.Pichon F.Freschi V.Cirimele P.Bauer J.Dong A.Maffucci S.Ventre N.Femia G.Di Capua N.Kuster I.Liorni article ColemanERGS2019 1191 Journal of the Air & Waste Management Association 2019 8 69 9 15NRM01: Sulf-Norm: Metrology for sampling and conditioning SO2 emissions from stacks 1070-1078 Uncertainty requirements, European Union’s Industrial Emissions Directive, monitoring sulfur dioxide emissions https://doi.org/10.1080/10962247.2019.1604449 EMPIR 2015: Pre-Co-Normative Informa UK Limited 30 1096-2247, 2162-2906 10.1080/10962247.2019.1604449 NA M.D.Coleman M.Ellison R.A.Robinson T.D.Gardiner T.O.M.Smith article CinelliNViePG2019 1216 Journal of Environmental Radioactivity 2019 8 204 16ENV10: MetroRADON: Metrology for radon monitoring 163-174 metroRADON, indoor radon surveys, representativeness EMPIR 2016: Environment Elsevier BV 30 0265-931X 10.1016/j.jenvrad.2019.04.010 NA G.Pantelić I.Čeliković M.Živanović I.Vukanac J.K.Nikolić G.Cinelli V.Gruber article ChouhaniFiPBJVH2019 2041 Sensors 2019 8 19 15 16ENV01: MercOx: Metrology for oxidised mercury 3432 Nanostructure Knitting based Passive Sampler , Hg2+, Water EMPIR 2016: Environment MDPI AG 30 1424-8220 10.3390/s19153432 NA R.S.Chouhan G.Žitko V.Fajon I.Živković M.Pavlin S.Berisha I.Jerman A.Vesel M.Horvat article BausiKBC2019 1736 Measurement Science and Technology 2019 7 30 30 9 16ENG02: PV-Enerate: Advanced PV energy rating 095902 High-speed digital light source photocurrent mapping system EMPIR 2016: Energy IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab1f40 NA F.Bausi G. Koutsourakis J.C.Blakesley F.A.Castro article GennserCPBBMCKCRMBJDH2019 1311 Nature Communications 2019 7 29 10 1 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements Electronic wavefunction, Quantum tomography EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-019-11369-5 NA R.Bisognin A.Marguerite B.Roussel M.Kumar C.Cabart C.Chapdelaine A.Mohammad-Djafari J.-M.Berroir E.Bocquillon B.Plaçais A.Cavanna U.Gennser Y.Jin P.Degiovanni G.Fève article OrtolanoARCETCZSCC2019 1227 Scientific Reports 2019 7 23 9 1 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics graphene, electrical resistance tomography, conductivity, terahertz spectroscopy https://doi.org/10.1038/s41598-019-46713-8 EMPIR 2016: Pre-Co-Normative Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-019-46713-8 NA A.Cultrera D.Serazio A.Zurutuza A.Centeno O.Txoperena D.Etayo A.Cordon A.Redo-Sanchez I.Arnedo M.Ortolano L.Callegaro article SOCHOROVARLLKFDCCBBT2019 1285 Applied Radiation and Isotopes 2019 7 20 153 November 2 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy 1-11 Ho166, Activity standardization, gamma-spectrometry, Half-life measurements, Molecular radiotherapy, MRTDosimetry EMPIR 2015: Health Elsevier 30 10.1016/j.apradiso.2019.108826 NA C.Bobin J.BOUCHARD V.CHISTE S.COLLINS P.Dryák A.FENWICK J.Keightley M.C.Lépy V.Lourenco A.Robinson J.Sochorová C.THIAM article ShardCHS2019 1182 Surface and Interface Analysis 2019 7 15 15SIP02: ISOChemDepth: An International Standard for Reliable Chemical Depth Profiling of Organic Materials ISO, standard, SIMS, sputtering, yield volumes https://doi.org/10.1002/sia.6686 EMPIR 2015: Support for Impact Wiley 30 0142-2421, 1096-9918 10.1002/sia.6686 NA A.G.Shard R.Havelund M.P.Seah C.CLIFFORD article CalonicoLPCB2019 1229 Metrologia 2019 7 56 4 15SIB05: OFTEN: Optical frequency transfer - a European network 045008 optical frequency comb, multibranch Er:fiber comb, spectral purity transfer,ultrastable laser EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab2b0f NA P.Barbieri C.Clivati M.Pizzocaro F.Levi D.Calonico article SchmidtCOHBMLK2019 1340 Review of Scientific Instruments 2019 7 90 7 17FUN07: CC4C: Coulomb Crystals for Clocks 073201 Optical ClocksTrapped Ions EMPIR 2017: Fundamental AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.5100594 NA T.Leopold S. A.King P.Micke A.Bautista-Salvador J. C.Heip C.Ospelkaus J. R.Crespo López-Urrutia P. O.Schmidt article KoutsourakisBC2019 1735 Sensors 2019 6 28 19 13 16ENG02: PV-Enerate: Advanced PV energy rating 2870 non-destructive testing, current mapping, digital micromirror device, compressed sensing EMPIR 2016: Energy MDPI AG 30 1424-8220 10.3390/s19132870 NA G. Koutsourakis J.C.Blakesley F.A.Castro article HibberdMOCORMOPVHC2019 1159 Genome Medicine 2019 6 24 11 1 15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance 41 whole genome sequencing, drug resistance, tuberculosis https://genomemedicine.biomedcentral.com/articles/10.1186/s13073-019-0650-x EMPIR 2015: Health Springer Science and Business Media LLC 30 1756-994X 10.1186/s13073-019-0650-x NA J.E.Phelan D.M.O’Sullivan D.Machado J.Ramos Y.E.A.Oppong S.Campino J.O’Grady R.McNerney M.L.Hibberd M.Viveiros J.F.Huggett T.G.Clark article GandonLegerTCMC2019 1278 PROCEEDINGS OF the 29th Quadrennial Session of the CIE 2019 6 24 16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting Road photometry, Road lighting design, Gonioreflectometer,16NRM02 EMPIR 2016: Pre-Co-Normative International Commission on Illumination, CIE 30 10.25039/x46.2019.PP23 NA V.Muzet M.Colomb M.Toinette P.Gandon-Leger J.P.Christory proceedings MeuretHC2019 1435 SPIE Proceeding, Modeling Aspects in Optical Metrology VII 2019 6 21 11057 - 18SIB03: BxDiff: New quantities for the measurement of appearance 110570N Volume scattering, solid-state lighting, inverse problem, adding-doubling https://lirias.kuleuven.be/2825988?limo=0 EMPIR 2018: SI Broader Scope SPIE Munich, Germany Modeling Aspects in Optical Metrology VII (SPIE Optical Metrology) 24-06-2019 to 26-06-2019 30 9781510627932 0277-786X 10.1117/12.2525791 NA A.Correia P.Hanselaer Y.Meuret article PottieLATMQFCX2019 1117 IEEE Transactions on Instrumentation and Measurement 2019 6 68 6 15SIB05: OFTEN: Optical frequency transfer - a European network 2195-2200 Optical fiber links, phase lock loop, phase measurement, two-way noise compensation, ultrastable frequencytransfer EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2018.2886865 NA D.Xu E.Cantin F.Frank N.Quintin F.Meynadier P.Tuckey A.Amy-Klein O.Lopez P.E.Pottie article CelepPGDH2019 1070 IEEE Transactions on Instrumentation and Measurement 2019 6 68 6 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 1852-1859 Diode detector, Harmonic effect, Microwave measurements, Microwave power, Power sensor https://ieeexplore.ieee.org/document/8700278 EMPIR 2015: Research Potential Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2019.2905885 NA K.Drazil J.Grajciar T.Pavlicek M.Celep M.Hudlicka article BursikovaKC2019 1250 Ultramicroscopy 2019 6 201 15SIB09: 3DNano: Traceable three-dimensional nanometrology 18-27 Scanning Probe Microscopy,Uncertainty,Elastic deformation https://www.sciencedirect.com/science/article/pii/S0304399118302638 EMPIR 2015: SI Broader Scope Elsevier BV 30 0304-3991 10.1016/j.ultramic.2019.03.010 NA P.Klapetek A.Charvátová Campbell V. Buršíková article UrsinTSFC2019 1349 npj Quantum Information 2019 5 24 5 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits quantum metrology, Hong-Ou-Mandel EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2056-6387 10.1038/s41534-019-0161-z NA Y.Chen M.Fink F.Steinlechner J.P.Torres R.Ursin article OliveroBOFCJGSPBFHBER2019 1261 Advanced Quantum Technologies 2019 5 20 2 5-6 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1900006 diamond, ion‐beam irradiation, nitrogen vacancies ,NV magnetometry, quantum sensing, ultrafast laser writing EMPIR 2017: Fundamental Wiley 30 2511-9044, 2511-9044 10.1002/qute.201900006 NA http://hdl.handle.net/2318/1704485 S.M.Eaton J.P.Hadden V.Bharadwaj J.Forneris F.Picollo F.Bosia B.Sotillo A.N.Giakoumaki O.Jedrkiewicz A.Chiappini M.Ferrari R.Osellame P.E.Barclay P.Olivero R.Ramponi article LuisoLGDC2019 1343 IEEE Transactions on Instrumentation and Measurement 2019 5 13 68 10 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 3841 - 3849 Current transformer (CT), frequency coupling matrix (FCM), harmonics, nonlinearity compensation, phase-dependent characteristics, power quality, power system measurements SEG https://ieeexplore.ieee.org/document/8713410 EMPIR 2017: Industry IEEE 30 0018-9456 10.1109/TIM.2019.2905908 NA A.J.Collin A.Delle Femine D.Gallo R.Langella M.Luiso proceedings SignorinoCLFGGL2019 1452 2019 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 2019 5 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems DC railway system, power and energy measurement, voltage and current transducer, stationary and dynamic metrological characterization https://doi.org/10.5281/zenodo.3597387 EMPIR 2016: Energy IEEE

445 Hoes Lane Piscataway NJ 08855-1331 United States

Auckland (New Zeland) 2019 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 20-05-2019 to 23-05-2019 30 10.1109/I2MTC.2019.8826995 NA D.Signorino G.Crotti A.Delle Femine D.Gallo D.Giordano C.Landi M.Luiso article TibertoCCBMF2019 1266 Scientific Reports 2019 4 29 9 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 6591 Magnetic nanostructures, Hysteresis losses, Micromagnetic modelling https://www.nature.com/articles/s41598-019-43197-4 EMPIR 2015: SI Broader Scope Springer Nature 30 2045-2322 (online) 10.1038/s41598-019-43197-4 NA R.Ferrero A.Manzin G.Barrera F.Celegato M.Coïsson P.Tiberto article WarwickRCZ2019 1925 Journal of Analytical Atomic Spectrometry 2019 4 26 34 9 16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities 1810-1821 tandem mass spectrometry, nuclear waste characterisation, rapid measurement, expanded measurement capability https://eprints.soton.ac.uk/430647 EMPIR 2016: Environment Royal Society of Chemistry (RSC) 30 0267-9477, 1364-5544 https://doi.org/10.1039/C8JA00411K NA P. E.Warwick B. C.Russell I. W.Croudace Ž.Zacharauskas manual HaddadiDLHGLHPZWHMSRKPASC2019 1085 2019 4 24 14IND02: PlanarCal: Microwave measurements for planar circuits and components Calibration, on-wafer, S-parameters, traceability, uncertainty budget, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), microwave probes, extreme impedance measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise, vector network analyzer (VNA) https://oar.ptb.de/resources/show/10.7795/530.20190424B EMPIR 2014: Industry Physikalisch-Technische Bundesanstalt (PTB) 30 10.7795/530.20190424B NA K.Haddadi G.Dambrine R.Lozar K.Helmreich G.Gold K.Lomakin W.Heinrich G.N.Phung M.Zeier M.Wollensack J.Hoffmann F.Mubarak X.Shang N.Ridler K.Kuhlmann T.Probst U.Arz M.Spirito R.Clarke article GardiniVPC2019 1165 Biomedical Imaging and Sensing Conference 2019 4 21 11140 2019 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 170-174 Quantitative imaging of efflux pumps in planktonic and biofilm-associated bacteria throughsingle-molecule localization microscopy https://www.spiedigitallibrary.org/conference-proceedings-of-spie/11140/2535451/Biomedical-Imaging-and-Sensing-Conference/10.1117/12.2535451.full EMPIR 2015: Health SPIE 30 0277-786X 10.1117/12.2535451 NA L.Gardini T.Vignolini F.S.Pavone M.Capitanio article BuechelerTSALWCW2019 1241 Science and Technology of Advanced Materials 2019 4 20 1 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 313-323 time-resolved photoluminescence EMPIR 2016: Energy Informa UK Limited 30 1468-6996, 1878-5514 10.1080/14686996.2019.1586583 NA T.P.Weiss R.Carron M.H.Wolter J.Löckinger E.Avancini S.Siebentritt S.Buecheler A.N.Tiwari article TiwariBCFBW2019 1240 Scientific Reports 2019 3 29 9 1 16ENG03: HyMet: Hybrid metrology for thin films in energy applications thin filmsemiconductor EMPIR 2016: Energy Springer Nature 30 2045-2322 10.1038/s41598-019-41716-x NA T.P.Weiss B.Bissig T.Feurer R.Carron S.Buecheler A.N.Tiwari article KurlyandskayaSCMBACT2019 944 Journal of Magnetism and Magnetic Materials 2019 3 473 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 403-409 Magnetic hyperthermia, Fe-oxide, Magnetic nanoparticles EMPIR 2016: Pre-Co-Normative Elsevier BV 30 0304-8853 10.1016/j.jmmm.2018.10.107 NA M.Coïsson G.Barrera C.Appino F.Celegato L.Martino A.P.Safronov G.V.Kurlyandskaya P.Tiberto article HuKPHNKNC2019 1306 Scientific Reports 2019 3 9 1 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements quantitative MFM https://www.nature.com/articles/s41598-019-40477-x#additional-information EMPIR 2015: SI Broader Scope Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-019-40477-x NA D.Nečas P.Klapetek V.Neu M.Havlíček R.Puttock O.Kazakova X.Hu L.Zajíčková article PitreLHHCSPCGLZ2019 1167 Science Bulletin 2019 3 64 5 15SIB02: InK 2: Implementing the new kelvin 2 286-288 Refractive Index, Primary Thermometry, resonance frequencies EMPIR 2015: SI Broader Scope Elsevier BV 30 2095-9273 10.1016/j.scib.2019.01.018 NA H.Zhang W.Liu B.Gao Y.Chen H.Chen C.Pan Y.Song D.Han J.Hu E.Luo L.Pitre article ChunnilallKBGRKLPRGD2019 1012 Metrologia 2019 2 22 56 2 17FUN06: SIQUST: Single-photon sources as new quantum standards 025004 single-photon sources, quantum technologies, quantum characterization EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab022e NA E.Rebufello F.Piacentini M.López R.A.Kirkwood I.Ruo Berchera M.Gramegna G.Brida S.Kück C.J.Chunnilall M.Genovese I.P.Degiovanni article ChunnilallKBGRKLPRGD20190 1012 Metrologia 2019 2 22 56 2 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 025004 single-photon sources, quantum technologies, quantum characterization EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab022e NA E.Rebufello F.Piacentini M.López R.A.Kirkwood I.Ruo Berchera M.Gramegna G.Brida S.Kück C.J.Chunnilall M.Genovese I.P.Degiovanni article ChunnilallKBGRKLPRGD20191 1012 Metrologia 2019 2 22 56 2 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 025004 single-photon sources, quantum technologies, quantum characterization EMPIR 2014: Industry IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ab022e NA E.Rebufello F.Piacentini M.López R.A.Kirkwood I.Ruo Berchera M.Gramegna G.Brida S.Kück C.J.Chunnilall M.Genovese I.P.Degiovanni article NeuCJBPKC2019 1305 Journal of Applied Physics 2019 2 14 125 6 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 060901 MFM https://aip.scitation.org/doi/10.1063/1.5050712 EMPIR 2015: SI Broader Scope AIP Publishing 30 0021-8979, 1089-7550 10.1063/1.5050712 NA O.Kazakova R.Puttock C.Barton H.Corte-León HectorCorte-Leon M.Jaafar V.Neu article MendezSBCKSD2019 1021 Measurement Science and Technology 2019 2 11 30 3 15RPT04: TracePQM: Traceability routes for electrical power quality measurements 035006 quantum standard, digital converter, Josephson arbitrary waveform synthesizer, programmable Josephson voltage standard, Monte Carlo method, Sine fitting algorithms, artificial neural network (ANN) https://iopscience.iop.org/article/10.1088/1361-6501/aafb27/meta EMPIR 2015: Research Potential IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aafb27 NA J.Diaz de Aguilar J.R.Salinas O.Kieler R.Caballero R.Behr Y.A.Sanmamed A.Méndez article OrtolanoCMC2019 1226 Measurement Science and Technology 2019 2 30 3 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics 035102 electrical noise, graphene, flicker, spectrometer https://iopscience.iop.org/article/10.1088/1361-6501/aafcab EMPIR 2016: Pre-Co-Normative IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aafcab NA M.Marzano A.Cultrera M.Ortolano L.Callegaro article JohnsonKCE2019 1148 Physical Review B 2019 1 22 99 4 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 045306 electron quantum optics, hot electron, energy relaxation, phonon https://arxiv.org/abs/1807.11814 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.99.045306 NA C.Emary L.A.Clark M.Kataoka N.Johnson article PlimmerLHCLGCSZCSP2019 1168 Cryogenics 2019 1 97 15SIB02: InK 2: Implementing the new kelvin 2 1-6 Cryogenics, Cryogen-free cryostat, Pulse-tube cooler, Single-pressure refractive index gas thermometry, Thermal switch, Temperature, Metrology, Primary thermometry EMPIR 2015: SI Broader Scope Elsevier BV 30 0011-2275 10.1016/j.cryogenics.2018.10.015 NA H.Chen Y.Chen H.Zhang Y.Song P.Changzhao B.Gao W.Liu D.Han E.Luo M.Plimmer F.Sparasci L.Pitre article SampleCL2019 972 Solar Energy 2019 1 177 16ENG02: PV-Enerate: Advanced PV energy rating 471-482 Bifacial, PV performance, Silicon modules https://ac.els-cdn.com/S0038092X18311514/1-s2.0-S0038092X18311514-main.pdf?_tid=b01e03f6-6af8-4d95-84c6-97f340a4e315&acdnat=1548743260_0bede7742e05c52fb725fc5b521b678c EMPIR 2016: Energy Elsevier BV 30 0038-092X 10.1016/j.solener.2018.11.051 NA J.Lopez-Garcia A.Casado T.Sample article OliveroDFGRBLKTMCKGD2019 1007 Metrologia 2019 1 56 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 015016 colour centers, single-photon source, metrology for quantum technologies EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaf6c8 NA E.Moreva P.Traina R.A.Kirkwood M.López G.Brida M.Gramegna I.Ruo-Berchera J.Forneris S.Ditalia Tchernij P.Olivero C.J.Chunnilall S.Kück M.Genovese I.P.Degiovanni article OliveroDFGRBLKTMCKGD20190 1007 Metrologia 2019 1 56 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 015016 colour centers, single-photon source, metrology for quantum technologies EMPIR 2017: Fundamental IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaf6c8 NA E.Moreva P.Traina R.A.Kirkwood M.López G.Brida M.Gramegna I.Ruo-Berchera J.Forneris S.Ditalia Tchernij P.Olivero C.J.Chunnilall S.Kück M.Genovese I.P.Degiovanni article OliveroDFGRBLKTMCKGD20191 1007 Metrologia 2019 1 56 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 015016 colour centers, single-photon source, metrology for quantum technologies EMPIR 2014: Industry IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aaf6c8 NA E.Moreva P.Traina R.A.Kirkwood M.López G.Brida M.Gramegna I.Ruo-Berchera J.Forneris S.Ditalia Tchernij P.Olivero C.J.Chunnilall S.Kück M.Genovese I.P.Degiovanni techreport VukanaciePNCG2019 1288 JRC Technical Reports 2019 1 EUR 29613 16ENV10: MetroRADON: Metrology for radon monitoring atmospheric pollutant, carcinogenic substance, chemical product, Europe, rare gas, research report, scientific research, toxic substance https://op.europa.eu/en/publication-detail/-/publication/1ae688eb-1555-11e9-81b4-01aa75ed71a1/language-en/format-PDF/source-109153861 EMPIR 2016: Environment Publications Office of the European Union 30 978-92-79-97643-8 1831-9424 NA http://dx.doi.org/10.2760/977726 I. Vukanac M.Živanović I.Čeliković G. Pantelić J.K. Nikolić G. Cinelli V.Gruber article ElsterSCWKL2019 1324 SIAM Journal on Imaging Sciences 2019 1 12 4 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion 2035-2062 Bayesian spatial-temporal regression, cardiac MR, uncertainty quantification EMPIR 2015: Health Society for Industrial & Applied Mathematics (SIAM) 30 1936-4954 10.1137/19M1246274 NA J.Lehnert C.Kolbitsch G.Wübbeler A.Chiribiri T.Schaeffter C.Elster article VavassoriASCGPRCC2019 1307 Nanoscale 2019 11 10 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 4478-4488 MFM https://pubs.rsc.org/en/content/articlelanding/2019/NR/C8NR07729K#!divAbstract EMPIR 2015: SI Broader Scope Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/C8NR07729K NA H.Corte-León H.Corte-León L A.Rodríguez M.Pancaldi C.Gatel D.Cox E.Snoeck V.Antonov P.Vavassori article LandiGGDCL2019 1038 IEEE Transactions on Instrumentation and Measurement 2019 Early acce 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 1-8 Calibration, Digital Low-Power Instrument Transformer (DLPIT), digitizer, Discrete Fourier Transform (DFT), phase measurement, Phasor Measurement Unit (PMU) ,power system measurements. https://ieeexplore.ieee.org/document/8624467 EMPIR 2017: Industry Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2018.2888919 NA G.Crotti A.Delle Femine D.Gallo D.Giordano C.Landi M.Luiso proceedings GiordanoCRMGLFRSBD2019 1945 WCRR Papers 2019 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems arc discharge; electric arc; Power quality; rail transportation system; EMPIR 2016: Energy Tokyo, Japan WORLD CONGRESS OF RAIL RESEARCH (WCRR), Tokyo, Japan, 28 October - 1 November 2019 28-10-2019 to 01-11-2019 30 NA https://zenodo.org/record/4587794 D.Giordano G.Crotti P.Roccato A.Mariscotti D.Gallo M.Luiso N. Filippini I.Rossetta C.Spalvieri A.Biancucci L.Domandio article OraliS2019 2364 International Journal of Modern Physics A 2019 34 36 17FUN07: CC4C: Coulomb Crystals for Clocks 1942003 Linear ion traps, atomic clock, electric RF fields, simulation of electrostatic fields, finite element method, multipole field expansion, ion trajectories, particle tracing,Coulomb crystals https://www.worldscientific.com/doi/abs/10.1142/S0217751X1942003X EMPIR 2017: Fundamental World Scientific Publishing Company 30 1793-656X NA https://arxiv.org/abs/2112.02203 M.Oral O.Číp L.Slodička article BaduraCMR2019 1042 IEEE Transactions on Instrumentation and Measurement 2019 17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors Capacitors, Standards, Voltage measurement, Calibration, Uncertainty, Gain, Voltage transformersCapacitive divider, high voltage, inductive voltage divider (IVD), phase displacement, ratio error SEG EMPIR 2017: Pre-Co-Normative 30 10.7795/EMPIR.17NRM01.CA.20190408 NA H.Badura J.Chunyang E.Mohns P.Raether proceedings SpasovaBNOSCTHZSAV2019 1490 19th International Congress of Metrology (CIM2019) 2019 - 2019 18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance 5/18006 EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple EMPIR 2018: Research Potential EDP Sciences Paris, France 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201918006 NA N.Arifovic D.Sestan D.Zvizdić N.Hozic E.Turzó-András S.Čohodarević R.Strnad K.Opel D.Neagu C.Bordianu S.Spasova T.Vukičević thesis Cvelbar2019 1161 2019 traceable monitoring and evaluation of antimicrobial resistance Humani virus citomegalije, odpornost, kvantitativni PCR, digitalni PCR https://plus.si.cobiss.net/opac7/bib/5046607 EMPIR 2015: Health Univerza V Ljubljana 30 NA https://repozitorij.uni-lj.si/IzpisGradiva.php?id=106576&lang=eng TašjaCvelbar article GodDCBYDDRW2019 1238 Acta Physica Polonica B 2019 50 3 15SIB10: MetroBeta: Radionuclide beta spectra metrology 685 Nuclear mean field theory, modeling prediciton capacities, nuclear point group symmetreis, high-rank symmetries EMPIR 2015: SI Broader Scope Jagiellonian University 30 0587-4254, 1509-5770 10.5506/APhysPolB.50.685 NA J.Dudek I.Dedes J.Yang A.Baran D.Curien T.Dickel A.Góźdź D.Rouvel H.L.Wang article NeufeldKCLLK2019 1304 IEEE Transactions on Electromagnetic Compatibility 2019 ea ea 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 1-10 Basic restrictions, compliance testing, magnetic field (MF) gradient, near-field source, standards, wireless power transfers (WPTs) https://ieeexplore.ieee.org/document/8789646 EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9375, 1558-187X 10.1109/TEMC.2019.2924519 NA I.Liorni T.Lisewski M.H.Capstick S.Kuehn E.Neufeld N.Kuster proceedings SPINELLICTVDKWMDDD2019 1405 unavailable 2019 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 1032-1036 External beam radiotherapy, EBRT, HITU, Ultrasound, Hyperthermia http://publications.rwth-aachen.de/record/767416 EMPIR 2018: Health Deutsche Gesellschaft für Akustik Aachen, Germany 23rd International Congress on Acoustics : integrating 4th EAA Euroregio 09-09-2019 to 13-09-2019 30 978-3-939296-15-7 NA https://doi.org/10.18154/RWTH-CONV-238838 A.SPINELLI B.CACCIA G.TER HAAR G.VAN RHOON J.de Pooter B.Karaböce V.Wilkens P.MILORO G.Durando A.DENKOWA R.DIJKEMA proceedings HrabinaiPeHi2018 1129 21st Czech-Polish-Slovak Optical Conference on Wave and Quantum Aspects of Contemporary Optics 2018 12 18 17IND03: LaVA: Large Volume Metrology Applications SI metre realisation, HCN gas, molecular spectroscopy, hyperfine transition, optical frequency comb https://arxiv.org/abs/1905.07272 EMPIR 2017: Industry SPIE Lednice, Czech Republic 21st Czech-Polish-Slovak Optical Conference on Wave and Quantum Aspects of Contemporary Optics 03-09-2018 to 07-09-2018 30 10.1117/12.2517761 NA M.Hošek S.Rerucha L.Pravdova M.Čížek J.Hrabina O.Číp article ColemanGKBDR2018 970 Measurement 2018 12 129 16ENV08: IMPRESS 2: Metrology for air pollutant emissions 167-183 flow measurement, cyclonic flow, velocity measurements, standard reference method, ultrasonic flow measurement, EN ISO 16911-2, validated computational fluid dynamics (CFD) modelling, OpenFoam software, Emissions Trading System https://arxiv.org/ftp/arxiv/papers/1808/1808.10159.pdf EMPIR 2016: Environment Elsevier BV 30 0263-2241 10.1016/j.measurement.2018.06.032 NA J.Gersl S.Knotek Z.Belligoli R.P.Dwight R.A.Robinson M.D.Coleman article SchioppoNMMLLIHCFBBBBAWSLWZZZ2018 958 Science Advances 2018 12 4 12 15SIB03: OC18: Optical clocks with 1E-18 uncertainty eaau4869 optical atomic clocks, sensor network, dark matter http://advances.sciencemag.org/content/4/12/eaau4869.full EMPIR 2015: SI Broader Scope American Association for the Advancement of Science (AAAS) 30 2375-2548 10.1126/sciadv.aau4869 NA P.Wcisło P.Ablewski K.Beloy S.Bilicki M.Bober R.Brown R.Fasano R.Ciuryło H.Hachisu T.Ido J.Lodewyck A.Ludlow W.McGrew P.Morzyński D.Nicolodi M.Schioppo M.Sekido R.Le Targat P.Wolf X.Zhang B.Zjawin M.Zawada article CrespoLopezUrrutiaKSS2018 980 Reviews of Modern Physics 2018 12 90 4 17FUN07: CC4C: Coulomb Crystals for Clocks optical clocks https://arxiv.org/abs/1803.06532 EMPIR 2017: Fundamental American Physical Society (APS)

1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States

30 0034-6861, 1539-0756 10.1103/RevModPhys.90.045005 NA M.G.Kozlov M.S.Safronova J.R.Crespo López-Urrutia P. O.Schmidt article LuoLYHLSPZGCGHP2018 1170 Science Bulletin 2018 12 63 24 15SIB02: InK 2: Implementing the new kelvin 2 1601-1603 primary thermometry, low temperature, refractive index, microwave resonator EMPIR 2015: SI Broader Scope Elsevier BV 30 2095-9273 10.1016/j.scib.2018.12.001 NA D.Han B.Gao H.Chen P.Gambette H.Zhang C.Pan Y.Song W.Liu Y.Liu J.Hu B.Yu E.Luo L.Pitre article NewellHMRLKHCPYKE2018 994 Communications Physics 2018 11 20 1 1 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics Confocal microscopy, graphene. EMPIR 2016: Pre-Co-Normative Springer Nature America, Inc 30 2399-3650 10.1038/s42005-018-0084-6 NA V.Panchal Y.Yang G.Cheng J.Hu M.Kruskopf C.I.Liu A.F.Rigosi C.Melios A.R.Hight Walker D.B.Newell O.Kazakova R.E.Elmquist article JaksiMODPCMTSSKDHLDGF2018 1009 ACS Photonics 2018 11 12 5 12 17FUN06: SIQUST: Single-photon sources as new quantum standards 4864-4871 color centers; diamond; ion implantation; lead; photoluminescence; single-photon source EMPIR 2017: Fundamental American Chemical Society (ACS) 30 2330-4022, 2330-4022 10.1021/acsphotonics.8b01013 NA S.Ditalia Tchernij T.Lühmann T.Herzig J.Küpper A.Damin S.Santonocito M.Signorile P.Traina E.Moreva F.Celegato S.Pezzagna I. P.Degiovanni P.Olivero M.Jakšić J.Meijer P. M.Genovese J.Forneris article JaksiMODPCMTSSKDHLDGF20180 1009 ACS Photonics 2018 11 12 5 12 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 4864-4871 color centers; diamond; ion implantation; lead; photoluminescence; single-photon source EMPIR 2017: Fundamental American Chemical Society (ACS) 30 2330-4022, 2330-4022 10.1021/acsphotonics.8b01013 NA S.Ditalia Tchernij T.Lühmann T.Herzig J.Küpper A.Damin S.Santonocito M.Signorile P.Traina E.Moreva F.Celegato S.Pezzagna I. P.Degiovanni P.Olivero M.Jakšić J.Meijer P. M.Genovese J.Forneris article MartinezVerduCPVF2018 1008 Optics Express 2018 11 26 23 16NRM08: BiRD: Bidirectional reflectance definitions 30116 Graininess, texture effects, reflectance and traceability https://www.osapublishing.org/oe/fulltext.cfm?uri=oe-26-23-30116&id=400717 EMPIR 2016: Pre-Co-Normative The Optical Society 30 1094-4087 10.1364/OE.26.030116 NA A.Ferrero J.L. Velázquez E.Perales J.Campos F.M.Martínez Verdú article CalossoPDPDS2018 997 Review of Scientific Instruments 2018 11 89 11 17FUN07: CC4C: Coulomb Crystals for Clocks 113116 Experiment control system, experiment control program, FPGA https://doi.org/10.1063/1.5049120 EMPIR 2017: Fundamental AIP Publishing 30 0034-6748, 1089-7623 NA https://arxiv.org/abs/1901.04851 C.E.Calosso M.Pomponio A.Detti E.Perego L.Duca C.Sias article VargasBCMPR2018 894 Remote Sensing 2018 10 30 10 11 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident 1712 UAS, CZT, UAS software Architecture, radiological detection EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs10111712 NA P.Royo E.Pastor M.Macias R.Cuadrado C.Barrado A.Vargas article ClarkPLPBDMSSS2018 883 Acta Materialia 2018 10 15 159 1 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 89-101 Orientation mapping, Crystallographic characterisation, Electrochemical jet processing, https://www.sciencedirect.com/science/article/pii/S1359645418305998 EMPIR 2015: SI Broader Scope Elsevier BV 30 1359-6454 10.1016/j.actamat.2018.07.059 NA A.Speidel R.Su R.Su J.Mitchell-Smith P.Dryburgh I.Bisterov D.Pieris W.Li R.Patel M.Clark article LandiGGFCL2018 1039 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 2018 10 1 1 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 1-2 Phase Measurement,Data Acquisition System,Calibration,Power System Measurements,DFT,PMU,LPIT https://doi.org/10.5281/zenodo.2628739 EMPIR 2017: Industry IEEE 30 2160-0171 10.1109/TIM.2018.2888919 NA G.Crotti A.Delle Femine D.Gallo D.Giordano C.Landi M.Luiso article Chretien2018 Journal of Computational and Applied Mathematics 2018 10 340 1 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics 221-230 Conic singular value, subdifferential, Lagrange duality, Newton's method https://arxiv.org/pdf/1807.02589.pdf EMRP A169: Call 2013 Energy II Elsevier BV 30 0377-0427 10.1016/j.cam.2018.02.035 NA S.Chretien article ChebenVMOHLSWH2018 873 Optics Letters 2018 9 21 43 19 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 4691 Subwavelength, anisotropy, silicon, waveguides https://riuma.uma.es/xmlui/handle/10630/16695 EMPIR 2014: Industry The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.43.004691 NA J.M.Luque-González A.Herrero-Bermello A.Ortega-Monux I.Molina-Fernandez A.V.Velasco P.Cheben J.H.Schmid S.Wang R.Halir article KonijnenbergGMGGCGR2018 825 European Journal of Nuclear Medicine and Molecular Imaging 2018 9 14 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy Dosimetry, Absorbed Dose EMPIR 2015: Health Springer Nature America, Inc 30 1619-7070, 1619-7089 10.1007/s00259-018-4136-7 NA J.I.Gear M.G.Cox J.Gustafsson K.S.Gleisner I.Murray G.Glatting M.Konijnenberg G. D.Flux proceedings CarabelliDPDFTMGR2018 1414 Quantum Photonic Devices 2018 2018 9 11 10733 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1073304 Diamond,Color centers,Confocal microscopy,Electroluminescence,Single photon https://iris.unito.it/handle/2318/1685641#.XjvhgWhKhPY EMPIR 2017: Fundamental SPIE San Diego, California, United States SPIE NanoScience + Engineering 19-08-2018 to 23-08-2018 30 10.1117/12.2323102 NA M.Genovese E.Moreva P.Traina J.Forneris S.Ditalia Tchernij F.Picollo I.P.Degiovanni V.Carabelli P.Olivero article LandiGDRGCLM2018 1146 IEEE Transactions on Instrumentation and Measurement 2018 9 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems DC railway system, Electric arc, Rail transportation Pantograph–catenary, Predictive maintenance EMPIR 2016: Energy IEEE 30 10.1109/TIM.2019.2902805 NA G.Crotti A.Delle Femine D.Gallo D.Giordano C.Landi M.Luiso A.Mariscotti P.Roccato article LandiGDGCL2018 1145 2018 IEEE 9th International Workshop on Applied Measurements for Power Systems (AMPS) 2018 9 16ENG04: MyRailS: Metrology for smart energy management in electric railway systems DC railway system, power and energy measurement, voltage and current transducer, static and dynamic characterizzation SEG https://doi.org/10.1109/AMPS.2018.8494873 EMPIR 2016: Energy IEEE 30 10.5281/zenodo.3265102 NA C.Landi D.Gallo A.Delle Ferninc D.Giordano G.Crotti M.Luiso article VanhaeckeCL2018_2 971 Analytica Chimica Acta 2018 9 1025 15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease 69-79 MC-ICP-MS; Copper; Gallium; Isotope ratio; Interferences; Micro-samples https://www.sciencedirect.com/science/article/pii/S0003267018306147?via%3Dihub EMPIR 2015: Health Elsevier BV 30 0003-2670 10.1016/j.aca.2018.05.025 NA S.Lauwens M.Costas-Rodríguez F.Vanhaecke article LangellaGDCL2018 1037 2018 IEEE 9th International Workshop on Applied Measurements for Power Systems (AMPS) 2018 9 1 1 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 1-6 Current Transformer, Calibration, Non-linearity, Power System Measurement, Harmonics, Compensation SEG https://zenodo.org/record/2628408#.XKYZ3pgzaCo EMPIR 2017: Industry IEEE 30 2475-2304 10.5281/zenodo.2628408 NA R.Langella D.Gallo A.Delle Femine A.J.Collin M.Luiso article YangBJCJTS2018 Biomedical Engineering / Biomedizinische Technik 2018 9 63 s1 HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound 240 OPM, SQUID, SQUID-MEG, signal-to-noise ratio EMRP A169: Call 2011 Metrology for Health Walter de Gruyter GmbH

Berlin

30 1862-278X, 0013-5585 10.1515/bmt-2018-6045 NA T.Yang R.Brühl A. Jodko-Władzińska P.Cotic Smole V.Jazbinšek L.Trahms T.Sander-Thömmes proceedings SenC2018 836 2018 International Symposium on Electromagnetic Compatibility (EMC EUROPE) 2018 8 30 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 1-6 Conducted Emission, Conducted Immunity, EMC, Verification http://rfmw.cmi.cz/documents/papers/Sen_EMCEurope2018OA.pdf EMPIR 2015: Research Potential IEEE

Piscataway, USA

Amsterdam, The Netherlands 2018 International Symposium on Electromagnetic Compatibility (EMC EUROPE) 27-08-2018 to 30-08-2018 30 978-1-4673-9698-1 2325-0364 10.1109/EMCEurope.2018.8485179 NA O.Şen S.Çakır article CastroBW2018 786 Physical Review Applied 2018 8 24 10 2 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 024038 photovoltaics, transient photovoltage, transient photocurrent, organic solar cells, finite-element method, organic semiconductors https://journals.aps.org/prapplied/abstract/10.1103/PhysRevApplied.10.024038 EMPIR 2016: Energy American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.024038 NA S.Wood J.C.Blakesley F.A.Castro article IldayCEHe2018 1075 Physical Review Applied 2018 8 20 10 2 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 024027 frequency comb, low-noise EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2331-7019 NA https://arxiv.org/abs/1905.01116 F.O.Ilday M.Çelik C.Erdoğan R.Hamid C.Şenel article SieversYSHGBTCBF2018 996 Applied Physics Letters 2018 8 13 113 7 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements Excitation, Coherent control, Magnetization dynamics, magnetic tunnel junctions, acoustic pulses https://arxiv.org/abs/1804.10503 EMPIR 2015: SI Broader Scope 30 10.1063/1.5037780 NA H.F.Yang F.Garcia-Sanchez X.K.Hu S.Sievers T.Böhnert J.D.Costa M.Tarequzzaman R.Ferreira M.Bieler H.W.Schumacher article DelleFemineGLGCLL2018 1035 Journal of Physics: Conference Series 2018 8 1065 1 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 052033 Current Transformer, Calibration, Power System Measurement, Current Measurement, Distorted Conditions SEG https://iopscience.iop.org/article/10.1088/1742-6596/1065/5/052033/pdf EMPIR 2017: Industry IOP Publishing

Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom

30 1742-6588, 1742-6596 10.1088/1742-6596/1065/5/052033 NA G.Crotti A.Delle Femine D.Gallo D.Giordano C.Landi P.S.Letizia M.Luiso article BruchertseiferFCDPHVPLMM2018 Applied Radiation and Isotopes 2018 8 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity γ-ray intensities, 227Ac, 227Th, 223Ra, decay data, γ-ray spectrometry EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2018.08.023 NA F.Bruchertseifer A.Fazio P.Carconi P.Dryák S.Pierre M.Hult R.Van Ammel S.Pommé G.Lutter M.Marouli A.Morgenstern article OguzAytekinKMSISFSZSJoHBHPV2018 1086 Journal of Physics: Conference Series 2018 8 1065 15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement 122019 Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019 EMPIR 2015: Research Potential IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1065/12/122019 NA N.Hodzic S.Čohodarević N.Jandrić R.Strnad D.Zvizdić D.Sestan V.Fernicola D.Smorgon L.Iacomini S.Simic D.Mac Lochlainn N.Karaboce S.Oguz Aytekin J.Bojkovski D.Hudoklin O.Petrušova T.Vukičević article PendrillSFMCW2018 1150 Journal of Physics: Conference Series 2018 8 1065 7 15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases 072033 Patient-centred cognition metrology EMPIR 2015: Health IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1065/7/072033 NA S.JCano J.Melin W.PFisher A.JStenner L.RPendrill article McKennaGSBCHGP2018 608 RSC Advances 2018 7 31 8 52 14IND12: Innanopart: Metrology for innovative nanoparticles 27276–27282 Nanoparticles, nanotechnology, nanoalloys, platinum, bimetallic, electron microscopy http://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra02449a EMPIR 2014: Industry The Royal Society of Chemistry 30 2046-2069 10.1039/C8RA02449A NA S.Gholhaki S.Hung D.Cant C.Blackmore A.Shard Q.Guo K.McKenna R.Palmer proceedings OzturkSC2018 888 2018 IEEE Symposium on Electromagnetic Compatibility, Signal Integrity and Power Integrity (EMC, SI & PI) 2018 7 30 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 82-87 Aerospace, Capacitor, CS101, DFT, EMC, FFT, Immunity, Military, Susceptibility, Time Domain http://rfmw.cmi.cz/documents/papers/Cakir_CS101.pdf EMPIR 2015: Research Potential IEEE Long Beach, CA, USA 2018 IEEE Symposium on Electromagnetic Compatibility, Signal Integrity and Power Integrity 30-07-2018 to 02-08-2018 30 978-1-5386-6619-7 10.1109/EMCSI.2018.8495307 NA S.Çakır O.Şen M.Ozturk article ManaCMMDF2018 Metrologia 2018 7 27 55 5 ENV58: MeteoMet2: Metrology for essential climate variables 662-669 cavity ring-down spectroscopy (CRDS), water vapour mole fraction, water vapourdensity, high-resolution molecular spectroscopy EMRP A169: Call 2013 Environment II IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aad15e NA G.Mana A.Castrillo A.Merlone L.Moretti H.Dinesan E.Fasci article BoarinoRDSPDGFMC2018 846 Scientific Reports 2018 7 27 8 1 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance surface-enhanced Raman spectroscopy; substrates for bio-analytical applications; flexible gold-coated Si nanowires https://www.nature.com/articles/s41598-018-29641-x.pdf EMPIR 2015: Health Springer Nature 30 2045-2322 10.1038/s41598-018-29641-x NA E.Cara L.Mandrile F.Ferrarese Lupi A.M.Giovannozzi M.Dialameh C.Portesi K.Sparnacci N.De Leo A.M.Rossi L.Boarino article XuerebGMLMTCC2018 852 Optica 2018 7 25 5 8 15SIB05: OFTEN: Optical frequency transfer - a European network 893 optical fiber, optical frequency transfer EMPIR 2015: SI Broader Scope The Optical Society 30 2334-2536 10.1364/OPTICA.5.000893 NA C.Clivati A.Tampellini A.Mura F.Levi G.Marra P.Galea A.Xuereb D.Calonico article PonsVFC2018 901 Optics Express 2018 7 26 14 15SIB07: PhotoLED: Future photometry based on solid-state lighting products 18633 photometer, spectral, mismatch, error, quality index EMPIR 2015: SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.26.018633 NA A.Ferrero J.L. Velázquez A.Pons J.Campos proceedings ZuccaPMGCS2018 1082 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 2018 7 Online Unique 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 1-2 Voltage measurement, Calibration, Probes, Windings, Frequency measurement, Power measurement http://arxiv.org/abs/1905.08046 EMPIR 2016: Energy IEEE Paris (France) 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 08-07-2018 to 13-07-2018 30 978-1-5386-0974-3 2160-0171 10.1109/CPEM.2018.8500831 NA M.Zucca U.Pogliano M.Modarres D.Giordano G.Crotti D.Serazio proceedings GrajciarDACHP2018 887 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 2018 7 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 1-2 Harmonic effect, microwave measurements, microwave power, power sensor, uncertainty http://rfmw.cmi.cz/documents/papers/Celep_HarmonicEffect_cpem2018.pdf EMPIR 2015: Research Potential IEEE Paris, France 2018 Conference on Precision Electromagnetic Measurements 08-07-2018 to 13-07-2018 30 978-1-5386-0974-3 2160-0171 10.1109/CPEM.2018.8500788 NA MuratCELEP YaserAbdo KarelDražil JanGrajciar MartinHudlicka BorutPinter article CampCV2018 Applied Radiation and Isotopes 2018 7 137 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 241-249 H*(10) calculation methods, LaBr3(Ce) detector, MetroERM EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2018.03.026 NA A.Camp N.Cornejo A.Vargas article ZinkPC2018 750 Physics in Medicine & Biology 2018 7 63 15 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 155015 radiation dosimetry, reference dosimetry, ICRU 90 EMPIR 2016: Pre-Co-Normative IOP Publishing 30 1361-6560 10.1088/1361-6560/aad148 NA D.Czarnecki B.Poppe K.Zink article SigrayLCBMBBAHRGCBD2018 904 ACTA IMEKO 2018 7 7 2 15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz 32 low frequency hydrophone calibration; low frequency underwater noise recorders; underwater acoustics; calibration http://dx.doi.org/10.21014/acta_imeko.v7i2.542 EMPIR 2015: Research Potential IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v7i2.542 NA A.Biber A.C.Çorakçı A.Golick S.Robinson G.Hayman J.Ablitt S.Barrera-Figueroa S.Buogo S.Mauro F.Borsani S.Curcuruto M.Linné P.Sigray P.Davidsson article YuWMGDCBBTCOGM2018 955 Rapid Communications in Mass Spectrometry 2018 6 26 32 15 16ENV06: SIRS: Metrology for stable isotope reference standards 1207-1214 N2O, reference material, isotope delta value, USGS51, USGS52 https://onlinelibrary.wiley.com/doi/10.1002/rcm.8257 EMPIR 2016: Environment Wiley 30 0951-4198 10.1002/rcm.8157 NA N.E.Ostrom H.Gandhi T.B.Coplen S.Toyoda J.K.Böhlke W.A.Brand K.L.Casciotti J.Dyckmans A.Giesemann J.Mohn J.Mohn R.Well L.Yu manual KielerBWMRCSBSSCDOB2018 719 2018 6 21 1 14RPT01: ACQ-PRO: Towards the propagation of ac quantum voltage standards ISBN ok https://grp.isbn-international.org/search/piid_cineca_solr/978-80-905619%2B%2528ISBNPrefix%2529?keys=978-80-905619%2B%2528ISBNPrefix%2529 Good Practice Guide, quantum standards, alternating voltage, Josephson effect, measurement techniques, uncertainty estimation, software tools, safe operation, cryogenic equipment EMPIR 2014: Research Potential Czech Metrology Institute

Brno

30 978-80-905619-2-2 NA http://acqpro.cmi.cz/index.php/results/28-good-practice-guide O.Kieler R.Behr J.M.Williams H.Malmbekk L.Ribeiro V.Cabral A.Sosso P.Bruszewski M.Šíra Y.A.Sanmamed R.Caballero J.Diaz de Aguilar R.Orhan G.Bonfait article MalhiARNDBOCL2018 959 Remote Sensing 2018 6 13 10 6 16ENV03: MetEOC-3: Further metrology for earth observation and climate 933 tree reconstruction, radiative transfer, terrestrial LiDAR, forestry, 3D modelling, calibration and validation, end-to-end traceability https://www.mdpi.com/2072-4292/10/6/933 EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs10060933 NA K.Calders N.Origo A.Burt M.Disney J.Nightingale P.Raumonen M.Åkerblom Y.Malhi P.Lewis article CorrederaSPGdV2018 569 Sensors 2018 6 10 18 6 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 1895 fiber-optic sensors; fiber Bragg gratings interrogators; absolute calibration EMPIR 2014: Industry MDPI AG 30 1424-8220 10.3390/s18061895 NA J.de Miguel J.Galindo-Santos C.Pulido de Torres P.Salgado A.V.Velasco P.Corredera article OverneyMDCKPOG2018 Metrologia 2018 6 55 4 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 499-512 impedance metrology, impedance bridges, impedance standards, digital instrumens, comparisons http://iopscience.iop.org/article/10.1088/1681-7575/aabf24 EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aabf24 NA F.Overney M.Marzano V.D’Elia L.Callegaro J.Kucera L.Palafox M.Ortolano G.Gülmez article LuoHLCSZCPPG2018 1169 Science Bulletin 2018 6 63 12 15SIB02: InK 2: Implementing the new kelvin 2 733-734 low-temperature, cryogenic temperature, primary thermometry, refractive-index gas thermometry, microwave resonator EMPIR 2015: SI Broader Scope Elsevier BV 30 2095-9273 10.1016/j.scib.2018.05.023 NA B.Gao C.Pan L.Pitre H.Chen Y.Chen H.Zhang Y.Song W.Liu D.Han E.Luo article deClercqZGRPCAB2018 Physical Review Applied 2018 6 9 6 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications Resonance raman transition, dual-frequency laser, long-term stability, rubidium, standard; compensation, performance, shifts, EMRP A169: Call 2012 Metrology for Industry (II) American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.9.064002 NA E.de Clercq T.Zanon-Willette S.Guérandel C.Rocher M.Petersen G.Coget M.Abdel Hafiz R.Boudot article MaheSHDMPLOC2018 896 Welding in the World 2018 6 62 5 15HLT09: MetAMMI: Metrology for additively manufactured medical implants 1049-1057 Additive manufacturing, Volumetric non-destructive techniques (NDTs), Archimedes’ method, Gas pycnometric method, Multi-frequency eddy current method, C-scan ultrasound method EMPIR 2015: Health Springer Nature America, Inc 30 0043-2288, 1878-6669 10.1007/s40194-018-0593-7 NA A.F.Obaton M.Q.Le V.Prezza D.Marlot P.Delvart A.Huskic S.Senck E.Mahé C.Cayron article WebsterCPB2018 1149 Journal of Physics: Conference Series 2018 6 1044 15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases 012057 patient-centred outcome metrology EMPIR 2015: Health IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1044/1/012057 NA S.JCano L.RPendrill S.PBarbic W.PFisher proceedings RobinsonMCY2018 850 Proc. SPIE 2018 5 17 10683 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 106831B Encircled Angular Flux, modal distribution, far field intensity pattern, step-index fibres https://arxiv.org/abs/1806.09839 EMPIR 2014: Industry Strasbourg Fiber Lasers and Glass Photonics: Materials through Applications 22-04-2018 to 26-04-2018 30 10.1117/12.2306430 NA E.Robinson H.Yang N.Castagna J.Morel proceedings PousASTOC2018 765 2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility (EMC/APEMC) 2018 5 14 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 177-182 Aerospace, CS101, EMC, Immunity, Military, Time Domain http://rfmw.cmi.cz/documents/papers/Cakir_FFT_TDS_CS101.pdf EMPIR 2015: Research Potential IEEE Singapore 2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility 14-05-2018 to 18-05-2018 30 978-1-5090-5997-3 10.1109/ISEMC.2018.8393762 NA S.Çakır M.Ozturk B.Tektas O.Şen S.Acak M.Pous article BuismanCHL2018 797 URSI 2018 5 14IND10: MET5G: Metrology for 5G communications MIMO, Testbed, Interference, Distortion http://www.ursi.org/proceedings/procAT18/papers/SA052.pdf EMPIR 2014: Industry 30 NA http://arxiv.org/abs/1809.07825 K.Buisman D.Cheadle D.Humphreys T. H.Loh article VandervorstvAZFMMC2018 482 Journal of Vacuum Science & Technology B, Nanotechnology and Microelectronics: Materials, Processing, Measurement, and Phenomena 2018 5 36 3 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 03F130 accuracy, composition, Atom probe, GaN https://avs.scitation.org/doi/10.1116/1.5019693 EMPIR 2014: Industry American Vacuum Society 30 2166-2746, 2166-2754 10.1116/1.5019693 NA R.J.H.Morris R.Cuduvally D.Melkonyan C.Fleischmann M.Zhao L.Arnoldi P.van der Heide W.Vandervorst article CornejoDiaz2018 Radiation Protection Dosimetry 2018 5 ENV57: MetroERM: Metrology for radiological early warning networks in Europe ambient dose equivalent measurements, spectrometric detectors EMRP A169: Call 2013 Environment II Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncy064 NA N.Cornejo Díaz article ErikssonHLCB2018 800 URSI 2018 5 14IND10: MET5G: Metrology for 5G communications Millimeter-waveSINRMIMO EMPIR 2014: Industry 30 10.23919/URSI-AT-RASC.2018.8471560 NA https://research.chalmers.se/en/publication/505084 KBuisman DCheadle T HLoh DHumphreys T Eriksson article SavioLSSCM2018 824 CIRP Annals 2018 5 67 1 14IND09: MetHPM: Metrology for highly-parallel manufacturing 599-602 Data fusion, Surface topography, Interferometry, Photogrammetry, Coordinate measurement https://www.sciencedirect.com/science/article/pii/S0007850618300672?via%3Dihub EMPIR 2014: Industry Elsevier BV 30 0007-8506 10.1016/j.cirp.2018.04.043 NA R.Leach D.Sims-Waterhouse F.Medeossi E.Savio S.Carmignato R.Su article LewisAWNDOC2018 Agricultural and Forest Meteorology 2018 4 252 ENV53: MetEOC2: Metrology for earth observation and climate 231-240 Sensor comparison, Leaf area index, Terrestrial LiDAR, Hemispherical photography, LAI-2200, Validation. http://discovery.ucl.ac.uk/1542932/1/Origo_1-s2.0-S0168192317300369-main.pdf EMRP A169: Call 2013 Environment II Elsevier BV 30 0168-1923 10.1016/j.agrformet.2018.01.029 NA P.Lewis J.Armston W.Woodgate J.Nightingale M.Disney N.Origo K.Calders article AarhaugHAGCMB2018 502 International Journal of Hydrogen Energy 2018 4 15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications ISO14687-2, Hydrogen quality, Fuel cell electrical vehicle, Probability of occurrence, Hydrogen production process, ISO 19880-8 https://www.sciencedirect.com/science/article/pii/S0360319918308450 EMPIR 2015: Pre-Co-Normative Elsevier BV 30 0360-3199 10.1016/j.ijhydene.2018.03.084 NA TBacquart AMurugan MCarré BGozlan FAuprêtre FHaloua T.A.Aarhaug article VenceljPDCBGP2018 Applied Radiation and Isotopes 2018 4 134 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 439-445 Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements, Radon and thoron background, Radon progeny, Walk-in radon chamber EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.07.039 NA M.Vencelj D.Ponikvar P.De Felice F.Cardellini D.Brodnik D.Glavič-Cindro T.Petrovič article MichlerWMDEC2018 858 Acta Materialia 2018 4 148 14IND03: Strength-ABLE: Metrology for length-scale engineering of materials 202-215 Titanium aluminides Micromechanics Electron backscattering diffraction (EBSD)Digital image correlation Deformation twinning EMPIR 2014: Industry Elsevier BV 30 1359-6454 10.1016/j.actamat.2018.01.007 NA T.E.J.Edwards F.Di Gioacchino G.Mohanty J.Wehrs J.Michler W.J.Clegg article ChudnovskyPGWKGWHZBNZZZZ2018 582 Applied Physics Letters 2018 3 26 112 13 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 132405 magnetic skyrmion, magnetic force microscopy, stray field, perpendicular magnetic anisotropy http://hdl.handle.net/10754/627497 EMPIR 2015: SI Broader Scope AIP Publishing 30 0003-6951, 1077-3118 10.1063/1.5021172 NA X,Zhang S.Zhang J.Zhang Q.Zhang C.Barton V.Neu Y.Zhao Z.Hou Y.Wen C.Gong O.Kazakova W.Wang Y.Peng D.A.Garanin E.M.Chudnovsky article TabandehBSRCM2018 Measurement Science and Technology 2018 3 16 29 5 ENV58: MeteoMet2: Metrology for essential climate variables 054002 hygrometry, humidity generator, frost point, upper-air sensors EMRP A169: Call 2013 Environment II IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aaa785 NA S.Tabandeh G.Beltramino D.Smorgon L.Rosso R.Cuccaro G.Mana article CarrollMB2018 International Journal of Thermophysics 2018 3 10 39 4 SIB64: METefnet: Metrology for moisture in materials 50 Calibration, Evolved vapor analyze,r Measurement traceability, Water content https://link.springer.com/article/10.1007%2Fs10765-018-2368-1 EMRP A169: Call 2012 SI Broader scope (II) Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-018-2368-1 NA P. A.Carroll P.Miao S. A.Bell article CalonicoPTVR2018 589 Review of Scientific Instruments 2018 3 89 3 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 033103 frequency metrology, optical fibre links http://arxiv.org/abs/1807.10818 EMPIR 2015: SI Broader Scope AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.5016514 NA B.Rauf M. C.Vélez López P.Thoumany M.Pizzocaro D.Calonico article SylvainCHF2018 The International Journal of Advanced Manufacturing Technology 2018 2 18 96 1-4 IND62: TIM: Traceable in-process dimensional measurement 947–961 Material standard; Calibration; Geometric errors; Intercomparison; Traceability https://link.springer.com/article/10.1007/s00170-017-1572-7#enumeration EMRP A169: Call 2012 Metrology for Industry (II) Springer London 30 1433-3015 10.1007/s00170-017-1572-7 NA L.Sylvain T.Christophe N.Hichem V.Fabien article RaumonenLCBBDW2018 Interface Focus 2018 2 16 8 2 ENV53: MetEOC2: Metrology for earth observation and climate 20170048 above-ground biomass, terrestrial laser, scanning, lidar, canopy, structure, buttress EMRP A169: Call 2013 Environment II The Royal Society 30 2042-8898, 2042-8901 10.1098/rsfs.2017.0048 NA P.Raumonen S. L.Lewis K.Calders A.Burt M.Boni Vicari M. I.Disney P.Wilkes article CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018 812 Nature Physics 2018 2 12 14 5 SIB55: ITOC: International timescales with optical clocks 437-441 optical fiber, optical frequency transfer EMRP A169: Call 2011 SI Broader Scope Springer Nature 30 1745-2473, 1745-2481 10.1038/s41567-017-0042-3 NA G.A.Costanzo M.Zucco P.Barbieri A.Tampellini F.Bregolin B.Rauf M.Pizzocaro P.Thoumany H.S.Margolis M.Zampaolo A.Rolland F.N.Baynes L.Timmen H.Denker C.Voigt C.Lisdat S.Häfner U.Sterr S.Vogt S.Koller J.Grotti C.Clivati F.Levi D.Calonico article HenaultCLDRBFMBH2018 374 Measurement 2018 2 116 16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities 18-24 Distributed temperature sensors; Raman; Metrology; Structural health monitoring; Optical fibres http://www.sciencedirect.com/science/article/pii/S0263224117306656 EMPIR 2016: Environment Elsevier BV 30 0263-2241 10.1016/j.measurement.2017.10.041 NA G.Failleau O.Beaumont R.Razouk S.Delepine-Lesoille M.Landolt B.Courthial J.M.Hénault F.Martinot J.Bertrand B.Hay article PeyresERHVPLMGDMC2018 Applied Radiation and Isotopes 2018 2 132 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 72-78 γ-ray spectrometry, 235U, 231Th, Decay data, γ-ray emission probabilities, NORM EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.10.049 NA V.Peyres R.Eykens S.Richter M.Hult R.Van Ammel S.Pommé G.Lutter M.Marouli E.García-Toraño P.Dryák M.Mazánová P.Carconi proceedings SaverioPavoneCCGV2018 849 Biophysical Journal 2018 2 114 3 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 14a Highly Inclined and Laminated Optical sheet (HILO) microscopy, dSTORM https://www.biophysics.org/Portals/0/EasyDNNnews/Uploads/2131/2018%20Program-WEB.pdf EMPIR 2015: Health Elsevier BV Moscone Center Biophysical Society 62nd Annual Meeting 17-02-2018 to 21-02-2018 30 0006-3495 10.1016/j.bpj.2017.11.121 NA T.Vignolini L.Gardini V.Curcio M.Capitanio F.Saverio Pavone article VermesseSLDBROGDDPDSGCP2018 Physica Medica 2018 1 45 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 106-116 Dose-area product, Beam quality, DAP ratio, Small photon beams EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2017.12.012 NA D.Vermesse L.Sommier M.Le Roy J.Daures J.M.Bordy B.Rapp A.Ostrowsky J.Gouriou S.Dufreneix F.Delaunay A.Petrucci V.De Coste L.Silvi A.S.Guerra C.Caporali M.Pimpinella article ZhouWLCZ2018 799 Loughborough Antennas & Propagation Conference 2018 2018 14IND10: MET5G: Metrology for 5G communications wireless communication, MIMO OTA test, link performance, SINR, uncertainty. EMPIR 2014: Industry 30 NA http://arxiv.org/abs/1809.07826 Y.Zhou M.Wang T. H.Loh D.Cheadle Y.Zhao article BeckhoffMWJCHU2018 534 Journal of Analytical Atomic Spectrometry 2018 16ENG03: HyMet: Hybrid metrology for thin films in energy applications X-ray fluorescence, atomic fundamental parameters https://arxiv.org/abs/1805.02951 EMPIR 2016: Energy Royal Society of Chemistry (RSC)

Thomas Graham House Science Park, Milton Rd Science Park, Milton Rd Cambridge CB4 0WF United Kingdom

30 0267-9477, 1364-5544 10.1039/C8JA00046H NA R.Unterumsberger P.Honicke J.L.Colaux C.Jeynes M.Wansleben M.Muller B.Beckhoff article ZhaoFLLC2018 867 CIRP Annals 2018 67 1 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 539-542 Information, Surface, Characterization EMPIR 2015: SI Broader Scope Elsevier BV 30 0007-8506 10.1016/j.cirp.2018.04.002 NA C.F.Cheung M.Liu R.Leach X.Feng C.Zhao article CouplandLTS2017 420 Optics Letters 2017 12 21 43 1 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 82 Imaging systems , Interferometry, Metrology , Calibration , Microscopy, Aberrations https://www.osapublishing.org/ol/fulltext.cfm?uri=ol-43-1-82 EMPIR 2015: SI Broader Scope The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.43.000082 NA R.Su M.Thomas R.Leach J.Coupland article RuizCMPB2017 819 Applied Optics 2017 12 18 57 1 14IND09: MetHPM: Metrology for highly-parallel manufacturing A235-A241 holographic, reference wave, optical holography, https://www.osapublishing.org/ao/abstract.cfm?uri=ao-57-1-A235 EMPIR 2014: Industry The Optical Society 30 1559-128X, 2155-3165 10.1364/AO.57.00A235 NA I.S.Park R.J.C.Middleton C.R.Coggrave P.D.Ruiz J MCoupland article NeumaierDCBDS2017 Journal of Instrumentation 2017 12 18 12 12 ENV57: MetroERM: Metrology for radiological early warning networks in Europe P12024-P12024 data acquisition concepts, dosimetry concepts and apparatus, overall mechanics, design (support structures and materials, vibration analysis etc), radiation monitoring EMRP A169: Call 2013 Environment II IOP Publishing 30 1748-0221 10.1088/1748-0221/12/12/P12024 NA S.Neumaier R.Dabrowski M.D.Cort M.Bleher H.Dombrowski U.Stöhlker article BorkowskiKMuC2017 594 Physical Review A 2017 12 15 96 6 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 063411 Optical Feshbach resonances, ultra-cold molecules https://arxiv.org/abs/1708.05403 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.96.063411 NA M.Borkowski R.Muñoz Rodriguez M.B.Kosicki R.Ciuryło P.S.Żuchowski article vandenBergCVL2017 Optics Express 2017 12 14 25 26 SIB60: Surveying: Metrology for long distance surveying 32570 Fabry-Perot, Interferometry, Metrology, Mode-locked lasers, Optical resonators, Laser range finder, Ultra fast lasers https://www.osapublishing.org/DirectPDFAccess/294E3804-A5DD-C864-BA58B8635F309FB1_379535/oe-25-26-32570.pdf?da=1&id=379535&seq=0&mobile=no EMRP A169: Call 2012 SI Broader scope (II) The Optical Society 30 1094-4087 10.1364/OE.25.032570 NA S.van den Berg O.Číp D.Voigt A.Lešundák article NielsenAKKIIHGFCCBHOOSS2017 International Journal of Thermophysics 2017 12 39 1 SIB64: METefnet: Metrology for moisture in materials Karl Fischer, Loss-on-drying, Moisture, Oven drying, Traceability EMRP A169: Call 2012 SI Broader scope (II) Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-017-2340-5 NA J.Nielsen R.Aro M.Krasheninina T.Keawprasert N.Ismail G.V.Ionescu D.Hudoklin E.Georgin V.Fernicola G.Cortellessa B.I.Choi S.Bell M.Heinonen S.Oguz Aytekin P.Österberg J.Skabar R.Strnad article TakasuBBCJYKTT2017 775 Physical Review A 2017 12 96 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 063405 photoassociation, spectroscopy, ytterbium, EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.96.063405 NA M.Borkowski A.A.Buchachenko R.Ciuryło P.S.Julienne H.Yamada Y.Kikuchi K.Takahashi Y.Takahashi Y.Takasu proceedings RidlerCL2017_2 519 2017 90th ARFTG Microwave Measurement Symposium (ARFTG) 2017 11 30 14IND02: PlanarCal: Microwave measurements for planar circuits and components Measurement repeatability, Measurement reproducibility, On-wafer measurements, Millimeter-wave measurements, Measurement uncertainty http://eprints.whiterose.ac.uk/125336/ EMPIR 2014: Industry IEEE

445 Hoes Lane Piscataway NJ 08855-1331 United States

Boulder, Colorado ARFTG 90th Microwave Measurement Conference 28-11-2017 to 01-12-2017 30 978-1-5386-4356-3 10.1109/arftg.2017.8255866 NA R GClarke CLi N MRidler article SassiLGWTMPLBPDCESK2017 Atmospheric Measurement Techniques Discussions 2017 11 28 ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change 1-17 zero gas, VOC measurements https://www.atmos-meas-tech-discuss.net/amt-2017-412/ EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8610 10.5194/amt-2017-412 NA G.Sassi M.Lecuna Y.Ghorafi R.Wortmann E.Tensing K.Michl C.Plass-Duelmer J.Li A.Baldan S.Persijn A.Demichelis A.Claude J.Englert M.P.Sassi D.Kubistin article BaeHCGHAK2017 414 Journal of Applied Physics 2017 11 21 122 19 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 194502 single electron pump, quantum dot, single electron tunneling http://aip.scitation.org/doi/abs/10.1063/1.5000319 EMPIR 2015: SI Broader Scope AIP Publishing 30 0021-8979, 1089-7550 10.1063/1.5000319 NA Y.H.Ahn Y.P.Hong C.Hong Y.S.Ghee Y.Chung M.H.Bae N.Kim article SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017 Measurement Science and Technology 2017 11 13 ENV58: MeteoMet2: Metrology for essential climate variables Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta EMRP A169: Call 2013 Environment II IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa99fc NA L.Šindelárová D.Sestan J.Salminen H.Sairanen L.Rosso J.del Rio M.K.Rasmussen S.Oguz Aytekin M.de Podesta P.Pavlasek M.Nogueras Cervera J.Nielsen C.Musacchio P.Miao L.G.Lanza A.Kowal M.Kalemci D.Hudoklin R.Högström S.Hernandez de la Villa M.Heinonen D.Groselj A.Gonzalez Calvo E.Georgin T.Gardiner C.García Izquierdo A.Garcia-Benadí VFernicola V.Ebert J.Drnovsek M.Dobre R.Cuccaro G.Coppa M.Colli N.Chiodo A.Castrillo D.del Campo M.Brunet J.Bojkovski G.Beltramino S.A.Bell G.Beges F.Sanna A.Merlone D.Smorgon F.Sparasci R.Strnad M.Voldán R.J.Underwood G.Mana proceedings SalterCR2017 528 ARMMS RF & Microwave Society Conference, 13-14 Nov, 2017, Wyboston, Bedfordshire 2017 11 13 14IND02: PlanarCal: Microwave measurements for planar circuits and components measurement, state-of-the-art of measurements, 0.1 THz to 1.1 THz frequency range, rectangular metallic waveguides, on-wafer planar circuits, bult material characterisations, Terahertz Gap http://eprints.whiterose.ac.uk/125335/ EMPIR 2014: Industry ARMMS Wyboston, Bedfordshire, UK ARMMS RF & Microwave Society Conference 13-11-2017 to 14-11-2017 30 NA http://eprints.whiterose.ac.uk/125335/ M J Salter R GClarke N MRidler article CapogniDS2017_2 Applied Radiation and Isotopes 2017 11 129 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities 135-141 Surface contamination, Method of measurement, Uncertainty of measurement http://www.sciencedirect.com/science/article/pii/S0969804317303913?via%3Dihub EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.08.018 NA M.Capogni P.De Felice D.Stanga article UlmKECCSHFB2017 450 Analytical & Bioanalytical Chemistry 2017 10 28 409 29 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 6907-6923 Fourier transforminfrared spectroscopy, Hierarchical cluster analysis (HCA), Principal componentsanalysis (PCA), Leishmania, DNA, Multivariate differentiation EMPIR 2015: Health Springer 30 1618-2642 10.1007/s00216-017-0655-5 NA A.Hornemann D.Sinning S.Cortes L.Campino P.Emmer K.Kuhls G.Ulm M.Frohme B.Beckhoff article CalonicoMLCT2017_2 367 Metrologia 2017 10 54 6 15SIB05: OFTEN: Optical frequency transfer - a European network 805-809 optical fiber, optical frequency transfer EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa8a41 NA A.Tampellini C.Clivati F.Levi A.Mura D.Calonico article LestremauLKvBMBCBRYAB2017 Biomass and Bioenergy 2017 10 105 ENG54: Biogas: Metrology for biogas 127-135 BiogasCompositionImpuritiesVesselsSampling EnG http://www.sciencedirect.com/science/article/pii/S0961953417302118 EMRP A169: Call 2013 Energy II Elsevier BV 30 10.1016/j.biombioe.2017.06.025 NA F.Lestremau J.Li I.Krom A.M.H.van der Veen B.Brewer A.Murugan S.Bartlett L.Culleton O.Büker L.Rosell H.Yaghooby K.Arrhenius J.Beranek article DeboliMCS2017 Meteorological Applications 2017 9 15 ENV58: MeteoMet2: Metrology for essential climate variables weather station; positioning; agriculture; calibration; uncertainty; Metrology for Meteorology http://onlinelibrary.wiley.com/doi/10.1002/met.1685/epdf EMRP A169: Call 2013 Environment II Wiley-Blackwell 30 1350-4827 10.1002/met.1685 NA R.Deboli A.Merlone A.Calvo F.Sanna proceedings CakirS2017 598 2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE 2017 9 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 1-5 Calibration, Comparison, Loop Antenna, Network Analyser, Three Antenna http://rfmw.cmi.cz/documents/papers/Sen_EMCEurope2017_OA.pdf EMPIR 2015: Research Potential IEEE Angers, France 2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE 04-09-2017 to 07-09-2017 30 978-1-5386-0689-6 2325-0364 10.1109/EMCEurope.2017.8094694 NA O.Şen S.Çakır article AgustoniFHCMMA2017 2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 2017 9 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids 19-24 Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measurement standards SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/AMPS.2017.8078324 NA M.Agustoni S.Fricke E.Houtzager H.Çaycı A.Mortara E.Mohns B.Ayhan proceedings ClarksonCHRS2017 2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 2017 9 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics Network topology, Topology, Substations, Estimation, Current measurement, voltage measurement, Load flow SEG EMRP A169: Call 2013 Energy II IEEE Liverpool, United Kingdom Applied Measurements for Power Systems 20-09-2017 to 22-09-2017 30 978-1-5386-0343-7 2475-2304 10.1109/AMPS.2017.8078349 NA P.Clarkson S.Chretien Q.Hong I.Rohouma M.Segovia article RotellaCMMVIDLNRSN2017 Spectrochimica Acta Part B: Atomic Spectroscopy 2017 9 135 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 22-28 Combined >XRR-GIXRF, Depth profiling, thin films, TCO EMRP A169: Call 2013 Energy II Elsevier BV 30 0584-8547 10.1016/j.sab.2017.06.011 NA H.Rotella B.Caby Y.Ménesguen Y.Mazel A.Valla D.Ingerle B.Detlefs M.-C.Lépy A.Novikova G.Rodriguez C.Streli E.Nolot article ChoiGIBFBGRPH2017 International Journal of Thermophysics 2017 8 29 38 10 SIB64: METefnet: Metrology for moisture in materials Effect of ambient humidity, Moisture content, Timber wood,Transportation, Wood handling EMRP A169: Call 2012 SI Broader scope (II) Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-017-2292-9 NA B.I.Choi D.A.E.Gelil N.Ismail G.Beltramino V.Fernicola M.W.Ben Ayoub E.Georgin M.Rudolfová Z.Palkova M.Heinonen article DegiovanniAPRLVTGBCVG2017 334 Nature Physics 2017 8 14 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 4 Protective Measurements, Weak Measurements https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf; EMPIR 2014: Industry Springer Nature 30 1745-2473, 1745-2481 10.1038/nphys4223 NA F.Piacentini A.Avella E.Rebufello R.Lussana F.Villa A.Tosi M.Gramegna G.Brida E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article KiriakopoulosLCMXGP2017 Radiation Protection Dosimetry 2017 8 10 178 3 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 276-287 detector response, cosmic radiation, spectroscopy, time series EMRP A169: Call 2013 Environment II Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncx107 NA EKiriakopoulos FLEONTARIS ACLOUVAS AMaltezos SXANTHOS JGuilhot CPotiriadis article NeuVSMSRGCPK2017 581 Scientific Reports 2017 8 7 1 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 7224 Magnetic straz field, Magnetic force microscopy, multi-layered probe, Hall sensor. https://www.nature.com/articles/s41598-017-07327-0 EMPIR 2015: SI Broader Scope Springer Nature 30 2045-2322 10.1038/s41598-017-07327-0 NA V.Panchal H.Corte-León B.Gribkov L.A.Rodriguez E.Snoeck A.Manzin E.Simonetto S.Vock V.Neu O.Kazakova article CapogniDS2017 Applied Radiation and Isotopes 2017 8 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities Efficiency transfer method, Calibration, Surface contamination measurement EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.08.009 NA M.Capogni P.De Felice D.Stanga article GuardamagnaLINCRCS2017 Powder Technology 2017 8 318 2017 IND61: Metrosion: Metrology to enable high temperature erosion testing 95-109 Computed tomography, Particle shape, Particle size, Particle velocity, Shadow imaging, Sphericity http://findit.dtu.dk/en/catalog/2363396961
http://www.sciencedirect.com/science/article/pii/S0032591017304412 EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0032-5910 10.1016/j.powtec.2017.05.042 NA C.Guardamagna L.Lorenzoni J.Illemann U.Neuschaefer-Rube S.Clausen C.Rothleitner F.Cernuschi E.Skinner article StrohMHSSCSLT2017 Applied Radiation and Isotopes 2017 8 126 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 296-299 210Pb, 210Po, Metallurgy, Industry, Gamma-ray spectrometry, Naturally occurring radionuclides EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2016.12.048 NA H.Stroh G.Marissens M.Hult S.Schreurs W.Schroeyers T.Croymans I.V.Schreurs G.Lutter F.Tzika article BoudotdYTCBA2017 New Journal of Physics 2017 7 25 19 7 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 073028 Counterpropagating light waves, saturation spectroscopy, dark resonances, diode-lasers; d-1 line, d1 line, d2 line EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing 30 1367-2630 10.1088/1367-2630/aa7258 NA R.Boudot E.de Clercq V.Yudin A.Taichenachev G.Coget D.Brazhnikov M.Abdel Hafiz article AntonovSMKCK2017 583 Scientific Reports 2017 7 24 7 1 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 6295 domain wall, magnetoresistance, permalloy https://www.nature.com/articles/s41598-017-06292-y.pdf EMPIR 2015: SI Broader Scope Springer Nature 30 2045-2322 10.1038/s41598-017-06292-y NA H.Corte-León P.Krzysteczko A.Manzin H.W.Schumacher V.Antonov O.Kazakova article HenriksenCST2017 404 Physical Review A 2017 7 24 96 1 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 013847 laser stabilisation, atom-cavity dynamics EMPIR 2015: SI Broader Scope American Physical Society (APS)

1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States

30 2469-9926, 2469-9934 10.1103/PhysRevA.96.013847 NA https://arxiv.org/pdf/1704.08245.pdf S. A.Schäffer B. T. R.Christensen M. R.Henriksen J. W.Thomsen proceedings AcakCS2017 201 2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC) 2017 7 13 2017 2017 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 124-126 CDN, Conducted Immunity, EMC, Loop Impedance, Support http://rfmw.cmi.cz/documents/papers/Sen_APEMC2017_OA.pdf EMPIR 2015: Research Potential IEEE Seoul 2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC) 20-06-2017 to 23-06-2017 30 10.1109/APEMC.2017.7975442 NA O.Şen S.Çakır S.Acak proceedings CamisardPLACWQCS2017 445 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fiber, optical frequency transfer https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf https://www.eftf.org/previous-meetings/ EMPIR 2015: SI Broader Scope IEEE Besançon, France 2017 European Frequency and Time Forum & International Frequency Control Symposium 10-07-2017 to 13-07-2017 30 10.1109/FCS.2017.8088897 NA E.Cantin N.Quintin F.Wiotte C.Chardonnet A.Amy-Klein O.Lopez P.E.Pottie G.Santarelli E.Camisard article SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017 477 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fibre, network, clock, time, dissemination, service https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE 30 10.1109/FCS.2017.8089004 NA P.Krehlik L.Śliwczyński J.Dostal J.Radil V.Smotlacha R.Velc J.Vojtech M.Campanella D.Calonico C.Clivati F.Levi O.Číp S.Rerucha R.Holzwarth M.Lessing F.Camargo B.Desruelle J.Lautier-Gaud E.L.English J.Kronjäger P.Whibberley P.E.Pottie R.Tavares P.Tuckey F.John M.Snajder J.Stefl P.Nogaś R.Urbaniak A.Binczewski W.Bogacki K.Turza G.Grosche H.Schnatz E.Camisard N.Quintin J.Diaz T.Garcia E.Ros A.Galardini A.Seeds Z.Yang A.Amy-Klein article GarciaToranoVPMCP2017 Applied Radiation and Isotopes 2017 7 125 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 196-202 Alpha spectrometry, 226Ra, Decay data, Alpha-particle emission probabilities EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.04.029 NA E.García-Toraño R.Van Ammel S.Pommé M.Marouli T.Crespo S.Pierre article ClarksonGDC2017 Numerical Algebra, Control and Optimization 2017 7 7 3 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics 289-299 Networks, Power grids SEG EMRP A169: Call 2013 Energy II American Institute of Mathematical Sciences (AIMS) 30 2155-3289 10.3934/naco.2017019 NA P.Clarkson C.Guyeux S.Darses S.Chretien article MasowskiLCCBAPMNNlLKBKMZCPBT2017 402 Astronomy & Astrophysics 2017 7 603 15SIB03: OC18: Optical clocks with 1E-18 uncertainty A48 high angular resolution instrumentation, interferometers EMPIR 2015: SI Broader Scope EDP Sciences 30 0004-6361, 1432-0746 10.1051/0004-6361/201730615 NA P.Krehlik L.Buczek J.Kołodziej M.Lipiński Ł.Śliwczyński J.Nawrocki P.Nogaś A.Marecki E.Pazderski P.Ablewski M.Bober R.Ciuryło A.Cygan D.Lisak P.Masłowski P.Morzyński M.Zawada R. M.Campbell J.Pieczerak A.Binczewski K.Turza article FrazerESJCS2017 Tribology International 2017 7 111 ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems 184-191 gears, lubrication, profile errors, EHL http://www.sciencedirect.com/science/article/pii/S0301679X17300944?via%3Dihub EMRP A169: Call 2013 Energy II Elsevier BV 30 0301-679X 10.1016/j.triboint.2017.02.034 NA R.Frazer H.P.Evans K.J.Sharif H.U.Jamali A.Clarke B.Shaw article ParkCL2017 311 Scientific Reports 2017 6 27 7 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 1-8 Ququarts, Quantum state tomography https://www.nature.com/articles/s41598-017-04444-8 EMPIR 2014: Industry Springer Nature 30 2045-2322 10.1038/s41598-017-04444-8 NA H.J.Lee S.K.Choi H.S.Park article HughesCLLK2017_2 Proc. SPIE 2017 6 26 10332 IND53: Large Volume: Large volume metrology in industry 1033202 Interferometry, large volume metrology, sensors, distance measurement, calibration, traceability EMRP A169: Call 2012 Metrology for Industry (II) SPIE 30 10.1117/12.2273644 NA B.Hughes M. A.Campbell A. J.Lewis G. M.Lazzarini N.Kay article KazakovaKCMMI2017 899 IEEE Transactions on Magnetics 2017 6 22 53 11 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 1-5 Angular magnetoresistance (MR), cylindrical nanowires, domain-wall (DW) pinning, magnetic force microscopy (MFM) https://pure.royalholloway.ac.uk/portal/en/publications/angular-magnetoresistance-of-nanowires-with-alternating-cobalt-and-nickel-segments(95f3afd6-6bb1-4548-843d-66a03bd12b0d).html EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9464, 1941-0069 10.1109/TMAG.2017.2718623 NA H.Mohammed H.Corte-León Y. P.Ivanov J. A.Moreno O.Kazakova J.Kosel article MasowskiCZDBCAMWBL2017 387 Journal of Quantitative Spectroscopy and Radiative Transfer 2017 6 11 201 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 156-160 Transition frequency, Absolute frequency measurement, Optical atomic clock, Oxygen B band, Cavity ring-down spectroscopy EMPIR 2015: SI Broader Scope Elsevier BV 30 0022-4073 10.1016/j.jqsrt.2017.07.010 NA https://arxiv.org/pdf/1705.06639.pdf K.Bielska S.Wójtewicz P.Morzyński P.Ablewski A.Cygan M.Bober J.Domysławska M.Zawada R.Ciuryło P.Masłowski D.Lisak article CrottiGMZ2017 IEEE Transactions on Power Delivery 2017 6 32 3 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1645-1652 Boundary element analysis, finite-element analysis, numerical simulation, voltage divider, voltage measurement SEG EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 0885-8977, 1937-4208 10.1109/TPWRD.2015.2498705 NA G.Crotti D.Giordano M.Modarres M.Zucca article PescettoLGC2017 IEEE Transactions on Instrumentation and Measurement 2017 6 66 6 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1108-1116 Frequency measurement, Cutoff frequency, Voltage measurement, Phase measurement, Transfer functions, Calibration, Impedance EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2017.2661658 NA P.Pescetto M.Luiso D.Giordano G.Crotti article XuCJSCPVHSC2017 574 Optics Letters 2017 6 42 11 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 2239 temperature, silicon on insulator, microspectrometer https://digital.csic.es/handle/10261/164048 EMPIR 2014: Industry The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.42.002239 NA A.Herrero-Bermello A.V.Velasco H.Podmore P.Cheben J.H.Schmid S.Janz M.L.Calvo D.XXu A.Scott P.Corredera article CallegaroDO2017 IEEE Transactions on Instrumentation and Measurement 2017 6 66 6 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1496-1502 Bridge circuits, electromagnetic devices,impedance measurement, precision measurements EMRP A169: Call 2012 SI Broader scope (II) Institute of Electrical and Electronics Engineers (IEEE)

445 Hoes Lane Piscataway NJ 08855-1331

30 0018-9456, 1557-9662 10.1109/TIM.2016.2637458 NA LucaCallegaro VincenzoD'Elia MassimoOrtolano article DavisCWL2017 IEEE Transactions on Instrumentation and Measurement 2017 6 66 6 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1176-1183 Phasor measurement unit (PMU), power quality (PQ), power system harmonics, power system management, smart grids SEG EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2017.2660019 NA P.N.Davis A.E.Christensen P.S.Wright T.Lippert article FrigoRDHC2017 2017 IEEE Manchester PowerTech 2017 6 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality Phasor Measurement Unit (PMU), PMU calibrator, distribution networks, IEEE C37.118 http://ieeexplore.ieee.org/document/7981109/ EMRP A169: Call 2013 Energy II IEEE 30 10.1109/PTC.2017.7981109 NA G.Frigo G.Rietveld E.Dierikx D.Hoogenboom D.Colangelo article ManderEBCB2017 Metrologia 2017 5 26 54 3 ENV58: MeteoMet2: Metrology for essential climate variables S63-S73 humidty, meteorology, sensor drift http://iopscience.iop.org/article/10.1088/1681-7575/aa6dd0/meta;jsessionid=69E0689027FB9B75F14F77239651C49F.ip-10-40-1-105 EMRP A169: Call 2013 Environment II IOP Publishing

Bristol

30 0026-1394, 1681-7575 10.1088/1681-7575/aa6dd0 NA NMander CEngland S LBeardmore P ACarroll S ABell article ClivatiLIDCSDCBI2017 140 Atomic Physics (physics.atom-ph) 2017 5 18 15SIB05: OFTEN: Optical frequency transfer - a European network molecular frequencies EMPIR 2015: SI Broader Scope 30 10.1038/s41598-017-12891-6 NA G.Insero S.Borri D.Calonico P.Cancio Pastor C.Clivati D.D’Ambrosio P.De Natale M.Inguscio F.Levi G.Santambrogio proceedings BurgerTMC2017 851 Proc. SPIE 2017 5 17 10683 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 1068336 Finite element modelling, modal distribution, specialty fibres http://arxiv.org/abs/1807.10811 EMPIR 2014: Industry Strasbourg Fiber Lasers and Glass Photonics: Materials through Applications 22-04-2018 to 26-04-2018 30 10.1117/12.2307372 NA N.Castagna J.Morel L.Testa S.Burger article CowburnMCSFWK2017 251 AIP Advances 2017 5 7 5 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 056715 We present new studies of the characteristics and detection ability of nanoscale sensors based on domain wall nucleation within perpendicularly magnetised ultrathin CoFeB/Pt films. A combination of MFM imaging and anomalous Hall effect transport measurements were used to verify and characterise the behaviour of fabricated devices. After initial characterisation, the influence of magnetic nanoparticles on device behaviour was studied using individual iron oxide (FeOx) particles mounted on modified atomic force microscopy probes. We demonstrate the successful detection of particles ranging in diameter between 2.8 μm and 100 nm. In the case of the 2.8 μm particle, we have mapped the signal amplitude produced at a variety of distances from the sensor. We find that the particle’s influence may be detected at separations up to 700 nm. Furthermore, we demonstrate a method for resolving the location of a particle with respect to the centre of the device, providing a lateral sensing ability. EMPIR 2015: SI Broader Scope AIP Publishing 30 2158-3226 10.1063/1.4975357 NA J.Wells A.Fernández Scarioni H.W.Schumacher D.Cox R.Mansell R.Cowburn O.Kazakova article SantarelliLLCCMWKKCSNRQDLBRGGAWGALLPG2017 138 Metrologia 2017 5 54 3 15SIB05: OFTEN: Optical frequency transfer - a European network 348-354 optical fiber frequency transfer, atomic fountain clocks, international fountain, clock comparison http://iopscience.iop.org/article/10.1088/1681-7575/aa65fe EMPIR 2015: SI Broader Scope IOP Publishing

Bristol

30 0026-1394, 1681-7575 10.1088/1681-7575/aa65fe NA JGuena SWeyers MAbgrall CGrebing VGerginov PRosenbusch SBize BLipphardt HDenker NQuintin S M FRaupach DNicolodi FStefani NChiodo SKoke AKuhl FWiotte FMeynadier ECamisard CChardonnet YLe Coq MLours GSantarelli AAmy-Klein RLe Targat OLopez P EPottie GGrosche article CaldersODN2017 Agricultural and Forest Meteorology 2017 5 237-238 ENV53: MetEOC2: Metrology for earth observation and climate 143-149 Plant area index, Sensor comparison, Levelling, Hemispherical photography. EMRP A169: Call 2013 Environment II Elsevier BV

New York, USA

30 0168-1923 10.1016/j.agrformet.2017.02.004 NA KimCalders NiallOrigo MathiasDisney JoanneNightingale article CaldersBADNMOB2017 IEEE Transactions on Geoscience and Remote Sensing 2017 5 55 5 ENV53: MetEOC2: Metrology for earth observation and climate 2716-2724 Data interoperability, radiometric calibration, RIEGL VZ-400, terrestrial light detection and ranging (LiDAR). EMRP A169: Call 2013 Environment II Institute of Electrical and Electronics Engineers (IEEE)

New York, USA

30 0196-2892, 1558-0644 10.1109/TGRS.2017.2652721 NA KimCalders AndrewBurt JohnArmston Mathias I.Disney JoanneNightingale JasmineMuir NiallOrigo BenjaminBrede article JehlBKCVSHLBKC2017 369 IEEE Electron Device Letters 2017 4 38 4 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 414-417 Quantum dots, Quantum effect semiconductor devices, Quantization, Current control https://arxiv.org/abs/1612.09547 http://www.e-si-amp.eu/outputs/ EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0741-3106, 1558-0563 10.1109/LED.2017.2670680 NA P.Clapera J.Klochan R.Lavieville S.Barraud L.Hutin M.Sanquer M.Vinet A.Cinins G.Barinovs V.Kashcheyevs X.Jehl article CarmeleRBSSSGSSvTHKR2017 234 Nature Communications 2017 4 8 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 14870 Quantum dots, Quantum optics, Single photons and quantum effects . https://www.nature.com/articles/ncomms14870 EMPIR 2014: Industry Springer Nature 30 2041-1723 10.1038/ncomms14870 NA T.Heindel A.Thoma M.von Helversen M.Schmidt A.Schlehahn M.Gschrey P.Schnauber J. -H.Schulze A.Strittmatter J.Beyer S.Rodt A.Carmele A.Knorr S.Reitzenstein article VelascoVSVCSP2017 573 Optics Letters 2017 3 31 42 7 waveguides and applications 1440 Fourier transform, silicon on insulator, compressive sensing https://digital.csic.es/handle/10261/163371 EMPIR 2014: Industry The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.42.001440 NA H.Podmore A.Scott P.Cheben A.V.Velasco A.V.Velasco J.H.Schmid M.Vachon article GotzingerVPCLSMIBS2017 Metrologia 2017 3 21 54 2 EXL02: SIQUTE: Single-photon sources for quantum technologies 218-223 single photon sources, single photon metrology, silicon vacancy center, low optical flux detector, photon on demand EMRP A169: Call 2012 Open excellence call IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa5ba2 NA S.Götzinger A.Vaigu G.Porrovecchio X.L.Chu S.Lindner M.Smid A.Manninen E.Ikonen C.Becher V.Sandoghdar article deClercqGYCAB2017 Journal of Applied Physics 2017 3 14 121 10 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 104903 Frequency standard, laser, resonances, stability, shift EMRP A169: Call 2012 Metrology for Industry (II) AIP Publishing 30 0021-8979, 1089-7550 10.1063/1.4977955 NA E.de Clercq S.Guérandel P.Yun G.Coget M.Abdel Hafiz R.Boudot article SchumacherACMMCKMSCK2017 252 AIP Advances 2017 3 7 5 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 056808 AbstractDevices comprised of CoFeB nanostructures with perpendicular magnetic anisotropy and non-magnetic Ta channel were operated in thermal lateral spin valve (LSV) mode and studied by magnetotransport measurements and magnetic scanning gate microscopy (SGM). Due to the short spin diffusion length of Ta, the spin diffusion signal was suppressed, allowing the study of the contribution from the anomalous Nernst (ANE) and anomalous Hall effects (AHE). The magnetotransport measurements identified the switching fields of the CoFeB nanostructures and demonstrated a combination of AHE and ANE when the devices were operated in thermally-driven spin-injection mode. Modified scanning probe microscopy probes were fabricated by placing a NdFeB magnetic bead (MB) on the apex of a commercial Si probe. The dipole magnetic field distribution around the MB was characterized by using differential phase contrast technique and direct measurement of the switching field induced by the bead in the CoFeB nanodevices. Using SGM we demonstrate the influence of localized magnetic field on the CoFeB nanostructures near the non-magnetic channel. This approach provides a promising route towards the study of thermal and spin diffusion effects using local magnetic fields. EMPIR 2015: SI Broader Scope AIP Publishing 30 2158-3226 10.1063/1.4977891 NA H.Corte-León A.F.Scarioni R.Mansell P.Krzysteczko D.Cox D.McGrouther S.McVitie R.Cowburn H.W.Schumacher V.Antonov O.Kazakova article MartinezVerduLAKOGKJFSPSC2017 Applied Optics 2017 3 56 7 IND52: XD Reflect: Multidimensional reflectometry for industry 1996 BSDF, BRDF, BTDF, Densitometers, reflectometers, Reflection. EMRP A169: Call 2012 Metrology for Industry (II) The Optical Society

2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States

30 0003-6935, 1539-4522 10.1364/AO.56.001996 NA F. M.Martínez-Verdú F. B.Leloup J.Audenaert S.Källberg G.Obein G.Ged A.Koo P.Jaanson A.Ferrero C.Strothkämper E.Perales A.Schirmacher J.Campos article ZoladekLemanczykBNKCS2017 Solar Energy Materials and Solar Cells 2017 3 161 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 388-396 Slot-die coating; Polymer Solar Cells (PSC); Large-area; Ambient stability; PCDTBT:PC70BM; Light beam induced current (LBIC); Photoluminescence (PL) EMRP A169: Call 2013 Energy II Elsevier BV

New York, United States

30 0927-0248 10.1016/j.solmat.2016.12.019 NA AlinaZoladek-Lemanczyk FrancescoBausi EdwardNew Dimitar I.Kutsarov Fernando A.Castro S. Ravi P.Silva article MarsteinPHRCDS2017 IEEE Journal of Photovoltaics 2017 3 7 2 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 479-485 Passivation, Hafnium compounds, Silicon, Annealing, Temperature, silicon, atomic layer deposition, carrier lifetime, crystal growth from melt, dielectric thin films, electrical resistivity, hafnium compounds, passivation, refractive index, Si, surface passivation, hafnium oxide thin film, atomic layer deposition, resistivity, low temperature anneal, precleaning, precursors, deposition temperature, postannealing temperature, minority carrier lifetime, surface recombination velocity, Czochralski n-type wafers, light soaking, refractive index, solar cells, HfO2, silicon surface passivation, Atomic layer deposition (ALD), defect density, fixed charges, hafnium oxide (HfO2), photovoltaic cells EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE)

445 Hoes Lane, Piscataway, NJ 08855-1331, USA

30 2156-3381, 2156-3403 10.1109/JPHOTOV.2016.2645399 NA Erik StensrudMarstein Alexander PyymakiPerros HaugHalvard PaivikkiRepo XuemeiCheng MarisaDi Sabatino HeleSavin article BettsBHCKG2017 IEEE Journal of Photovoltaics 2017 3 7 2 ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification 486-492 Compressed sensing (CS), light beam induced current (LBIC)measurements, solar cells, spatial characterization EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE)

Piscataway, New Jersey

30 2156-3381, 2156-3403 10.1109/JPHOTOV.2016.2646900 NA TRBetts MBliss SRGHall MCashmore GKoutsourakis RGottschalg article YacootRPCHCL2017 Measurement Science and Technology 2017 2 16 28 4 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 045204 optical metrology, DBR laser diode, frequency stabilization, laser interferometry, dimensional metrology, iodine stabilization, displacement measurement EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing

Temple Circus,Temple Way, Bristol, BS1 6BE, United Kingdom

30 0957-0233, 1361-6501 10.1088/1361-6501/aa5ab9 NA AndrewYacoot SimonRerucha Tuan MPham MartinCizek VaclavHucl OndřejČíp JosefLazar article ClarksonCSC2017 Signal, Image and Video Processing 2017 2 16 2017 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics 1-8 Convex relaxation, Nuclear Norm, Hankel approximation, Prony’s method, Exponential sums, Signal approximation, Missing Data SEG EMRP A169: Call 2013 Energy II Springer Nature 30 1863-1703, 1863-1711 10.1007/s11760-017-1062-2 NA PaulClarkson StéphaneChrétien Basad AlSarray GuillaumeCottez article StagniRPNNMMLFBBAACZC2017 134 Scientific Reports 2017 2 7 15SIB05: OFTEN: Optical frequency transfer - a European network 40992 VLBI experiment, remote atomic clock https://www.nature.com/articles/srep40992 EMPIR 2015: SI Broader Scope Springer Nature

New York

30 2045-2322 10.1038/srep40992 NA C.Clivati R.Ambrosini T.Artz A.Bertarini C.Bortolotti M.Frittelli F.Levi A.Mura G.Maccaferri M.Nanni M.Negusini F.Perini M.Roma M.Stagni M.Zucco D.Calonico article deClercqGBFMCTY2017 Physical Review Applied 2017 1 25 7 1 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications Frequency standards, atomic clock, ramsey fringes, dark-line, vapor, laser spectroscopy EMRP A169: Call 2012 Metrology for Industry (II) American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.7.014018 NA E.de Clercq S.Guérandel R.Boudot B.François S.Micalizio C.E.Calosso F.Tricot P.Yun article JelinekKC2017 Measurement Science and Technology 2017 1 24 28 3 SIB61: CRYSTAL: Crysalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology 034005 density functional theory, atomic force microscopy, uncertainty EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing

Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom

30 0957-0233, 1361-6501 10.1088/1361-6501/aa5075 NA PavelJelínek PetrKlapetek Anna CharvátováCampbell article DucourtieuxCBAFF2017 Measurement Science and Technology 2017 1 23 28 3 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 034007 atomic force microscope, metrology, virtual instrument, measurement uncertainty, Monte Carlo method, Morris design, Sobol indices EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing

Temple Circus, Temple, Bristol, BS1 6BE, United Kingdom

30 0957-0233, 1361-6501 10.1088/1361-6501/28/3/034007 NA SebastienDucourtieux PaulCeria YounesBoukellal AlexandreAllard NicolasFischer NicolasFeltin article CalonicoLCCMBRTP2017 111 Metrologia 2017 1 20 54 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 102-112 optical lattice clock, SI second, frequency metrology EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa4e62 NA MPizzocaro PThoumany BRauf FBregolin GMilani CClivati G.A.Costanzo FLevi DCalonico article CobbenNN2017 IEEE Transactions on Power Systems 2017 1 32 1 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics 694-704 Chaos expansion, probabilistic power flow, SEG EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 0885-8950, 1558-0679 10.1109/TPWRS.2016.2558622 NA J.F.G.Cobben P.H.Nguyen F.Ni article Physical Chemistry Chemical Physics 2017 1 Issue 6, 2017 Issue 6, 2017 IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale Phys. Chem. Chem. Phys., 2017,19, 4243-4250 high-temperature ferroelectric domain morphology PbTiO3 ultrathin films http://pubs.rsc.org/en/Content/ArticleLanding/2017/CP/C6CP08157F#!divAbstract EMRP A169: Call 2012 Metrology for Industry (II) RSC

London

30 Issue 6, 2017 10.1039/C6CP08157F 1 59,80 No, EURAMET is never allowed to make the publication publicly available. Dorothy M.Duffy Anna V.Kimmel Jacob B. J.Chapman, article MihailescuBKC2017 497 Metrologia 2017 1 54 1A 14RPT04: Absorb: Absorbed dose in water and air 06004-06004 cavity chamber, air kerma reference, comparison EMPIR 2014: Research Potential IOP Publishing 30 0026-1394, 1681-7575 10.1088/0026-1394/54/1a/06004 NA CKessler DBurns L CMihailescu SChiriotti article BecherLSGCSPHLRK2017_2 Optica 2017 1 4 1 EXL02: SIQUTE: Single-photon sources for quantum technologies 71 Metrology, Radiometry, Sources, Photon statistics EMRP A169: Call 2012 Open excellence call The Optical Society 30 2334-2536 10.1364/OPTICA.4.000071 NA C.Becher S.Lindner V.Sandoghdar S.Götzinger X.L.Chu M.Smid G.Porrovecchio H.Hofer M.López B.Rodiek S.Kück article VavassoriAMCNCPK2017 255 IEEE Transactions on Magnetics 2017 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 1-1 Probes, Magnetic domains, Magnetic resonance imaging, Magnetic field measurement, Perpendicular magnetic anisotropy, Saturation magnetization https://pure.royalholloway.ac.uk/portal/en/publications/vshaped-domain-wall-probes-for-calibrated-magnetic-force-microscopy(9c2d50b1-9b1a-4aae-9b39-ca8c1864daf3).html EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9464, 1941-0069 10.1109/TMAG.2017.2694324 NA R.Puttock H.Corte-León V.Neu D.Cox A.Manzin V.Antonov P.Vavassori O.Kazakova proceedings PokatilovPNETLICDYNPVTC2017_2 1152 18th International Congress of Metrology 2017 15RPT04: TracePQM: Traceability routes for electrical power quality measurements 8 power quality; metrology; power; traceability; measurement EMPIR 2015: Research Potential EDP Sciences Paris 18th International Congress of Metrology 19-09-2017 to 21-09-2017 30 10.1051/metrology/201704001 NA V.Nováková Zachovalová A.Yovcheva J.Diaz de Aguilar R.Caballero Santos D.Ilić J.Lončarević B.Trinchera K.Ellingsberg H.Ndilimabaka A.Philominraj A.Pokatilov O.Power B.Voljc V.Tarasso H.Çaycı article CoxD2017 430 Computational and Mathematical Methods in Medicine 2017 2017 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy 1-9 Uncertainty, Calibration,Quantitative Imaging https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5660760/ EMPIR 2015: Health Hindawi Limited 30 1748-670X, 1748-6718 10.1155/2017/9830386 NA M.D’Arienzo M.Cox article MillerCL2017_2 310 IEEE 2017 14IND10: MET5G: Metrology for 5G communications Link Assessment, Millimeter Wave, MIMO, 5G Communications http://arxiv.org/abs/1809.07805 EMPIR 2014: Industry IEEE 30 10.1109/ARFTG.2017.8000845 NA T. H.Loh D.Cheadle P.Miller article CoppolaCGMBGOS2017 931 IMEKO 2017 14IND03: Strength-ABLE: Metrology for length-scale engineering of materials Hardness, indentation modulus, macro-scale. EMPIR 2014: Industry Imeko

.

30 NA https://www.imeko.org/publications/tc5-2017/IMEKO-TC5-2017-001.pdf G.Coppola R.Cagliefo G.Genta G.Maizza G.Barbato A.Germak C.Origlia A. Schiavi proceedings PavanelloCLS2017 966 Proceedings of EUPVSEC 2017 2017 5CO.7.3 16ENG02: PV-Enerate: Advanced PV energy rating Bifacial, c-Si, n-Type, Energy Performance, PV Modules https://www.eupvsec-proceedings.com/proceedings?paper=43071 EMPIR 2016: Energy Amsterdam, the Netherlands 33rd European Photovoltaic Solar Energy Conference and Exhibition 25-09-2017 to 29-09-2017 30 3-936338-47-7 10.4229/EUPVSEC20172017-5CO.7.3 NA D.Pavanello A.Casado J.Lopez-Garcia T.Sample article BojkovskiOKMSISFZSSJoHHPV2017 1095 18th International Congress of Metrology 2017 2017 18th 15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement 4/06006 Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html EMPIR 2015: Research Potential EDP Sciences 30 10.1051/metrology/201706006 NA N.Hodzic S.Čohodarević N.Jandrić R.Strnad D.Sestan D.Zvizdić V.Fernicola D.Smorgon L.Iacomini S.Simic D.Mac Lochlainn N.Karaboce S.Oguz Aytekin J.Bojkovski D.Hudoklin O.Petrušova T.Vukičević article GarciaToranoMCPWM2016 Applied Radiation and Isotopes 2016 12 27 126 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 289-292 Artificial neural network; ANN; Exemption limit; NORM; Monte Carlo; Gamma-spectrometry; PENELOPE; PENNUC https://www.sciencedirect.com/science/article/pii/S0969804316304985 EMRP A169: Call 2012 Metrology for Industry (II) Elsevier 30 10.1016/j.apradiso.2016.12.044 NA E.García-Toraño M.Mejuto T.Crespo V.Peyres H.Wiedner F.J.Maringer article CuenatCMSHKSWK2016 249 AIP Advances 2016 12 22 7 5 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 055904 Abstract: Using electrical and thermal measurements, we present a method for characterising the anomalous Nernst effect (ANE) within nanoscale devices implementing perpendicular anisotropy materials. Perpendicularly magnetised CoFeB/Pt nanowires were fabricated in close proximity to Pt heater elements on an electrically insulating substrate. The voltages induced within the magnetic material as a result of the ANE were recorded for increasing heater powers, and for both out-of-plane saturated states of the device. Scanning thermal probe microscopy was used to map the temperature distribution within the region of the device at a range of heater powers. By analysing the results from each thermography measurement, it was possible to correlate the temperature gradient induced at the magnetic nanowire against the anomalous Nernst voltage measured within the device. For the particular material, geometry and substrate used, a Nernst coefficient value KN = 2.3 μV(K.T)-1 was calculated. This combination of measurements can provide a powerful tool to characterise the ANE within a number of nanoscale systems, a necessary task for the future implementation and optimisation of the effect within spin-caloritronic devices. EMPIR 2015: SI Broader Scope AIP Publishing 30 2158-3226 10.1063/1.4973196 NA J.Wells E.Selezneva P.Krzysteczko X.Hu H.W.Schumacher R.Mansell R.Cowburn A.Cuenat O.Kazakova article IEEE Electromagnetic Compatibility Magazine 2016 12 15 5 3 IND60: EMC: Improved EMC test methods in industrial environments 45-51 Alternative, Current Probe, CDN, Conducted Immunity, EMC, High Current, Industry, Mains Impedance http://ieeexplore.ieee.org/document/7764249/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

30 2162-2272 10.1109/MEMC.0.7764249 1 59 No, EURAMET is never allowed to make the publication publicly available. SoydanÇakır OsmanŞen SavaşACAK MarcoAZPURUA FerranSILVA MustafaÇetintaş proceedings Resumen de la Contribuciones. XI Reunión Nacional de Óptica 2016 12 10 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 168 size pigment, sparkle, visual detection - EMRP A169: Call 2012 Metrology for Industry (II) Universidad de Salamanca

Salamanca

Salamanca, Spain XI Reunión Nacional de Óptica 01-09-2015 to 03-09-2015 112 978-84-608-4609-3 - 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. O.Gómez E.Perales E.Chorro V.Viqueira F.M.Martínez-Verdú A.Ferrero J.Campos proceedings Resúmenes de las contribuciones. XI Reunión Nacional de Óptica 2016 12 10 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 171 goniochromatism, AUDI2000 color difference formula, STRESS - EMRP A169: Call 2012 Metrology for Industry (II) Universidad de Salamanca

Salamnaca

Salamanca XI Reunión Nacional de Óptica 01/09/2015 to 03/09/2015 112 978-84-608-4609-3 - 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.Perales E.Chorro O.Gómez V.Viqueira F.M.Martínez-Verdú L.Gómez-Robledo M.Melgosa proceedings Resúmenes de las contribuciones. XI Reunión Nacional de Óptica 2016 12 10 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 170 lighting booths, goniochromatism, color rendering - EMRP A169: Call 2012 Metrology for Industry (II) Universidad de Salamanca

Salamanca

Salamanca, Spain XI Reunión Nacional de Óptica 01-09-2015 to 03-09-2015 112 978-84-608-4609-3 - 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.Perales E.Chorro V.Viqueira F.M.Martínez-Verdú article Solar Energy Materials and Solar Cells 2016 12 2 161 November 2016 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 89-95 Printed solar cells, Organic photovoltaics, Defects, Transient photovoltage, Transient photocurrent, Characterisation http://www.sciencedirect.com/science/article/pii/S0927024816304974 EMRP A169: Call 2013 Energy II Elsevier

Amsterdam

30 0927-0248 10.1016/j.solmat.2016.11.029 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SWood DO’Connor C WJones J DClaverley J CBlakesley CGiusca F ACastro article VandervorstDPFLTHVBTFCS2016 158 The Journal of Physical Chemistry C 2016 12 120 49 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 28074-28082 ToF-SIMS, GCIB, Ar cluster, quantification, depth profiling, organics, solar cells, polymer, fullerenes EMPIR 2014: Industry American Chemical Society (ACS)

CAS, a division of the American Chemical Society 2540 Olentangy River Road Columbus Ohio 43210 United States

30 1932-7447, 1932-7455 10.1021/acs.jpcc.6b09911 NA S.Surana T.Conard C.Fleischmann J.G.Tait J.P.Bastos E.Voroshazi R.Havelund M.Turbiez P.Louette A.Felten C.Poleunis A.Delcorte W.Vandervorst article ElsterCW2016 Color Research & Application 2016 12 Na Na IND52: XD Reflect: Multidimensional reflectometry for industry 1-7 Measurement uncertainty; CIELAB color coordinates; Monte Carlo method EMRP A169: Call 2012 Metrology for Industry (II) Wiley-Blackwell 30 0361-2317 10.1002/col.22109 NA ClemensElster JoaquinCampos Acosta GerdWübbeler article FallaniICCLFCFDLC2016 136 Physical Review Letters 2016 11 23 117 22 15SIB05: OFTEN: Optical frequency transfer - a European network synthetic dimensions, spin-orbit coupling, optical clock transition https://arxiv.org/abs/1609.04800 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.117.220401 NA L. F.Livi G.Cappellini M.Diem L.Franchi C.Clivati M.Frittelli F.Levi D.Calonico J.Catani M.Inguscio L.Fallani article RietveldZOBCL2016 Metrologia 2016 11 21 53 6 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 1384-1394 uncertainty analysis, electrical measurement, solid-state lighting EMRP A169: Call 2013 Energy II IOP Publishing

Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom

30 0026-1394, 1681-7575 10.1088/0026-1394/53/6/1384 NA GRietveld DZhao FOverney J-PBraun AChristensen TLippert article YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016 321 The Journal of Physical Chemistry C 2016 10 27 120 42 14IND12: Innanopart: Metrology for innovative nanoparticles 24070-24079 VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory https://spiral.imperial.ac.uk/handle/10044/1/40824 EMPIR 2014: Industry American Chemical Society (ACS)

CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States

30 1932-7447, 1932-7455 10.1021/acs.jpcc.6b06713 NA N.A.Belsey D.Cant D.J.H.Cant C.Minelli J.R.Araujo B.Bock P.Brüner D.G.Castner G.Ceccone J.D.P.Counsell P.M.Dietrich M.H.Engelhard S.Fearn C.E.Galhardo H.Kalbe J.W.Kim L.Lartundo-Rojas H.S.Luftman T.S.Nunney J.Pseiner E.F.Smith V.Spampinato J.M.Sturm A.G.Thomas J.P.W.Treacy L.Veith M.Wagstaffe H.Wang M.Wang Y.C.Wang W.Werner L.Yang article VilllaLCDBGLAPTZG2016 231 Physical Review Letters 2016 10 20 117 17 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 170402 Weak Measurements, Optical tests of quantum theory, Weak Values https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.170402 EMPIR 2014: Industry American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.117.170402 NA F.Piacentini A.Avella M. P.Levi M.Gramegna G.Brida I. P.Degiovanni E.Cohen R.Lussana F.Villa A.Tosi F.Zappa M.Genovese article EngertRGPMKHSCLSKMP2016 International Journal of Thermophysics 2016 10 20 37 12 15SIB02: InK 2: Implementing the new kelvin 2 Temperature, Thermodynamic Methods, Kelvin https://pure.royalholloway.ac.uk/portal/en/publications/new-evaluation-of-t-t2000-from-002k-to-1k-by-independent-thermodynamic-methods(dc393a64-8d59-4083-9435-f2bd70eea8ed).html EMPIR 2015: SI Broader Scope Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-016-2123-4 NA JEngert A.Kirste A.Shibahara A.Casey L.V.Levitin J.Saunders O.Hahtela A.Kemppinen E.Mykkänen M.Prunnila D.Gunnarsson L.Roschier M.Meschke J.Pekola article BrabanCEFBLPHTPMPVWvTNP2016 Measurement Science and Technology 2016 10 27 11 ENV55: MetNH3: Metrology for ammonia in ambient air 115012 ammonia in ambient air, traceability, reference gas standards, optical transfer standard, validation and testing infrastructure EMRP A169: Call 2013 Environment II IOP Publishing

Bristol, United Kingdom

30 0957-0233, 1361-6501 10.1088/0957-0233/27/11/115012 NA Christine FBraban NathanCassidy VolkerEbert ValerioFerracci DavidBalslev-Harder DaianaLeuenberger CélinePascale TuomasHieta CarloTiebe JariPeltola Nicholas AMartin StefanPersijn OlaviVaittinen KlausWirtz Jannekevan Wijk Marsailidh MTwigg BernhardNiederhauser AndreaPogány article Journal of Environmental Radioactivity 2016 10 162-163 - ENV57: MetroERM: Metrology for radiological early warning networks in Europe 358-370 Nuclear chronometry; Uncertainty; CTBT; Non-proliferation; Geochronology; Nuclear medicine; Dosimetry http://www.sciencedirect.com/science/article/pii/S0265931X16302144 EMRP A169: Call 2013 Environment II Elsevier

Amsterdam

30 0265-931X 10.1016/j.jenvrad.2016.06.013 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.sciencedirect.com/science/article/pii/S0265931X16302144 SPommé SMCollins AHarms SMJerome article RietveldvJJNCAC2016 2016 17th International Conference on Harmonics and Quality of Power (ICHQP) 2016 10 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics Phasor measurement units, Power Quality, Power system harmonics, Impedance measurement, Harmonic impedance, Load modeling SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/ICHQP.2016.7783374 NA G.Rietveld H.E.van den Brom A.Jongepier W.Jin F.Ni V.Cuk M.Acanski J.F.G.Cobben article CobbenNNT2016 2016 International Conference on Probabilistic Methods Applied to Power Systems (PMAPS) 2016 10 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics ordinary least squares, Uncertainty quantification, Probabilistic power flow, Polynomial chaos expansion, Truncated Normal distribution SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/PMAPS.2016.7764175 NA J. F. G.Cobben P. H.Nguyen F.Ni J.Tang article ReganCBABS2016 Journal of Physics: Conference Series 2016 10 763 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 012010 gamma detector, airborne radiation monitoring, radiation monitoring EMRP A169: Call 2013 Environment II IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/763/1/012010 NA P HRegan S MCollins SBeeke PAitken-Smith S JBell RShearman article BecherCLB2016 Optics Express 2016 10 24 21 EXL02: SIQUTE: Single-photon sources for quantum technologies 23992 Nonlinear wave mixing, Photon statistics EMRP A169: Call 2012 Open excellence call The Optical Society 30 1094-4087 10.1364/OE.24.023992 NA C.Becher C.Chunnilall A.Lenhard M.Bock article DeLeoCVSMTFB2016 161 Nanoscale Research Letters 2016 9 29 11 436 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 1-10 Porous silicon, Optical lithography, 4-Nitrobenzenediazonium, grafting, Improved chemical resistance https://nanoscalereslett.springeropen.com/articles/10.1186/s11671-016-1654-8 EMPIR 2014: Industry SpringerOpen

London

30 1556-276X 10.1186/s11671-016-1654-8 NA M.V.Tiddia G.Mula E.Sechi A.Vacca E.Cara N.De Leo M.Fretto L.Boarino proceedings 2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 2016 9 28 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics 13-18 Smart meter; state estimation; distribution system; measurement uncertainty; data aggregation SEG http://ieeexplore.ieee.org/document/7602805/ EMRP A169: Call 2013 Energy II IEEE

Piscataway, NJ 08855-1331 USA

Aachen, Germany 2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 28-30 September 2016 30 978-1-5090-2373-8 10.1109/AMPS.2016.7602805 1 No, EURAMET is never allowed to make the publication publicly available. F.Ni P.H.Nguyen J.F.G.Cobben H.E.van den Brom D.Zhao article XanthosLCA2016 Radiation Protection Dosimetry 2016 9 24 175 1 ENV57: MetroERM: Metrology for radiological early warning networks in Europe radon in soil, radon migration in soil, long term measurements EMRP A169: Call 2013 Environment II Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncw277 NA S.Xanthos F.Leontaris A.Clouvas D.Alifragis article RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016 Atmospheric Chemistry and Physics 2016 9 23 16 18 ENV51: MeTra: Traceability for mercury measurements 11915-11935 Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1680-7324 10.5194/acp-16-11915-2016 NA R.Ramachandran X.Fu H.Zhang X.B.Feng D.Wip V.Obolkin N.Mashyanov F.Sena B.M.Gawlik L.M.Neves K.A.Read J.Kotnik M.Horvat H.Skov O.Magand H.Angot A.Dommergue P.E.Garcia M.D.CDiéguez C.Barbante W.Cairns J.Brito H.D.M.JBarbosa F.Morais P.Artaxo I.Wängberg J.Munthe L.Martin C.Labuschagne E.G.Brunke A.Weigelt R.Ebinghaus M.Landis V.Mannarino S.Cinnirella F.Carbone F.D'Amore M.Bencardino N.Pirrone F.Sprovieri D.Cossa J.Knoery NicolasMarusczak M.Nerentorp P.Fisicaro article Review of Scientific Instruments 2016 9 19 87 2016 SIB60: Surveying: Metrology for long distance surveying 093107 Mirrors, frequency combs, silver, Fabry-Perot interfermoters, piezoelectric transducers http://scitation.aip.org/content/aip/journal/rsi/87/9/10.1063/1.4962681 EMRP A169: Call 2012 SI Broader scope (II) AIP Publishing

Melville

30 10.1063/1.4962681 1 59 No, EURAMET is never allowed to make the publication publicly available. R.Šmíd A.Hänsel L.Pravdova O.Cip N.Bhattacharya article LegreKKJGCBMMS2016 751 Physical Review A 2016 9 15 94 3 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 030302(R) Quantum Cryptography, Quantum Communication https://link.aps.org/accepted/10.1103/PhysRevA.94.030302 EMPIR 2014: Industry American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.94.030302 NA V.Makarov J.P.Bourgoin P.Chaiwongkhot M.Gagné T.Jennewein S.Kaiser R.Kashyap M.Legré C.Minshull S.Sajeed article Journal of the Optical Society of America A 2016 9 14 33 10 IND52: XD Reflect: Multidimensional reflectometry for industry 1978-1988 BSDF, BRDF, BTDF, Diffraction, Radiometry, Scattering measurements. https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-33-10-1978 EMRP A169: Call 2012 Metrology for Industry (II) OSA

Washington, DC, USA

30 1084-7529 (print), 1520-8532 (online) 10.1364/JOSAA.33.001978 1 No, EURAMET is never allowed to make the publication publicly available. AFerrero BBernad JCampos EPerales J LVelázquez F MMartínez-Verdú article BennettBHWRBBRC2016 The Journal of Chemical Physics 2016 9 14 145 10 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 104301 DNA, cross sections, proton impact, tetrahydrofuran, pyrimidine, trimethylphosphate, Bragg peak EMRP A169: Call 2011 SI Broader Scope AIP Publishing

2 Huntington Quadrangle, Ste 1 No 1 Suite 300, Melville 11747-4502 ,United States

30 0021-9606, 1089-7690 10.1063/1.4962171 NA DanielBennett Marion U.Bug GerhardHilgers MingjieWang BenediktRudek Woon YongBaek TiciaBuhr HansRabus ChristopheChampion proceedings International Symposium and Exhibition on Electromagnetic Compatibility Proceedings 2016 9 10 1 1 IND60: EMC: Improved EMC test methods in industrial environments 1-100 Electromagnetic Compatibility (EMC), IEC 61000- 4-6, EN ISO 17025, EN ISO 17043, proficiency testing, round robin, test device, conducted immunity, common mode, disturbance signal, Coupling-Decoupling Network (CDN), inter-laboratory comparison, Equipment under Test (EUT), Auxiliary Equipment (AE). http://www.emceurope.org/2016/index.html EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, USA

Wroclaw / Poland EMC Europe 2016 Wroclaw International Symposium and Exhibition on Electromagnetic Compatibility 05-09-2016 to 09-09-2016 30 978-1-4799-6615-8 2158-110X 1 59 No, EURAMET is never allowed to make the publication publicly available. EmrahTas SoydanCakir MustafaCetintas PavelHamouz ThomasIsbring MihaKokalj DanielLopez UrbanLundgren DwiMandaris BorutPinter MartinPoriz MarcPous FrédéricPythoud OsmanSen FerranSilva MarekSvaboda BraiseTrincaz DongshengZhao proceedings 2016 International Symposium on Electromagnetic Compatibility - EMC Europe 2016 9 9 2016 2016 IND60: EMC: Improved EMC test methods in industrial environments 251-256 Alternative Test Methods, EMC, GTEM cell, Anechoich chamber, radiated immunity http://ieeexplore.ieee.org/document/7739215/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

Wroclaw 2016 International Symposium on Electromagnetic Compatibility - EMC Europe 05-09-2016 to 09-09-2016 30 978-1-5090-1416-3 2325-0364 10.1109/EMCEurope.2016.7739215 1 59 No, EURAMET is never allowed to make the publication publicly available. MohammedSALHI SoydanÇakır MehmetÇınar BahadırTEKTAŞ MustafaÇetintaş proceedings 2016 International Symposium on Electromagnetic Compatibility - EMC Europe 2016 9 9 2016 2016 IND60: EMC: Improved EMC test methods in industrial environments 695-700 Alternative test methods, EMC, GSM, Radiation pattern, Radiated immunity http://ieeexplore.ieee.org/document/7739219/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

Wroclaw 2016 International Symposium on Electromagnetic Compatibility - EMC Europe 05-09-2016 to 09-09-2016 30 978-1-5090-1416-3 2325-0364 10.1109/EMCEurope.2016.7739219 1 59 No, EURAMET is never allowed to make the publication publicly available. MohammedSALHI OsmanŞen SoydanÇakır MustafaÇetintaş proceedings 2016 International Symposium on Electromagnetic Compatibility - EMC Europe 2016 9 9 2016 2016 IND60: EMC: Improved EMC test methods in industrial environments 799-804 Surface Wire, Alternative, Emission, On-Site, Radiated http://ieeexplore.ieee.org/document/7739212/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

Wroclaw 2016 International Symposium on Electromagnetic Compatibility - EMC Europe 05-09-2016 to 09-09-2016 30 - 2325-0364 10.1109/EMCEurope.2016.7739212 1 59 No, EURAMET is never allowed to make the publication publicly available. BahadırTEKTAŞ OsmanŞen SoydanÇakır MustafaÇetintaş proceedings Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance 2016 9 7 N/A N/A IND52: XD Reflect: Multidimensional reflectometry for industry 295-302 BRDF, effect coatings, colour http://div2.cie.co.at/?i_ca_id=985 EMRP A169: Call 2012 Metrology for Industry (II) CIE

Vienna, Austria

Prague Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance 09-06-2016 to 09-07-2016 30 978-3-902842-59-6 1 No, EURAMET is never allowed to make the publication publicly available. CIE x043:2016 AFerrero BBernad JCampos EPerales F MMartínez-Verdú MSmid GPorrovecchio CStrothkämper proceedings Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance 2016 9 7 N/A N/A IND52: XD Reflect: Multidimensional reflectometry for industry 51-59 BRDF, gonio-spectrophotometry, effect coatings, diffraction http://div2.cie.co.at/?i_ca_id=985 EMRP A169: Call 2012 Metrology for Industry (II) CIE

Vienna, Austria

Prague Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance 09-06-2016 to 09-07-2016 30 978-3-902842-59-6 1 No, EURAMET is never allowed to make the publication publicly available. CIE x043:2016 AFerrero BBernad JCampos EPerales F MMartínez-Verdú article Optics Express 2016 8 31 24 18 EXL02: SIQUTE: Single-photon sources for quantum technologies 20904 Stefan sent an email 14/09/2016 asking to change the status to: No, EURAMET is never allowed to make the publication publicly available. and he sent also a copyright statement ti be included here, now it is updated Laser beam shaping, Microcavity devices, Quantum-well, -wire and -dot devices, Nanophotonics and photonic crystals. https://www.osapublishing.org/oe/abstract.cfm?uri=oe-24-18-20904 EMRP A169: Call 2012 Open excellence call The Optical Society

Washington, DC

30 1094-4087 10.1364/OE.24.020904 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. N.Gregersen D. P. S.McCutcheon J.Mørk J.Gérard J.Claudon article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, traceability; Calibration; Free-field over a reflecting plane (hemi-anechoic rooms)I-INCE Classification of Subjects Number(s): 72.4, 71.9 and 73.2 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. P.Cellard H.Andersson S.Brezas V.Wittstock article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, dissemination, directivity, correction, substitution I-INCE Classification of Subjects Number(s): 72.4 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S.Brezas P.Cellard H.Andersson C.Guglielmone C.Kirbas proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 16 SIB51: GraphOhm: Quantum resistance metrology based on graphene Chemical vapor deposition (CVD), Hexame-thyldisilazane (HMDS), Copper (Cu), CVD graphene (CVDG) http://ieeexplore.ieee.org/document/7540498/ EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540498 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Thodkar C.Schönenberger M.Calame F.Lüönd F.Overney B.Jeanneret proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 11 SIB51: GraphOhm: Quantum resistance metrology based on graphene Graphene, materials science and technology, measurement standards, metrology, quantum Hall effect devices http://ieeexplore.ieee.org/document/7540650/ EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540650 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Brun-Pcard R.Ribeiro-Palau F.Lafont D.Kazazis A.Michon F.Cheynis O.Couturaud C.Consejo B.Jouault W.Poirier F.Schopfer proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 11 SIB51: GraphOhm: Quantum resistance metrology based on graphene Graphene, quantum Hall effect, precision measurement, resistance metrology, cryogenic current comparator http://ieeexplore.ieee.org/document/7540495/?denied EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540495 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. D.H.Chae W.S.Kim A.Satrapinski S.Novikov proceedings Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on 2016 8 11 1 1 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 Delta-sigma modulation, Josephson junctions, measurement, metrology, voltage measurement. http://ieeexplore.ieee.org/document/7540457/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

New York

Ottawa Conference on Precision Electromagnetic Measurements 2016, (CPEM 2016) 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540457 1 59 No, EURAMET is never allowed to make the publication publicly available. http://ieeexplore.ieee.org/document/7540457/ JIreland ACryer JMWilliams EHoutzager RHornecker HEvan den Brom article Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on 2016 8 11 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measure-ment standards, High-Voltage techniques SEG http://ieeexplore.ieee.org/document/7540488/ EMRP A169: Call 2013 Energy II IEEE 30 978-1-4673-9134-4 10.1109/CPEM.2016.7540488 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. EHoutzager EMohns SFricke BAyhan HCayci article Applied Optics 2016 8 9 55 23 IND52: XD Reflect: Multidimensional reflectometry for industry 6458-6463 sparkle, detection, perception psychology, psycophysics, industrial inspection, https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-23-6458 EMRP A169: Call 2012 Metrology for Industry (II) Optical Society of America (OSA)

Washington, DC

30 2155-3165 10.1364/AO.55.006458 1 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. OGómez EPerales EChorro VViqueira FMMartínez-Verdú article DGaO Proceedings 2016 2016 8 8 117 EXL02: SIQUTE: Single-photon sources for quantum technologies 117_p32 single-photon source, nitrogen-vacancy in nanodiamonds, calibration, single-photon detectors, antibunching http://www.dgao-proceedings.de/download/117/117_p32.pdf http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6 EMRP A169: Call 2012 Open excellence call Deutschen Gesellschaft für angewandte Optik e.V.

Erlangen

30 1614-8436 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6 B.Rodiek M.López H.Hofer X.-L.Chu S.Götzinger S.Kück article SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016 135 Nature Communications 2016 8 7 15SIB05: OFTEN: Optical frequency transfer - a European network 12443 Clock network; geodesy; https://www.nature.com/articles/ncomms12443 EMPIR 2015: SI Broader Scope Springer Nature

New York

30 2041-1723 10.1038/ncomms12443 NA C.Lisdat G.Grosche N.Quintin C.Shi S.M.F.Raupach C.Grebing D.Nicolodi F.Stefani A.Al-Masoudi S.Doerscher S.Haefner J.-L.Robyr N.Chiodo S.Bilicki E.Bookjans A.Koczwara S.Koke A.Kuhl F.Wiotte F.Meynadier E.Camisard M.Abgrall M.Lours T.Legero H.Schnatz U.Sterr H.Denker C.Chardonnet Y.Le Coq G.Santarelli A.Amy-Klein R.Le Targat J.Lodewyck OLopez P.-E.Pottie article Ultrasound in Medicine and Biology 2016 8 42 8 HLT03: DUTy: Dosimetry for ultrasound therapy 2033–2038 High intensity focused ultrasound dosimetry, Quality assurance, Thermal mapping, Acoustic field evaluation, Magnetic resonance–guided focused ultrasound surgery, Infrared camera http://www.sciencedirect.com/science/article/pii/S0301562916300047 EMRP A169: Call 2011 Metrology for Health Elsevier 30 0301-5629 10.1016/j.ultrasmedbio.2016.03.028 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-9-1 PMiloro JCivale IRivens AShaw article Energy Procedia 2016 8 92 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 341-346 Black silicon, Nano-texturing, Surface passivation, Lifetime, Atomic layer deposition, Al2O3, Solar cells http://www.sciencedirect.com/science/article/pii/S1876610216305203 EMRP A169: Call 2013 Energy II Elsevier 30 10.1016/j.egypro.2016.07.093 1 No, EURAMET is never allowed to make the publication publicly available. E.Calle P.Ortega G. .von Gastrow IMartin H.Savin R.Alcubilla article Journal of Analytical Atomic Spectrometry 2016 7 26 31 09/2016 HLT05: Metallomics: Metrology for metalloproteins 1904-1912 selenoproteins, isotope dilution, ICP-MS, http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00122J#!divAbstract EMRP A169: Call 2011 Metrology for Health The Royal Society of Chemistry

Cambridge, United Kingdom

30 10.1039/c6ja00122j 1 No, EURAMET is never allowed to make the publication publicly available. M. Esteladel Castillo Busto CarolineOster SusanaCuello-Nunez Christian L.Deitrich AndreaRaab AnnaKonopka Wolf D.Lehmann HeidiGoenaga-Infante PaolaFisicaro article WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016 Atmospheric Chemistry and Physics Discussions 2016 7 20 ENV51: MeTra: Traceability for mercury measurements 1-33 mercury, wet deposition flux, EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1680-7375 10.5194/acp-2016-517 NA I.Wängberg C.Walters M.Vardè P.Spandow V.Somerset F.Sena M.R.Islas V.Obolkin J.Munthe T.Mkololo N.Mashyanov L.Martin O.Magand C.Labuschagne J.Kotnik M.Horvat K.Hansson U.Hageström B.Gawlik P.E.Garcia X.Fu X.B.Feng R.Ebinghaus A.Dommergue M.D.C.Diéguez S.Comero W.Cairns F.Arcega-Cabrera E.G.Brunke C.Barbante H.Angot F.D'Amore M.Bencardino N.Pirrone F.Sprovieri A.Weigelt X.Yang P.Fisicaro proceedings Proceedings CPEM 2016 2016 7 18 54 12 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 Analog to Digital Converter, Josephson Voltage Standards, Sampling, Waveform http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=4126881 EMRP A169: Call 2012 SI Broader scope (II) Unknown

Unknown

Ottawa Conference on Precision Elexctromagnetic Measurements 10-07-2016 to 15-07-2016 30 0018-9456 0018-9456 10.1109/TIM.2007.891162 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Blaise JeanneretBlaise Jeanneret Fr´ed´eric OverneyFr´ed´eric Overney Christophe ScherlyChristophe Scherly G´erald SchallerG´erald Schaller article LuisoLGGCM2016 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 2016 7 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality Frequency measurement, Calibration, Voltage measurement, Harmonic analysis, Capacitors, Power measurement, Distortion measurement SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/CPEM.2016.7540709 NA M.Luiso C.Landi D.Giordano D.Gallo G.Crotti M.Modarres article vandenBromRWCB2016 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 2016 7 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality instrument transformers, smart grids, metrology, phasor measurement units, synchrophasors, power quality,impedance measurement SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/CPEM.2016.7540462 NA H. E.van den Brom G.Rietveld P. S.Wright G.Crotti J. P.Braun article Measurement 2016 7 89 July 2016 SIB10: NOTED: Novel techniques for traceable temperature dissemination 109-113 metrology, non-uniqueness, temperature, ITS-90, HTSPRTs http://www.sciencedirect.com/science/article/pii/S0263224116300719 EMRP A169: Call 2011 SI Broader Scope Elsevier

London

30 0263-2241 10.1016/j.measurement.2016.04.014 1 59 No, EURAMET is never allowed to make the publication publicly available. http://ac.els-cdn.com/S0263224116300719/1-s2.0-S0263224116300719-main.pdf?_tid=2e04a3c4-0578-11e6-a14a-00000aacb361&acdnat=1460992620_67e1c65fd6ee11dc21807238014d192f GCoppa AMerlone article GiuscaSPZCMSK2016 Carbon 2016 7 103 SIB51: GraphOhm: Quantum resistance metrology based on graphene 273-280 Chemical vapour deposition, Graphene, Kelvin probe force microscopy, Raman spectroscopy EMRP A169: Call 2012 SI Broader scope (II) Elsevier

New York, USA

30 10.1016/j.carbon.2016.03.018 NA Christina E.Giusca SteveSpencer VishalPanchal AmaiaZurutuza AlbaCenteno ChristosMelios S. Ravi P.Silva OlgaKazakova article LarsonDCWLP2016 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 2016 7 2016 - ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1-2 Sea measurements, Current measurement, Power quality, Global Positioning System, Integrated circuit modeling, Smart grids, Instruments SEG EMRP A169: Call 2013 Energy II IEEE

New Jersey

30 - 10.1109/CPEM.2016.7540458 NA B.Larson P. N.Davis A. E.Christensen P. S.Wright T.Lippert P.Patel article Measurement Science and Technology 2016 6 23 27 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 085002 thermoelectric generator, metrology, accuracy, precision, reproducibility http://iopscience.iop.org/article/10.1088/0957-0233/27/8/085002/meta http://pubs.rsc.org/en/content/ebook/978-1-78262-323-6#!divbookcontent EMRP A169: Call 2013 Energy II Institute of Physics

London

30 10.1088/0957-0233/27/8/085002 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-6-23 http://pubs.rsc.org/en/content/chapter/bk9781782623236-00109/978-1-78262-323-6#!divabstract PDIAZ-CHAO AMUNIZ-PINIELLA ESELEZNEVA ACuenat article New Journal of Physics 2016 6 20 18 June 2016 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 065008 quantum key distribution, device-independent quantum key distribution, quantum communication, security analysis, information leakage, Trojan horse attacks http://iopscience.iop.org/journal/1367-2630 EMPIR 2014: Industry IOP Publishing

Bristol (UK)

30 1367-2630 10.1088/1367-2630/18/6/065008 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Tamaki M.Curty M.Lucamarini proceedings CalmonDESJ2016 QNDE16 2016 6 16 ENG57: VITCEA: Validated inspection techniques for composites in energy applications Hybrid ray-FDTD simulation ultrasonic inspection CFRP http://aip.scitation.org/doi/pdf/10.1063/1.4974660 EMRP A169: Call 2013 Energy II Atlanta QNDE16 17-07-2016 to 22-07-2016 30 10.1063/1.4974660 NA P.Calmon N.Dominguez R.Ecault D.Ségur K.Jezzine article Metrologia 2016 6 14 53 4 IND52: XD Reflect: Multidimensional reflectometry for industry 1024-1030 BRDF, goniospectrophotometry, interlaboratory comparison http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1024/meta EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing

Bristol, UK

30 Online ISSN: 1681-7575, Print ISSN: 0026-1394 10.1088/0026-1394/53/4/1024 1 No, EURAMET is never allowed to make the publication publicly available. AFerrero JCampos BBernad APons M LHernanz F MMartínez-Verdú AHöpe article Optica 2016 6 13 3 6 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 647 (300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings; (310.1860) Deposition and fabrication; (140.4780) Optical resonators. EMRP A169: Call 2012 Open excellence call Optical Society of America

Washington, D.C. 20036-1012 USA

30 2334-2536 10.1364/OPTICA.3.000647 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. G DCOLE WZHANG B JBJORK DFOLLMAN PHEU CDEUTSCH LSONDERHOUSE JROBINSON CFRANZ AALEXANDROVSKI MNOTCUTT O HHECKL JYE MASPELMEYER article Comptes Rendus Physique 2016 6 1 16 5 SIB55: ITOC: International timescales with optical clocks 461 - 470 Atomic fountain clocks, Optical lattice clocks, Optical frequency combs, Stability of natural constants, Timekeeping http://www.sciencedirect.com/science/article/pii/S1631070515000614 EMRP A169: Call 2012 SI Broader scope (II) Elsevier

Amsterdam

30 n/a 10.1016/j.crhy.2015.03.010 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-6-1 MAbgrall BChupin LDe Sarlo JGuena PLaurent YLe Coq RLe Targat JLodewyck MLours PRosenbuch G. D.Rovera SBize article International Journal of RF and Microwave Computer-Aided Engineering 2016 5 31 26 4 IND60: EMC: Improved EMC test methods in industrial environments 294-303 Alternative; close distance; emission; on-site; radiated http://onlinelibrary.wiley.com/doi/10.1002/mmce.20977/epdf EMRP A169: Call 2012 Metrology for Industry (II) Wiley Online Library

USA

30 - 10.1002/mmce.20977 1 59 No, EURAMET is never allowed to make the publication publicly available. OsmanŞen BahadırTEKTAŞ SoydanÇakır MustafaÇetintaş proceedings 2016 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC) 2016 5 21 01 - IND60: EMC: Improved EMC test methods in industrial environments 709-711 Radiated Emission, REI 02, Support, MIL-STD- 46IF http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7522843&newsearch=true&queryText=RE102%20support EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

Shenzhen 2016 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC) 17-05-2016 to 21-05-2016 30 - - 10.1109/APEMC.2016.7522843 1 59 No, EURAMET is never allowed to make the publication publicly available. OsmanŞen SoydanÇakır MuratCELEP MehmetÇınar RamizHAMID MustafaÇetintaş article REVIEW OF SCIENTIFIC INSTRUMENTS 2016 5 20 87 051904 (2016) SIB58: Angles: Angle metrology 1-12 Calibration, Mirrors, X-ray optics, Apertures, Comparators http://aip.scitation.org/doi/10.1063/1.4950729 EMRP A169: Call 2012 SI Broader scope (II) American Institute of Physics

Melville, NY 11747-4300 USA

30 Print: 0034-6748, Online: 1089-7623 10.1063/1.4950729 1 59 No, EURAMET is never allowed to make the publication publicly available. VVYashchuk NAArtemiev GCenters AChaubard RDGeckeler ILacey HMarth WRMcKinney TNoll FSiewert MWinter TZeschke article Advanced Functional Materials 2016 5 11 Volume 26 Issue 26 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems Pages 4704–4711 Spintronics, Perpendicular magnetic anisotropy, CoFeB thin films http://onlinelibrary.wiley.com/doi/10.1002/adfm.201505138/abstract EMRP A169: Call 2012 Open excellence call 30 10.1002/adfm.201505138 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.Vemulkar R.Mansell A.Fernández-Pacheco R.P.Cowburn article Applied Optic 2016 5 1 55 13 IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products 3555-3565 Microscopy; Optical transfer functions; Focus Variation Microscopy https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-13-3555 EMRP A169: Call 2012 Metrology for Industry (II) The Optical society of America

Washington, USA

30 1559-128X (print); 2155-3165 (online) 10.1364/AO.55.003555 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 N INIKOLAEV JPETZING J MCOUPLAND article CoutinR2016 Revue française de métrologie 2016 4 25 41 SIB57: NEWSTAR: New primary standards and traceability for radiometry 11-20 Caractérisation et validation d’un nouveau radiomètre cryogénique au LNE-LCM EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences 30 1772-1792, 1776-3215 10.1051/rfm/2016002 NA J.-M.Coutin B.Rougié article Philosophical Transactions of the Royal Society A 2016 3 28 374 2064 SIB01: InK: Implementing the new kelvin 20150046 Boltzmann constant, thermodynamic temperature, International Temperature Scale http://rsta.royalsocietypublishing.org/content/374/2064/20150046 EMRP A169: Call 2011 SI Broader Scope The Royal Society Publishing

London

30 1364-503X 10.1098/rsta.2015.0046 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-3-28 http://rsta.royalsocietypublishing.org/content/374/2064/20150046 R MGavioso DMadonna Ripa P P MSteur CGaiser TZandt BFellmuth Mde Podesta RUnderwood GSutton LPitre FSparasci LRisegari LGianfrani ACastrillo GMachin article Philosophical Transactions of the Royal Society A 2016 3 28 374 2064 SIB01: InK: Implementing the new kelvin 20150044 high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics http://rsta.royalsocietypublishing.org/content/374/2064/20150044 EMRP A169: Call 2011 SI Broader Scope The Royal Society

London

30 10.1098/rsta.2015.0044 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.RWooliams KAnhalt MBallico PBloembergen FBourson SBriaudeau JCampos M.GCox Ddel Campo WDong M.RDury VGavrilov IGrigoryeva M.LHernanz FJahan BKhlevnoy VKhromchenko D.HLowe XLu GMachin J.MMantilla M.JMartin H.CMcEvoy BRougie MSaldi S.G.RSalim NSasajima D.RTaubert A.D.WTodd RVan den Bossche article Journal of Synchrotron Radiation 2016 3 24 23 23 SIB58: Angles: Angle metrology 665-678 X-ray mirror; metrology; database; Python; statistics. http://scripts.iucr.org/cgi-bin/paper?S1600577516005014 EMRP A169: Call 2012 SI Broader scope (II) IUCr Journals

Chester CH1 2HU, England

30 1600-5775 10.1107/S1600577516005014 1 59,80 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MSanchez del Rio DBianchi DCocco MGlass MIdir JMetz LRaimondi LRebuffi RReininger XShi FSiewert SSpielmann-Jaeggi PTakacs MTomasset TTonnessen ATonnessenivo VVYashchuk article Measurement 2016 3 17 87 June 2016 IND53: Large Volume: Large volume metrology in industry 228–235 environment, calibration, metrology, air sensor, open source, data logging http://www.sciencedirect.com/science/article/pii/S0263224116001871 EMRP A169: Call 2012 Metrology for Industry (II) Elsevier

Amsterdam

30 0263-2241 10.1016/j.measurement.2016.03.023 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-3-18 A JLewis MCampbell PStavroulakis article Metrologia 2016 3 9 53 2 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 860 photothermal noise, AlGaAs, laser frequency stabilization, Fabry-Pérot cavities, gravitational waves http://iopscience.iop.org/article/10.1088/0026-1394/53/2/860/meta EMRP A169: Call 2012 Open excellence call IOP Publishing

Bristol, UK

30 0026-1394 10.1088/0026-1394/53/2/860 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. TChalermsongsak E DHall G DCole DFollman FSeifert KArai E KGustafson J RSmith MAspelmeyer R XAdhikari article PacynaHJDCBBBPHBGEPF2016 Environmental Science & Technology 2016 3 50 6 ENV51: MeTra: Traceability for mercury measurements 2767-2770 Mercury, Minamata Convention, EMRP A169: Call 2013 Environment II American Chemical Society (ACS) 30 0013-936X, 1520-5851 10.1021/acs.est.6b00573 NA J.Pacyna M.Horvat D.Jaffe C.T.Driscoll C.Chen P.Bustamante J.Blum N.Basu A.Pierce C.R.Hammerschmidt M.S.Bank M.S.Gustin D.C.Evers N.Pirrone P.Fisicaro article CapogniKDSI2016 Applied Radiation and Isotopes 2016 3 109 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities 358-362 Method of measurement, Large area reference sources, Numerical model EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2015.12.030 NA M.Capogni J.Keightley P.De Felice D.Stanga M.R.Ioan article Journal Of Clinical Microbiology 2016 2 28 54 2 HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms 392-400. Digital PCR, dPCR, Droplet, Influenza, Antimicrobial Resistance, AMR, Rare, Mutation, Trace, qPCR, Quantitative PCR, SNP, Single Nucleotide Polymorphism, H275Y, Oseltamivir, Tamiflu http://jcm.asm.org/content/54/2/392.long EMRP A169: Call 2011 Metrology for Health American Society for Microbiology

Washington DC

30 0095-1137 10.1128/JCM.02611-15 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A. S.Whale C.Bushell P.R.Grant S.Cowen I.Gutierrez-Aguirre D. M.O'Sullivan J.Zel M.Milavec C. A.Foy E.Nastouli J. A.Garson H. F.Huggett article Philosophical Transactions of the Royal Society A 2016 2 22 374 2064 SIB01: InK: Implementing the new kelvin 20150054 noise, thermometry, PLTS-2000, SQUID, primary, uncertainty http://rsta.royalsocietypublishing.org/content/374/2064/20150054 EMRP A169: Call 2011 SI Broader Scope The Royal Society Publishing

London

30 1471-2962 10.1098/rsta.2015.0054 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-22 AShibahara OHahtela JEngert Hvan der Vliet L VLevitin ACasey C PLusher JSaunders DDrung ThSchurig article Journal of the CMSC [reproduced in Quality Digest] 2016 2 18 9 1 (Spring 2016) IND53: Large Volume: Large volume metrology in industry 6pp FSI, coordinate metrology, SI, traceable http://www.qualitydigest.com/inside/cmsc-article/021816-novel-coordinate-measurement-system-based-frequency-scanning# EMRP A169: Call 2012 Metrology for Industry (II) Coordinate Metrology Society

Weatherford

30 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.qualitydigest.com/inside/cmsc-article/021816-novel-coordinate-measurement-system-based-frequency-scanning# BHughes MCampbell DVeal article SilvaPCCSC2016 IEEE Electromagnetic Compatibility Magazine 2016 2 16 4 4 IND60: EMC: Improved EMC test methods in industrial environments 58-65 Alternative, Current Probe, Conducted Emission, EMC, High Current, Industry, LISN, Mains Impedance https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7407180 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

30 2162-2264 10.1109/MEMC.2015.7407180 NA F.Silva M.Pous M.Cinar S.Çakır O.Şen M.Çetintaş article ChebenDKVNV2016 578 IEEE Photonics Technology Letters 2016 2 15 28 4 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 528-531 mid-IR, spectrometry, silicon photonics http://hdl.handle.net/10261/167745 https://dx.doi.org/10.5258/SOTON/383407 EMPIR 2014: Industry Institute of Electrical and Electronics Engineers (IEEE)

445 Hoes Lane Piscataway NJ 08855-1331 United States

30 1041-1135, 1941-0174 10.1109/LPT.2015.2496729 NA MilosNedeljkovic Aitor V.Velasco Aitor V.Velasco Ali Z.Khokhar AndreDelage PavelCheben article Appliced Physics Letters 2016 2 4 108 (2016) NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects 053303 EMRP A169: Call 2011 Metrology for New Technologies AIP Publishing 30 10.1063/1.4941227 1 59 No, EURAMET is never allowed to make the publication publicly available. G.M.Lazzerini G.M.Paternò G.Tregnago N.Treat N.Stingelin A.Yacoot F.Cacialli article MyersWardCMLGPGK2016 2D Materials 2016 2 3 1 SIB51: GraphOhm: Quantum resistance metrology based on graphene 015006 mono-, bi- and tri-layer epitaxial graphene, 6H–SiC(0001), measurements, Kelvin, N2, O2, NO2, doping effects,epitaxial graphene EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing

Bristol, United Kingdom

30 2053-1583 10.1088/2053-1583/3/1/015006 NA Rachael LMyers-Ward NathanCassidy Nicholas AMartin ArseniyLartsev Cristina EGiusca VishalPanchal D KurtGaskill OlgaKazakova article ShardCWC2016 318 Surface and Interface Analysis 2016 2 48 5 14IND12: Innanopart: Metrology for innovative nanoparticles 274-282 XPS, nanoparticle, nanoparticles, core-shell-shell, core-shell, thickness, overlayer https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4829121/ EMPIR 2014: Industry Wiley-Blackwell 30 0142-2421 10.1002/sia.5923 NA D.J.H.Cant Y.C.Wang D.G.Castner A.G.Shard article SawalNPGZRBTGSGACFEERBP2016 Accreditation and Quality Assurance 2016 1 29 21 2 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 121-129 Water Framework Directive, Interlaboratory comparison, Whole water sample, Suspended particulate matter, Polycyclic aromatic hydrocarbons, Polybrominated diphenyl ethers, Tributlyltin EMRP A169: Call 2010 Environment Springer Nature 30 0949-1775, 1432-0517 10.1007/s00769-015-1190-8 NA G.Sawal M.Nousiainen D.Pröfrock A.G.Gago T.Zuliani A.Rodríguez-Cea B.Binici M.Tunç T.Gokcen C.Swart F.Gantois E.Alasonati J.Cabillic I.Fettig H.Emteborg S.Elordui-Zapatarietxe J.Richter M.Buzoianu R.Philipp article OzgurAHYaCCY2016 Measurement Science and Technology 2016 1 20 27 3 SIB58: Angles: Angle metrology 035201 Angle metrology, Differential Fabry–Perot interferometry, small angle generators, autocollimators, Synchrotron and X-FEL optics EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing 30 0957-0233, 1361-6501 10.1088/0957-0233/27/3/035201 NA B.Özgür A.Akgöz R.Hamid T.Yandayan E.Şahin M.Çelik M.Çetintaş T.Yandyan article APPLIED PHYSICS LETTERS 2016 1 8 108 1 EXL02: SIQUTE: Single-photon sources for quantum technologies 011112-5 quantum-dot, fiber-coupling http://scitation.aip.org/content/aip/journal/apl EMRP A169: Call 2012 Open excellence call AIP Publishing LLC

Melville, NY

30 0003-6951 10.1063/1.4939264 1 59 No, EURAMET is never allowed to make the publication publicly available. D.Cadeddu J.Teissier F.Braakman N.Gregersen P.Stepanov J.M.Gérard J.Claudon R. J.Warburton M.Poggio M.Munsch article VelazquezFCPH2016 Journal of Optics 2016 1 18 2 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 1-9 goniophotometry, light-emitting diodes, Zernike polynomials, photometry EMRP A169: Call 2013 Energy II IOP Publishing

Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom

30 2040-8978, 2040-8986 10.1088/2040-8978/18/2/025605 NA J LVelazquez AFerrero JCampos APons M LHernanz article Journal of the mechanical behavior of biomedical materials 2016 1 53 January 2016 IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials 119-130 Hydrogels, Relaxation time, Strain-rate-dependence, Temperature-dependence, Young׳s modulus http://www.sciencedirect.com/science/article/pii/S1751616115002829 EMRP A169: Call 2010 Industry Elsevier

Amsterdam, Netherlands

30 1751-6161v 10.1016/j.jmbbm.2015.08.011 1 59 No, EURAMET is never allowed to make the publication publicly available. ASSchiavi RCCuccaro ATTroia article Measurement 2016 - - SIB10: NOTED: Novel techniques for traceable temperature dissemination - ITS-90, fixed points, thermal fluxes, phase transformation, computer fluid dynamics http://www.sciencedirect.com/science/article/pii/S0263224116000191 EMRP A169: Call 2011 SI Broader Scope Elsevier

London

30 02632241 10.1016/j.measurement.2015.11.044 1 59 No, EURAMET is never allowed to make the publication publicly available. P.Castro D.del Campo R.Lecuna C.García Izquierdo proceedings 2016 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality instrument voltage transformer, optimization, power quality, power system measurement, field programmable gate array (FPGA) SEG EMRP A169: Call 2013 Energy II Prague, Czech Republic XXI IMEKO World Congress “Measurement in Research and Industry” August 30 − September 4, 2015 30 978-80-01-05793-3 59 No, EURAMET is never allowed to make the publication publicly available. GCrotti DGallo DGiordano CLandi MLuiso DPicco article IEEE Transactions on Instrumentation and Measurement 2016 SIB10: NOTED: Novel techniques for traceable temperature dissemination Frequency conversion;Frequency measurement;Instruments;Microwave measurement;Resonant frequency;Standards;Uncertainty;Microwave resonance measurement;whispering gallery thermometry. EMRP A169: Call 2011 SI Broader Scope The Institute of Electrical and Electronics Engineers, Incorporated (the "IEEE")

Piscataway

30 10.1109/TIM.2015.2508258 1 59 No, EURAMET is never allowed to make the publication publicly available. S.Corbellini C.Ramella M.Pirola V.Fernicola A.Cappella article Coloration Technology 2016 131 4 IND52: XD Reflect: Multidimensional reflectometry for industry 303-309 gonio-apparent colours, sparkle, graininess, measurements http://onlinelibrary.wiley.com/doi/10.1111/cote.12157/citedby EMRP A169: Call 2012 Metrology for Industry (II) Society of Dyers and Colourists. John Wiley & Sons

New York

30 1478-4408 10.1111/cote.12157 1 59 No, EURAMET is never allowed to make the publication publicly available. E.Chorro E.Perales F.J.Burgos O.Gómez M.Vilaseca J.Pujol F.M.Martínez-Verdú proceedings CIE Proceeding 2016 IND52: XD Reflect: Multidimensional reflectometry for industry Goniofluorescence, fluorescence, photoluminescence, spectrophotometry EMRP A169: Call 2012 Metrology for Industry (II) International Comission on Illumination

Serrano 144

Manchester/UK 28th Session CIE June 28 - July 4, 2015 30 59 No, EURAMET is never allowed to make the publication publicly available. AFerrero BBernad J LVelazquez APons M LHernanz PJaanson F MMartinez-Verdu EChorro EPerales JCampos article Surface and Interface Analysis 2016 1 46 NEW01: TReND: Traceable characterisation of nanostructured devices 54-57 depth profiling, sputter yield, ion yield, matrix effect, OPV, P3HT, PCDTBT, PCBM http://onlinelibrary.wiley.com/doi/10.1002/sia.5621/abstract EMRP A169: Call 2011 Metrology for New Technologies Wiley Online Library

New Jersey NYC

30 0142-2421 10.1002/sia.5621 1 59 No option selected C.Fleischmann T.Conard R.Havelund A.Franquet C.Poleunis E.Voroshazi A.Delcorte W.Vandervorst proceedings Proceeding of the 7th Asia-Pacific International Symposium on Electromagnetic Compatibility & Signal Integrity and Technical Exhibition (APEMC 2016) 2016 1 1 IND60: EMC: Improved EMC test methods in industrial environments WE-PM-I-TC02-6 Alternative test method, ATM, conducted emission http://ieeexplore.ieee.org/document/7522905/?arnumber=7522905&tag=1 EMRP A169: Call 2012 Metrology for Industry (II) APEMC Shenzhen, China The 7th Asia-Pacific International Symposium on Electromagnetic Compatibility & Signal Integrity and Technical Exhibition (APEMC 2016) 18-05-2016 to 21-05-2016 30 978-1-4673-9494-9 10.1109/APEMC.2016.7522905 1 59 No option selected D.Zhao S.Cakir O.Sen article Proceedings of the 2016 International Symposium on EMC (EMC Europe) Wroclaw, Poland 2016 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 1-6 radiated susceptibility tests, radiated immunity test, active levelling, pre-calibration, substitution, MIL-STD, AECTP, IEC 61000-4-3, Large Equipment http://www.emceurope.org/2016/program.html EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, NJ

30 Not yet available 1 59 No, EURAMET is never allowed to make the publication publicly available. D.Mandaris S.Cakir O.Sen M.J.Lorenzo D.L.Sanz F.B.J.Leferink article Applied Physics B Lasers and Optics 2016 122 219 ENV55: MetNH3: Metrology for ammonia in ambient air Not Applicable ammonia, cavity ring-down spectroscopy, collisional broadening, cross interference, Primary Standard Gas Mixtures, gravimetry http://link.springer.com/article/10.1007/s00340-016-6486-9 EMRP A169: Call 2013 Environment II Springer

Chennai

30 Not Applicable 10.1007/s00340-016-6486-9 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. N AMartin VFerracci NCassidy J AHoffnagle techreport IlanderCBKP2016 106 JRC Technical reports 2016 JRC100968 JRC100968 14SIP07: Digital Standard: Standard for Digital Data Format for Nuclear Instrumentation 14 Nuclear metrology, International standard, Nuclear safety and security EMPIR 2014: Support for Impact Publications Office of the European Union

Brussels

30 978-92-79-57550-1 1831-9424 NA https://publications.jrc.ec.europa.eu/repository/handle/JRC100968 Tarja Ilander MarcoCapogni ChristopheBobin John Keightley JanPaepen article Applied Radiation and Isotopes 2016 112 Not Available HLT11: MetroMRT: Metrology for molecular radiotherapy 156-164 Quantitative imaging Molecular radiotherapy Gamma camera Calibration Radionuclide therapy http://ac.els-cdn.com/S0969804316300902/1-s2.0-S0969804316300902-main.pdf?_tid=0dfc2a3c-6de4-11e6-8cf3-00000aab0f02&acdnat=1472473873_beaec1e776a0c054de0ab95c6804d14c EMRP A169: Call 2011 Metrology for Health Elsevier Ltd

Netherlands, Amsterdam

30 0969-8043 10.1016/j.apradiso.2016.03.007 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-6-30 MarcoD'Arienzo MartaCazzato Maria LetiziaCozzella MauriceCox MarcoD'Andrea AldoFazio AndrewFenwick GiuseppeIaccarino LenaJohansson LidiaStrigari SaraUngania PierinoDe Felice article Physical Review A 2016 93 -- IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 023433 light-shift, vapor cell clock, POP http://journals.aps.org/pra/abstract/10.1103/PhysRevA.93.023433 EMRP A169: Call 2012 Metrology for Industry (II) APS

NY

30 2469-9926 10.1103/PhysRevA.93.023433 1 59 No, EURAMET is never allowed to make the publication publicly available. FLevi JCamparo BFrancois C ECalosso SMicalizio AGodone article Physical Review A 2016 93 9 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 063404()1-10 ac stark shift , atomic fountain, cold atoms http://journals.aps.org/pra/abstract/10.1103/PhysRevA.93.023433 EMRP A169: Call 2012 Metrology for Industry (II) APS

NY

30 2469-9926 10.1103/PhysRevA.93.063404 1 59 No, EURAMET is never allowed to make the publication publicly available. G. A.Costanzo SMicalizio AGodone JCamparo FLevi article Optics letters 2016 41 13 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 2982-2985 CPT, vapor cell,frequency stability https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-13-2982 EMRP A169: Call 2012 SI Broader scope (II) OSA

Washington

30 0146-9592 10.1364/OL.41.002982 1 59 No, EURAMET is never allowed to make the publication publicly available. https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-13-2982 M AHafiz GCoget Ede Clercq RBoudot article Journal of Chemical Thermodynamics 2016 96 1 ENG54: Biogas: Metrology for biogas 1–11 methane; helium; natural gas thermodynamic characterization; density; single-sinker densimeter; GERG-2008 equation of state EnG EMRP A169: Call 2013 Energy II Elsevier

Amsterdam

30 0021-9614 10.1016/j.jct.2015.12.006 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. R.Hernández-Gómez D.Tuma J.J.Segovia C.R.Chamorro article Journal of Chemical Thermodynamics 2016 101 1 ENG54: Biogas: Metrology for biogas 168-179 methane; helium; natural gas thermodynamic characterization; density; single-sinker densimeter; GERG-2008 equation of state EnG EMRP A169: Call 2013 Energy II Elsevier

Amsterdam

30 0021-9614 10.1016/j.jct.2016.05.024 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. R.Hernández-Gómez D.Tuma R.Villamañán C.R.Chamorro article Journal of Chemical Thermodynamics 2016 97 1 ENG54: Biogas: Metrology for biogas 137-141 speed of sound; coal mine methane; spherical resonator; GERG-2008 equation of state. EnG EMRP A169: Call 2013 Energy II Elsevier

Amsterdam

30 0021-9614 10.1016/j.jct.2016.01.020 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.J.Pérez-Sanz M.C.Martín C.R.Chamorro T.E.Fernández-Vicente J.J.Segovia inbook 2016 -- ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 109-132 Thermoelectric, solar cells, thermal conductivity http://pubs.rsc.org/en/content/ebook/978-1-78262-323-6#!divbookcontent EMRP A169: Call 2013 Energy II Royal Society of Chemistry

London

Thermoelectric Materials and Devices (Energy and Environment Series) 30 978-1-78262-323-6(print) 978-1-78262-404-2(pdf) 10.1039/9781782624042-00109 59 No, EURAMET is never allowed to make the publication publicly available. http://pubs.rsc.org/en/content/chapter/bk9781782623236-00109/978-1-78262-323-6#!divabstract ESELEZNEVA CStacey PDIAZ-CHAO AMUNIZ-PINIELLA ACuenat article 2016 IND61: Metrosion: Metrology to enable high temperature erosion testing 1-11 http://www.sciencedirect.com/science/article/pii/S009630031630755X EMRP A169: Call 2012 Metrology for Industry (II) 30 10.1016/j.amc.2016.12.021 59 No, EURAMET is never allowed to make the publication publicly available. NSSmith ATFFry LECCrocker FCCernuschi LLLorenzoni article IEEE Instrumentation & Measurement magazine 2016 18 6 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 42-46 Impedance, Bridge circuits, Impedance measurement, Standards, Current measurement, Frequency measurement, Voltage measurement http://ieeexplore.ieee.org/document/7335839/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

...

30 1094-6969 10.1109/MIM.2015.7335839 1 No, EURAMET is never allowed to make the publication publicly available. LCallegaro proceedings 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 2016 . . SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1-2 Capacitors, Frequency dependence, Standards, Impedance, Uncertainty, Bridge circuits, Capacitance http://ieeexplore.ieee.org/document/7540476/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

.

Ottawa, Canada 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 10-15 July 2016 30 978-1-4673-9134-4 978-1-4673-9134-4 10.1109/CPEM.2016.7540476 1 No, EURAMET is never allowed to make the publication publicly available. LCallegaro MSellone proceedings 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 2016 . . SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1-2 Capacitance, Capacitors, Uncertainty, Metrology, Capacitance measurement, Calibration, Linearity http://ieeexplore.ieee.org/document/7540710/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

.

Ottawa, Canada 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 10-15 July 2016 30 978-1-4673-9134-4 978-1-4673-9134-4 10.1109/CPEM.2016.7540710 1 No, EURAMET is never allowed to make the publication publicly available. FPourdanesh VD'Elia MOrtolano LCallegaro proceedings 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 2016 . . SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1-2 Bridge circuits, Impedance, Standards, Detectors, Bridges, Current measurement http://ieeexplore.ieee.org/document/7540629/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

.

Ottawa, Canada 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 10-15 July 2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540629 1 No option selected MOrtolano VD'Elia LCallegaro article Metrologia 2016 53 1 ENV58: MeteoMet2: Metrology for essential climate variables R1-R11 seawater salinity, seawater pH, relative humidity, traceability http://iopscience.iop.org/article/10.1088/0026-1394/53/1/R1 EMRP A169: Call 2013 Environment II Institute of Physics

London

30 0026-1394 10.1088/0026-1394/53/1/R1 1 59 No, EURAMET is never allowed to make the publication publicly available. RFeistel RWielgosz S ABell M FCamões J RCooper PDexter A GDickson PFisicaro A HHarvey MHeinonen OHellmuth H-JKretzschmar J WLovell-Smith T JMcDougall RPawlowicz PRidout SSeitz PSpitzer DStoica HWolf article Metrologia 2016 53 1 ENV58: MeteoMet2: Metrology for essential climate variables R40–R59 relative humidity, meteorology, metrology, IAPWS, BIPM, definitions, climate http://iopscience.iop.org/article/10.1088/0026-1394/53/1/R40/meta EMRP A169: Call 2013 Environment II Institute of Physics

London

30 0026-1394 10.1088/0026-1394/53/1/R40 1 59 No, EURAMET is never allowed to make the publication publicly available. J WLovell-Smith RFeistel A HHarvey OHellmuth S ABell MHeinonen J RCooper proceedings 2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) Proceedings 2016 N/A N/A ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids 167 Fiber Bragg grating, optical current sensor, power system instrumentation, electronic current transformer http://ieeexplore.ieee.org/document/7602871/ EMRP A169: Call 2013 Energy II IEEE

New Jersey

Aachen 2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 28-09-2016 30 978-1-5090-2373-8 10.1109/AMPS.2016.7602871 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=7585854 JNelson GFusiek LClayburn PNiewczas CBooth POrr NGordon article Journal of Chemical Thermodynamics 2015 12 28 84 1 ENG54: Biogas: Metrology for biogas 60-66 biogas; thermodynamic characterization; density; single sinker densimeter; GERG- 2008 EnG EMRP A169: Call 2013 Energy II Elsevier 30 10.1016/j.jct.2014.12.028 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. R.Hernandez-Gomez T. E.Fernandez-Vicente M. C.Martin Gonzalez M. E.Modejar C. R.Chamorro article Radiation Protection Dosimetry 2015 12 24 Radiation Protection Dosimetry 2015; doi: 10.1093/rpd/ncv513 Radiation Protection Dosimetry 2015; doi: 10.1093/rpd/ncv513 ENV57: MetroERM: Metrology for radiological early warning networks in Europe not available (advance access) Time series analysis , Gamma radiation measurements, Periodicity analysis http://rpd.oxfordjournals.org/content/early/2015/12/23/rpd.ncv513.abstract EMRP A169: Call 2013 Environment II Oxford University Press (OUP)

Oxford

30 Online ISSN 1742-3406 - Print ISSN 0144-8420 10.1093/rpd/ncv513 1 59 No, EURAMET is never allowed to make the publication publicly available. ACLOUVAS FLEONTARIS SXANTHOS LHADGILEONTIADIS article Radiation Measurements 2015 12 12 85 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 26-31 TEPC, Sealed TEPCs, Microdosimetry, Gas pressure Monitoring, Simulated site size http://www.sciencedirect.com/science/article/pii/S1350448715300834?np=y&npKey=bb8af66d5c5364335cd11492697ddcf8a85220bc4d891169d188109555d65c33 EMRP A169: Call 2011 SI Broader Scope Elsevier Ltd. 30 10.1016/j.radmeas.2015.12.004 1 59 No, EURAMET is never allowed to make the publication publicly available. S.Chiriotti D.Moro V.Conte B.Grosswendt F.Vanhavere S.Vynckier article Techniques de l'ingénieur 2015 12 10 none none SIB57: NEWSTAR: New primary standards and traceability for radiometry Article R6412 none http://www.techniques-ingenieur.fr/base-documentaire/mesures-analyses-th1/metrologie-optique-et-photonique-42143210/references-radiometriques-pour-les-mesures-de-rayonnement-optique-r6412/grandeurs-caracteristiques-des-rayonnements-r6412niv10002.html EMRP A169: Call 2012 SI Broader scope (II) http://www.techniques-ingenieur.fr/

Saint-Denis Cede

37 none 1 59 No, EURAMET is never allowed to make the publication publicly available. B.Rougié J. M.Coutin article SCIENCE CHINA Physics, Mechanics & Astronomy 2015 12 4 58 12 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 120404 gravitational waves, advanced techniques, thermal noise, coating, laser http://link.springer.com/article/10.1007%2Fs11433-015-5738-8 EMRP A169: Call 2012 Open excellence call Science China Press and Springer-Verlag

Berlin Heidelberg

30 1674-7348 10.1007/s11433-015-5738-8 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. VMITROFANOV SCHAO H-WPAN L-CKUO GCOLE JDEGALLAIX BWILLKE article IET Circuits, Devices and Systems 2015 12 3 9 6 NEW08: MetNEMS: Metrology with/for NEMS 397 - 402 graphere, metrology, http://ieeexplore.ieee.org/document/7339730/ EMRP A169: Call 2011 Metrology for New Technologies IEEE

New York City

30 1751-858X 10.1049/iet-cds.2015.0114 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-3 LHao JGallop QLiu JChen article IET Circuits, Devices & Systems 2015 12 3 9 6 NEW08: MetNEMS: Metrology with/for NEMS 420 - 427 thermal properties, atomic force microscopy, chemical vapour deposition, copper, foils, graphene, mechanical properties, micromechanical resonators, monolayers, scanning electron microscopy http://ieeexplore.ieee.org/document/7339736/ EMRP A169: Call 2011 Metrology for New Technologies IEEE

New York CIty

30 1751-858X 10.1049/iet-cds.2015.0149 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-3 SGoniszewski JGallop MAdabi KGajewski EShaforost NKlein ASierakowski JChen TGotszalk YChen LHao article Optica Pura y Aplicada 2015 12 1 48 4 14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications 283-289 integrated optics, spectroscopy, Fourier transform, Silicon on insulator, temperature drift, spectral retrieval. - EMPIR 2014: Industry SEDOPTICA

MADRID

112 - 10.7149/OPA.48.4.283 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A. V.Velasco J.Galindo-Santos P.Cheben M. LCalvo J.Schmid A.Delage D.-X.Xu S.Janz P.Corredera article Journal of Materials Science: Materials in Electronics 2015 12 26 12 NEW09: METCO: Metrology of electro-thermal coupling for new functional materials technology 9256-9267 http://link.springer.com/article/10.1007/s10854-015-3629-4 EMRP A169: Call 2011 Metrology for New Technologies Springer US 30 0957-4522 10.1007/s10854-015-3629-4 1 59 No, EURAMET is never allowed to make the publication publicly available. TSStevenson DMMartin PCCowin ABBlumfield ABBell TCComyn PMWWeaver article DeStefanoCPFVTMDFM2015 Physica Medica 2015 12 31 8 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 897-902 Intra operative radiation therapy, Electron beam dosimetry, High dose-per-pulse radiation therapy, Synthetic diamond dosimeters EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2015.06.008 NA S.De Stefano A.Ciccotelli M.Pimpinella M.D.Falco G.Verona-Rinati A.Tonnetti M.Marinelli C.Di Venanzio G.Felici F.Marangoni proceedings FerreroVHCP2015 Proceedings of the CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard 2015 11 26 1 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 24-33 GONIOSPECTRORADIOMETRY, OLED, photometry, near-field, sub-source EMRP A169: Call 2013 Energy II Commission Internationale de L'Eclairage

CIE Central Bureau, Babenbergerstraße 9/9A, 1010 Vienna, Austria

Braunschweig, Germany CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard 26-11-2015 to 26-11-2015 30 978-3-902842-28-2 NA A.Ferrero J.L. Velázquez M.L.Hernanz J.Campos A.Pons article Nature Communication 2015 11 24 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks arxiv.org/abs/1511.07735 EMRP A169: Call 2011 SI Broader Scope 30 1 59 No, EURAMET is never allowed to make the publication publicly available. C.Lisdat G.Grosche N.Quintin C.Shi S.M.F.Raupach C.Grebing D.Nicolodi F.Stefani A.Al-Masoudi S.Dörscher S.Häfner J.-L.Robyr N.Chiodo S.Bilicki E.Bookjans A.Koczwara S.Koke A.Kuhl F.Wiotte F.Meynadier E.Camisard M.Abgrall M.Lours T.Legero H.Schnatz U.Sterr H.Denker C.Chardonnet Y.Le Coq G.Santarelli article SourgenCBDJSH2015 Meteorological Applications 2015 11 18 22 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 836-841 calibration; thermistors; uncertainty; stratosphere; metrological characterization EMRP A169: Call 2010 Environment Wiley 30 1350-4827 10.1002/met.1504 NA D.Sourgen G.Coeur-Joly J.Bordereau T.Deuzé D.Jouin F.Sparasci A.Hertzog article Magnetic Resonance in Medicine 2015 11 3 Early View (Online Version of Record published before inclusion in an issue) HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI motion-induced electric field;static magnetic field;workers’ safety EMRP A169: Call 2011 Metrology for Health Wiley Periodicals, Inc. 30 1522-2594 10.1002/mrm.26031 1 59 No, EURAMET is never allowed to make the publication publicly available. LZilberti OBottauscio MChiampi article Color Research and Application 2015 11 3 41 4 IND52: XD Reflect: Multidimensional reflectometry for industry 384-391 vision; color; color measurement; perception psychology; psychophysics; industrial inspection http://onlinelibrary.wiley.com/doi/10.1002/col.21964/abstract EMRP A169: Call 2012 Metrology for Industry (II) Wiley Periodicals, Inc.

Arlington VA

30 1520-6378 10.1002/col.21964 1 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. OGómez EPerales EChorro FJBurgos MVilaseca FMMartínez-Verdú JPujol article IEEE Transactions on Instrumentation and Measurement 2015 11 2 65 5 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1149 - 1155 Bridge circuits, Impedance, Windings, Standards, Current measurement, Frequency measurement, Uncertainty http://ieeexplore.ieee.org/document/7314919/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

---

30 0018-9456 10.1109/TIM.2015.2490898 1 59 No, EURAMET is never allowed to make the publication publicly available. http://ieeexplore.ieee.org/document/7314919/ Callegaro D'Elia Kucera Ortolano Pourdanesh Trinchera manual 2015 11 2015 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects Nanoparticles, SEM, PMMA http://www.ptb.de/emrp/2618.html EMRP A169: Call 2011 Metrology for New Technologies 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. H.Jones J.Urquhart D.Cox article APPLIED PHYSICS LETTERS 2015 10 6 107 14 EXL02: SIQUTE: Single-photon sources for quantum technologies 141106-4 photonic antennas; photonic wire; quantum dot http://scitation.aip.org/content/aip/journal/apl EMRP A169: Call 2012 Open excellence call AIP Publishing

Melville, NY

30 0003-6951 10.1063/1.4932574 1 59 No, EURAMET is never allowed to make the publication publicly available. P.Stepanov A.Delga N.Gregersen E.Peinke M.Munsch J.Teissier J.Mørk M.Richard J.Bleuse J.M.Gérard J.Claudon article Review of Scientific Instruments 2015 10 5 83 IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale 103901 Piezoelectric fields, Interferometers, Ferroelectric materials, Polarization, Diffractometers http://scitation.aip.org/content/aip/journal/rsi/86/10/10.1063/1.4931992 EMRP A169: Call 2012 Metrology for Industry (II) AIP Publishing

Melville

30 0034-6748 10.1063/1.4931992 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CVVecchini PTThompson MSStewart AMPMuniz-Piniella SRCMMcMitchell JWWooldridge SLLepadatu LBBouchenoire SBBrown DWWermeille OBBikondoa CALLucas THHase MLLesourd DDDontsov MGCCain proceedings Proceedings of the 46th Spanish Congress on Acoustics. 2015 10 HLT03: DUTy: Dosimetry for ultrasound therapy 1.609-1.616 Ultrasound, Diagnostic, Temperature measurement http://www.sea-acustica.es EMRP A169: Call 2011 Metrology for Health Sociedad Española de Acústica

Madrid

Valencia (Spain) 46th Spanish Congress on Acoustics 21-23 October 2015 30 2340-7441 (Digital version) 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.congresotecniacustica.info/Fchrs/Publicacion Oficial Congreso.pdf FChinchurreta RHekkenhberg article ReganFJPCP2015 Applied Radiation and Isotopes 2015 10 104 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 203-211 Half-Life, 227Th, Radioactivity ,Nucleardata, Radioactivity ,γ-rayspectrometry ,Ionisation chamber ,Nuclearmedicine, NORM, TENORM EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2015.07.001 NA P.H.Regan K.M.Ferreira S.M.Jerome S.Pommé S.M.Collins A.K.Pearce article The Journal of Physical Chemistry C 2015 10 J. Phys. Chem. C 2015, 119, 17784−17789 J. Phys. Chem. C 2015, 119, 17784−17789 IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale J. Phys. Chem. C 2015, 119, 17784−17789 Shell Model Lead Zirconate Titanate Pb(Zr1−xTix)O3 http://pubs.acs.org/doi/pdf/10.1021/acs.jpcc.5b03207 EMRP A169: Call 2012 Metrology for Industry (II) ACS Publications 30 10.1021/acs.jpcc.5b03207 1 59 No, EURAMET is never allowed to make the publication publicly available. OGindele, AKimmel, MCain, DDuffy proceedings International Congress of Metrology (CIM) 2015, Proceedings 2015 9 23 2015 n.a. ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions 07008 EMRP, industrial emissions http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07008/metrology_metr2015_07008.html EMRP A169: Call 2013 Environment II EDP Sciences - Web of Conferences

Les Ulis Cedex

Paris 17th International Comgress of Metrology 2015 2015-09-21 to 2015-09-24 30 n.a. n.a. 10.1051/metrology/20150007008 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. AnneRausch OlavWerhahn OliverWitzel VolkerEbert Edgar MorenoVuelban JanGersl GjermundKvernmo JohnKorsman MarcColeman TomGardiner RodRobinson proceedings Proceedings of 17th International Congress of Metrology 2015 9 21 2015 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 14007 atomic force microscope, monte carlo method EMRP A169: Call 2012 Metrology for Industry (II) EDP Sciences Paris, France 17th International Congress of Metrology September 21-24, 2015 30 10.1051/metrology/20150014007 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. P.Ceria S.Ducourtieux Y.Boukellal article 17th International Congress of Metrology 2015 9 21 17th 2015 SIB64: METefnet: Metrology for moisture in materials 15003 Development - Moisture in materials http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences

London

30 NA 10.1051/metrology/20150015003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SBell AAro FArpino SAytekin GCortellessa MDell’Isola ZFerenčíková VFernicola RGavioso EGeorgin MHeinonen DHudoklin LJalukse NKaraböce ILeito AMäkynen PMiao JNielsen INicolescu MRudolfová MOjanen-Saloranta PÖsterberg PØstergaard MRujan MSega RStrnad TVachova proceedings 17th International Congress of Metrology 2015 9 21 2015 ENV55: MetNH3: Metrology for ammonia in ambient air 07003 ammonia, reference gas mixture, reference gas generator, dilution, absolute spectroscopic measurements, sampling, gas cylinders http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07003/metrology_metr2015_07003.html EMRP A169: Call 2013 Environment II EDP Sciences - Web of Conferences

Les Ulis Cedex

Paris, France 17th International Congress of Metrology 21-09-2015 to 24-09-2015 30 10.1051/metrology/201507003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Pogány D.Balslev-Harder C. F.Braban N.Cassidy V.Ebert V.Ferracci T.Hieta D.Leuenberger N.Lüttschwager N.Martin C.Pascale C.Tiebe M. M.Twigg O.Vaittinen J.van Wijk K.Wirtz B.Niederhauser proceedings BettsBHCWKG2015 Proceedings of the 31st European Photovoltaic Solar Energy Conference and Exhibition 2015 9 18 ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification 29-34 Simulation, Characterisation, Characterization, Compressed Sensing EMRP A169: Call 2013 Energy II WIP

Munich

Hamburg, Germany 31st European Photovoltaic Solar Energy Conference and Exhibition 14-09-2015 to 18-09-2015 30 3-936338-39-6 2196-0992 10.4229/EUPVSEC20152015-1AO.2.3 NA TRBetts MBliss SHall MCashmore XWu GKoutsourakis GGottschalg article IEEE Transactions on Magnetics 2015 9 15 PP 99 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI 1 Magnetic resonance imaging, Motion induced electric field, Human exposure, Finite element method EMRP A169: Call 2011 Metrology for Health IEEE

New York

30 0018-9464 10.1109/TMAG.2015.2474748 1 59 No, EURAMET is never allowed to make the publication publicly available. L.Zilberti O.Bottauscio M.Chiampi article Microscopy and Microanalysis 2015 9 14 21 6 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 1644-1648 elemental distributions, thin films, laser-induced breakdown spectroscopy, grazing-incidence X-ray fluorescence analysis, comparison http://journals.cambridge.org/action/displayAbstract?fromPage=online&aid=10063275&fulltextType=RA&fileId=S1431927615015093 EMRP A169: Call 2013 Energy II Cambridge University Press (CUP) 30 1431-9276 10.1017/S1431927615015093 1 59 No, EURAMET is never allowed to make the publication publicly available. DARAbou-Ras RCCaballero CSStreeck BBBeckhoff JHIIn SJJeong article Physical Review Letters 2015 9 11 115 11 HLT10: BiOrigin : Metrology for biomolecular origin of disease 117801 https://www.researchgate.net/publication/280773225_Molecular-Scale_Remnants_of_the_Liquid-Gas_Transition_in_Supercritical_Polar_Fluids EMRP A169: Call 2011 Metrology for Health American Physical Society

Maryland

10.1103/PhysRevLett.115.117801 1 59 No, EURAMET is never allowed to make the publication publicly available. V. P.Sokhan A.Jones F. S.Cipcigan J.Crain G. J.Martyna article Optics Express 2015 9 7 23 18 IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products 24057-24070 frequency-domain analysis https://www.osapublishing.org/view_article.cfm?gotourl=https%3A%2F%2Fwww%2Eosapublishing%2Eorg%2FDirectPDFAccess%2F8F4A3C0C-9409-1227-C41EA2E30AFE86F0_326786%2Foe-23-18-24057%2Epdf%3Fda%3D1%26id%3D326786%26seq%3D0%26mobile%3Dno&org= EMRP A169: Call 2012 Metrology for Industry (II) OSA Publishing

Washington, D.C

30 24057 10.1364/OE.23.0 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. https://www.osapublishing.org/view_article.cfm?gotourl=https%3A%2F%2Fwww%2Eosapublishing%2Eorg%2FDirectPDFAccess%2F8F4A3C0C-9409-1227-C41EA2E30AFE86F0_326786%2Foe-23-18-24057%2Epdf%3Fda%3D1%26id%3D326786%26seq%3D0%26mobile%3Dno&org= A. J.Henning C. L.Giusca JamesClaverley article APS Physics 2015 9 3 4 034001 SIB01: InK: Implementing the new kelvin 1-9 Tunnel-Junction Thermometry Down to Millikelvin Temperatures http://journals.aps.org/prapplied/abstract/10.1103/PhysRevApplied.4.034001 EMRP A169: Call 2011 SI Broader Scope APS Physics

New York

30 NA 10.1103/PhysRevApplied.4.034001 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A VFeshchenko LCasparis I MKhaymovich DMarandan O-PSaira MPalma MMeschke J PPekola D MZumbuhl article LandiGMGCL2015 2015 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 2015 9 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality power quality, medium voltage, voltage transformer, calibration, frequency SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/AMPS.2015.7312755 NA C.Landi D.Gallo M.Modarres D.Giordano G.Crotti M.Luiso article Applied Physics Letters 2015 8 31 107 9 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems 092405 Nanowires, Nucleation, Coercive force, Domain walls, Anisotropy http://scitation.aip.org/content/aip/journal/apl/107/9/10.1063/1.4930152 EMRP A169: Call 2012 Open excellence call AIP Publishing LLC

New York

30 1077-3118 10.1063/1.4930152 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 RMansell ABeguivin DCMCPetit AFernández-Pacheco JHLee RPCowburn article KimNHLAHLHMLHJBCPYKSPPHK2015 ACS Nano 2015 8 25 9 8 SIB51: GraphOhm: Quantum resistance metrology based on graphene 8352-8360 amorphous carbon, bottom-up growth, graphene, graphene growth from polymer, graphene-based heterostructure EMRP A169: Call 2012 SI Broader scope (II) American Chemical Society (ACS)

Washington, USA

30 1936-0851, 1936-086X 10.1021/acsnano.5b03037 NA Kwang S.Kim Konstantin S.Novoselov ChanyongHwang ZonghoonLee Jong-HyunAhn Sang WooHan Tae GeolLee SeungHyun ArtemMishchenko Seoung-KiLee SungHuh GumhyeJeon JinseokByun Dong-HunChae Hyo JuPark Seong UkYu Yong-JinKim Jin GyeongSon JaesungPark BeomjinPark Byung HeeHong Jin KonKim proceedings 2015 8 24 NEW07: THz Security: Microwave and terahertz metrology for homeland security THz, mm-wave, Skin Phantom, Thermal Imaging EMRP A169: Call 2011 Metrology for New Technologies Hong Kong 40th International Conference on Infrared, Millimeter and Terahertz Waves (IRMMW-THz 2015) 2015-08-23 until 2015-08-28 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Kazemipour M.Charles D.Allal M.Borsero L.Zilberti O.Bottauscio M.Chiampi proceedings CetintasACS2015 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 2015 8 22 2015 2015 IND60: EMC: Improved EMC test methods in industrial environments 1243-1247 Alternative; Voltage; Probe; Conducted Emission; EMC; Industry; In-Situ; LISN; Mains Impedance; On-Site EMRP A169: Call 2012 Metrology for Industry (II) IEEE Dresden 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 16-08-2015 to 22-08-2015 30 10.1109/ISEMC.2015.7256348 NA M.Çetintaş S.Acak S.Çakır O.Şen proceedings 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 2015 8 22 2015 2015 IND60: EMC: Improved EMC test methods in industrial environments 1260 - 1265 Alternative, Current Probe, CDN, Conducted Immunity, EMC, High Current, Industry, Mains Impedance http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=7256351&tag=1 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

Dresden 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 16-08-2015 to 22-08-2015 30 - 2158-110X 10.1109/ISEMC.2015.7256351 1 59 No, EURAMET is never allowed to make the publication publicly available. SoydanÇakır OsmanŞen SavaşACAK MustafaÇetintaş article Metrologia 2015 8 19 52 5 SIB01: InK: Implementing the new kelvin S233 Doppler broadening thermometry, laser spectroscopy, fundamental metrology EMRP A169: Call 2011 SI Broader Scope 2015 BIPM & IOP Publishing Ltd 30 10.1088/0026-1394/52/5/S233 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. EugenioFasci Maria DomenicaDe Vizia AndreaMerlone LuigiMoretti AntonioCastrillo LivioGianfrani article IEEE Electromagnetic Compatibility Magazine 2015 8 17 4 Quarter 2 IND60: EMC: Improved EMC test methods in industrial environments 82-91 Digital Signal Processing, Electromagnetic compatibility, Electromagnetic interference, Electromagnetic measurements, Time-domain analysis. http://ieeexplore.ieee.org/document/7204056/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

-

30 2162-2272 10.1109/MEMC.2015.7204056 1 No, EURAMET is never allowed to make the publication publicly available. 2162-2264 MarcoAzpúrua MarcPous SoydanÇakir MustafaÇETİNTAŞ FerranSilva article The Journal of Physical Chemistry C 2015 8 6 119 31 14IND12: Innanopart: Metrology for innovative nanoparticles 17687–17696 Core shell Nanoparticles, XPS simulations, XPS Intensities https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4554492/ EMPIR 2014: Industry American Chemical Sociery

Washington DC

30 10.1021/acs.jpcc.5b04517 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-6 MChudzicki WSMWerner AGShard YCWang DGCastner CJPowell article CIRP Annals Manufacturing Technology 2015 8 1 64 2 IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products 511-514 Metrology, Optical, Coordinate measuring machine (CMM) http://www.sciencedirect.com/science/article/pii/S0007850615000979 EMRP A169: Call 2012 Metrology for Industry (II) ELSEVIER

Amsterdam

30 0007-8506 10.1016/j.cirp.2015.04.089 1 59 No, EURAMET is never allowed to make the publication publicly available. WSun J. D.Claverley JamesClaverley techreport - 2015 7 30 - - NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation - - MAT https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf EMRP A169: Call 2011 Metrology for New Technologies PTB

Brunswick & Berlin

- 30 - - 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf C.Elster K.Klauenberg M.Walzel G.Wuebbeler P.Harris M.Cox C.Matthews I.Smith L.Wright A.Allard N.Fischer S.Cowen S.Ellison P.Wilson F.Pennecchi G.Kok A.Van der Veen L.R.Pendrill article Journal of Physical Chemistry (B) 2015 7 23 119 33 NEW01: TReND: Traceable characterisation of nanostructured devices 10784–10797 http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b05625 EMRP A169: Call 2011 Metrology for New Technologies ACS

Washington DC

30 10.1021/acs.jpcb.5b05625 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-6 A.Shard R.Havelund S.Spencer I.Gilmore M.R.Alexander T.B.Angerer S.Aoyagi J.P.Barnes A.Benayad A.Bernasik G.Ceccone J.D.PCounsell C.Deeks J.S.Fletcher D.J.Graham C.Heuser T.G.Lee C.Marie M.M.Marzec G.Mishra D.Rading O.Renault D.JScurr H.K.Shon V.Spampinato H.Tian F.Wang N.Winograd K.Wu A.Wucher article Physics in Medicine & Biology 2015 7 6 60 14 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI 5655–5680 MRI, dosimetry, computational modelling, near field measurements EMRP A169: Call 2011 Metrology for Health 30 Online ISSN: 1361-6560 / Print ISSN: 0031-9155 10.1088/0031-9155/60/14/5655 59 No, EURAMET is never allowed to make the publication publicly available. O.Bottauscio A. M.Cassarà J. W.Hand D.Giordano L.Zilberti M.Borsero M.Chiampi G.Weidemann article Journal of Materials Science: Materials in Electronics 2015 6 26 26 12 NEW09: METCO: Metrology of electro-thermal coupling for new functional materials technology 9268-9278 Piezoelectric, High Temperature, Measurement, Metrology, Interferometry http://link.springer.com/article/10.1007%2Fs10854-015-3285-8 EMRP A169: Call 2011 Metrology for New Technologies Springer US 30 0957-4522 10.1007/s10854-015-3285-8 59 No, EURAMET is never allowed to make the publication publicly available. PMWWeaver TSStevenson TQQuast GBBartl TSKSchmitz-Kempen PWWooliams ABBlumfield MSStewart MGCCain article Journal of Applied Physics 2015 6 25 117 24 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems 7/243905 nanodot, VNA-FMR, precessional mode http://scitation.aip.org/content/aip/journal/jap EMRP A169: Call 2012 Open excellence call AIP Publisching

NY

30 0021-8979 (print) ; 1089-7550 (online) 10.1063/1.4923160 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. X.KHu H.Dey N.Liebing H.W.Schumacher G.Csaba A.Orlov G.H.Bernstein W.Porod proceedings Proceedings SPIE 9525, Optical Measurement Systems for Industrial Inspection IX 2015 6 22 9525 95254K SIB60: Surveying: Metrology for long distance surveying piezoelectric actuator, passive cavity, mode-locked laser EMRP A169: Call 2012 SI Broader scope (II) SPIE Munich, Germany SPIE Optical Measurement Systems for Instrustrial Inspection IX, World of Photonics 22-06-2015 to 25-06-2015 30 9781628416855 10.1117/12.2190745 1 59 No, EURAMET is never allowed to make the publication publicly available. L.Pradova A.Lesundak V.Hucl M.Cizek B.Mikel J.Hrabina S.Rerucha O.Cip J.Lazar proceedings Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution 2015 6 15 n/a n/a ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1-4 power quality, power networks SEG http://cired.net/publications/cired2015/papers/CIRED2015_0663_final.pdf EMRP A169: Call 2013 Energy II n/a

n/a

Lyon, France 23rd International Conference and Exhibition on Electricity Distribution 14-06-2015 to 15-06-2015 30 n/a n/a 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://cired.net/publications/cired2015/papers/CIRED2015_0663_final.pdf VCuk Hvan den Brom SCobben GRietveld article Journal of the Air & Waste Management Association 2015 6 11 Vol. 65 Iss. 8,2015 ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions 1011-1019 CEN/TS 14793, FTIR, TGN M22, EN 15058, 2010/75/EU, Industrial, Emissions, pollution, SRMs, UNECE, CLRTAP, E-PRTR, CEMs, AMSs, BIPM, Fourier-transform infrared, measurement. http://www.tandfonline.com/doi/full/10.1080/10962247.2015.1058868 EMRP A169: Call 2013 Environment II Taylor & Francis

London

30 1096-2247 10.1080/10962247.2015.1058868 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-6-11 M.D.Coleman S.Render C.Dimopoulos A.Lilley R.A.Robinson T.O.M.Smith R.Camm R.Standring proceedings Proceedings of euspen’s 15th International Conference & Exhibition, Leuven, Belgium, June 2015 2015 6 1 2015 1 IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products 185-186 micro-CMMs, micro-CMM styli, design rules http://www.euspen.eu/Library/ProceedingsPresentations.aspx EMRP A169: Call 2012 Metrology for Industry (II) euspen

Milton-Keynes

Leuven, Belgium euspen’s 15th International Conference & Exhibition 01-06-2015 to 05-06-2015 30 14: 978-0-9566790-7-9 14: 978-0-9566790-7-9 1 59 No, EURAMET is never allowed to make the publication publicly available. http://www.euspen.eu/Portals/0/Content/2000-2013/Resources/Proceedings/2015%20Leuven%20Contents%20Pages.pdf M. A.Ismail J. D.Claverley R. K.Leach DChetwynd JamesClaverley article IEEE TRANSACTIONS ON INSTRUMENTATION AND MEASUREMENT 2015 6 64 6 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1398-1404 Digital filter, measurements, optimization, power systems, smart grids, voltage divider, voltage measurement SEG EMRP A169: Call 2013 Energy II IEEE Instrumentation and Measurement Society 30 0018-9456 10.1109/TIM.2015.2398971 1 59 No, EURAMET is never allowed to make the publication publicly available. GCrotti DGallo DGiordano CLandi MLuiso proceedings Proceedings of euspen’s 15 th International Conference & Exhibition, Leuven, Belgium, June 2015 2015 6 2015 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom O3.3, p 107 metrological atomic force microscopy, virtual instrument, modelling, Monte Carlo method, measurement uncertainty EMRP A169: Call 2012 Metrology for Industry (II) Euspen

Delft

Leuven, Belgium euspen’s 15 th International Conference & Exhibition June 1-5, 2015 30 978-0-9566790-7-9 59 No, EURAMET is never allowed to make the publication publicly available. P.Ceria S.Ducourtieux Y.Boukellal article International Journal of Simulation Modelling 2015 6 14 2 NEW06: TraCIM: Traceability for computationally-intensive metrology 227-237 Interlaboratory Comparison, Validation Software, Performance Metrics, Verification, Simulation MAT http://www.ijsimm.com/Full_Papers/Fulltext2015/text14-2_227-237.pdf EMRP A169: Call 2011 Metrology for New Technologies DAAAM International Vienna 

Vienna

30 1726-4529 10.2507/IJSIMM14(2)4.288 1 59 No, EURAMET is never allowed to make the publication publicly available. BAAcko SBBrezovnik LCLCrepinsek-Lipus RKKlobucar article WrightFCR2015 Proceedings of CIRED 2015 2015 6 1 1 ENG04: SmartGrid: Metrology for Smart Electrical Grids 0779 smart grids, distribution grid sensor networks, sensor placement algorithm, power flow, Electrical engineering. Electronics Nuclear engineering, Electrical and Electronic Engineering https://strathprints.strath.ac.uk/53767/1/Clarkson_etal_CIRED2015_algorithm_for_configuring_distribution_grid_sensor_networks.pdf EMRP A169: Call 2009 Energy CIRED

Lyon, France

30 978-1-78561-483-5 2032-9644 NA P.SWright AForbes PClarkson ARoscoe article IEEE Transactions on Magnetics 2015 5 21 51 11 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems 4/3401004 Ferromagnetic resonance (FMR) mode, microwave-assisted magnetization switching (MAS), nanomagnet logic (NML), simulation http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=20 EMRP A169: Call 2012 Open excellence call IEEE

New York

30 0018-9464 10.1109/TMAG.2015.2435901 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. X.K.Hu H.Dey N.Liebing G.Csaba A.Orlov G.H.Bernstein W.Porod P.Krzysteczko S.Sievers H.W.Schumacher proceedings 2015 5 19 SIB64: METefnet: Metrology for moisture in materials http://www.asmeatiuit2015.com/public/index.php EMRP A169: Call 2012 SI Broader scope (II) Villa Doria D'Angri, Napoli ASME ATI UIT 2015 17-20 June, 2015 30 59 No, EURAMET is never allowed to make the publication publicly available. F.Arpino G.Cortellessa M.Dell'Isola G.Ficco A.Carotenuto N.Massarotti article Proceedings of the National Academy of Sciences of the United States of America 2015 5 19 112 20 HLT10: BiOrigin : Metrology for biomolecular origin of disease 6341-6346 subcritical water intermolecular interactions many-body dispersion coarse-grained model electronic responses http://www.pnas.org/content/112/20/6341.full.pdf EMRP A169: Call 2011 Metrology for Health PNAS

Washington

30 10.1073/pnas.1418982112 1 59 No, EURAMET is never allowed to make the publication publicly available. Vlad P.Sokhan Andrew P.Jones Flaviu S.Cipcigan JasonCrain Glenn J.Martyna article Comptes Rendus Physique 2015 5 8 16 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 531–539 Time and frequency metrology Optical links Frequency stabilized lasers Fibre optics www.sciencedirect.com EMRP A169: Call 2011 SI Broader Scope 30 10.1016/j.crhy.2015.04.005 1 59 No, EURAMET is never allowed to make the publication publicly available. O.Lopez F.Kéfélian H.Jiang A.Haboucha A.Bercy F.Stefani B.Chanteau A.Kanj D.Rovera J.Achkar CChardonnet P.-O.Pottie A.Amy-Klein G.Santarelli article IEEE MAGNETICS LETTERS, 2015 5 5 6 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI Biomagnetics, magnetic resonance imaging, motion-induced fields, human exposure to electromagnetic fields. EMRP A169: Call 2011 Metrology for Health 30 1949-307X 10.1109/LMAG.2015.2429641 59 No, EURAMET is never allowed to make the publication publicly available. LucaZilberti OrianoBottauscio MarioChiampi article Radiation Protection Dosimetry 2015 5 4 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy http://rpd.oxfordjournals.org/content/early/2015/05/04/rpd.ncv293.abstract EMRP A169: Call 2011 SI Broader Scope 30 10.1093/rpd/ncv293 59 No, EURAMET is never allowed to make the publication publicly available. S.Chiriotti D.Moro P.Colautti V.Conte B.Grosswendt article Acta Physica Polonica A 2015 5 127 5 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 1516-1519 PACS numbers: 87.53.Bn, 87.53.-j http://przyrbwn.icm.edu.pl/APP/ABSTR/127/a127-5-18.html EMRP A169: Call 2011 SI Broader Scope 30 10.12693/APhysPolA.127.1516 59 No, EURAMET is never allowed to make the publication publicly available. U.Kamierczak A.Bantsar D.Banas J.Braziewicz J.Czub M.Jaskóla A.Korman M.Kruszewski A.Lankoff H.Lisowska M.Pietrzak S.Pszona T.Stepkowski Z.Szeflinski M.Wojewódzka proceedings 2015 5 SIB10: NOTED: Novel techniques for traceable temperature dissemination 887-892 frequency standards;measurement standards;network analysers;portable instruments;temperature measurement;whispering gallery modes;GPS-based solution;SWGT;VNA;complex resonance frequency detection;low-cost measurement system;rubidium frequency standard;sapphire whispering gallery thermometry;transfer temperature standard;vector network analyzer;Accuracy;Frequency measurement;Global Positioning System;Instruments;Resonant frequency;Standards;Temperature measurement;microwave measurements;microwave resonances;whispering gallery thermometry EMRP A169: Call 2011 SI Broader Scope The Institute of Electrical and Electronics Engineers, Incorporated (the "IEEE")

Piscataway

Pisa, Italy 2015 IEEE International Instrumentation and Measurement Technology Conference (I2MTC 2015) 11-14 May 2015 30 10.1109/I2MTC.2015.7151386 1 59 No, EURAMET is never allowed to make the publication publicly available. S.Corbellini C.Ramella M.Pirola V.Fernicola article Physical Review B 2015 4 28 91 14 NEW01: TReND: Traceable characterisation of nanostructured devices 144202 http://journals.aps.org/prb/abstract/10.1103/PhysRevB.91.144202 EMRP A169: Call 2011 Metrology for New Technologies APS Physics

Washington DC

30 1098-0121 10.1103/PhysRevB.91.144202 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-4-28 J.C.Blakesley F.ACastro article Phys. Rev. X 2015 4 27 5 2 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 021011 Atomic and Molecular Physics, Quantum Physics http://arxiv.org/abs/1501.03709 EMRP A169: Call 2012 Open excellence call American Physical Society

College Park, MD

30 2160-3308 10.1103/PhysRevX.5.021011 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. RKohlhaas ABertoldi ECantin AAspect ALandragin PBouyer article Classical and Quantum Gravity 2015 4 27 32 10 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 105008 gravitational wave detectors, absorption, crystalline coating http://iopscience.iop.org/article/10.1088/0264-9381/32/10/105008/meta EMRP A169: Call 2012 Open excellence call IOP Publishing

Bristol, UK

30 0264-9381 10.1088/0264-9381/32/10/105008 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. JSteinlechner I WMartin ABell GCole JHough SPenn SRowan SSteinlechner article Journal of the Optical Society of America A, Optics, Image Science and Vision. 2015 4 27 32 5 IND52: XD Reflect: Multidimensional reflectometry for industry 921-927 sparkle, Color, measurement, Vision - acuity, Color visión, Vision - contrast sensitivity, Spectral discrimination, Astronomical optics https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-5-921 EMPIR 2014: Industry The Optical Society (OSA)

Washington, DC

30 1084-7529 10.1364/JOSAA.32.000921 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. EKirchner Ivan der Lans EPerales FMMartínez-Verdú JCampos AFerrero article ChemComm 2015 4 24 51 45 NEW02: Raman: Metrology for Raman Spectroscopy 9366-9369 N/A http://pubs.rsc.org/en/Content/ArticleLanding/2015/CC/c5cc02675j#!divAbstract EMRP A169: Call 2011 Metrology for New Technologies Royal Society of Chemistry

Picadilly UK

30 N/A 10.1039/c5cc02675j 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 N.Rubio L.M.Hirvonen E.Z.Chong J.T.W.Wang M.Bourgognon H.Kafa H.A.F.M.Hassan W.T.Al-Jamal D.McCarthy C.Hogstrand F.Festy K.T.Al-Jamal article Radiation Protection and Dosimetry 2015 4 24 167 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 70-74 thoron, radon http://rpd.oxfordjournals.org/content/167/1-3/70.abstract?maxtoshow=&hits=10&RESULTFORMAT=&fulltext=thoron+sabot&searchid=1&FIRSTINDEX=0&resourcetype=HWCIT EMRP A169: Call 2012 Metrology for Industry (II) Oxford Journals

Oxford University

30 1742-3406 10.1093/rpd/ncv221 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BSabot PCassette SPierre NMichielsen SBondiguel article IEEE TRANSACTIONS ON MAGNETICS 2015 4 22 51 3 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI Biological effects of electromagnetic radiation, boundary element (BE) method, eddy currents, finite element (FE) method, magnetic resonance imaging (MRI). EMRP A169: Call 2011 Metrology for Health 30 0018-9464 10.1109/TMAG.2014.2363140 59 No, EURAMET is never allowed to make the publication publicly available. OBottauscio MChiampi JHand LZilberti article IEEE transactions on instrumentation and measurement 2015 4 20 64 6 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1355 - 1363 smart grid, metrology, synchrophasor, phasor measurement unit, revenue metering, power quality, grid modelling, electrical grids http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7089250 EMRP A169: Call 2013 Energy II IEEE

n/a

30 0018-9456 10.1109/TIM.2015.2406056 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. GertRietveld Jean-PierreBraun RicardoMartin PaulWright WeibkeHeins NikolaEll PaulClarkson NorbertZisky article Optics Express 2015 4 20 23 8 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 10604 - 10615 EMRP A169: Call 2011 SI Broader Scope 30 10.1364/OE.23.010604 1 59 No, EURAMET is never allowed to make the publication publicly available. C.Clivati G.Bolognini D.Calonico S.Faralli A.Mura F.Levi article Nature Nanotechnology 2015 4 20 10 SIB51: GraphOhm: Quantum resistance metrology based on graphene 965-971 graphene, QHR, measurement https://www.ptb.de/emrp/resources/documents/graphohm/Sonstige_Fotos/NatureComms7806-2015-Lafont.pdf EMRP A169: Call 2012 SI Broader scope (II) Macmillan Publishers 30 10.1038/ncomms7806 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Lafont R.Ribeiro-Palau D.Kazazis A.Michon O.Couturaud C.Consejo T.Chassagne M.Zielinski M.Portrail B.Jouault F.Schopfer W.Poirier article Radiation Protection Dosimetry 2015 4 15 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy http://rpd.oxfordjournals.org/content/early/2015/04/15/rpd.ncv153.abstract EMRP A169: Call 2011 SI Broader Scope 30 10.1093/rpd/ncv153 59 No, EURAMET is never allowed to make the publication publicly available. D.Moro S.Chiriotti V.Conte P.Colautti B.Grosswendt article Radiation Protection Dosimetry 2015 4 15 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy http://rpd.oxfordjournals.org/content/early/2015/04/15/rpd.ncv140.abstract EMRP A169: Call 2011 SI Broader Scope 30 10.1093/rpd/ncv140 59 No, EURAMET is never allowed to make the publication publicly available. S.Chiriotti D.Moro V.Conte P.Colautti B.Grosswendt E.Sterpin S.Vynckier article J. Opt. Soc. Am. B 2015 4 9 32 5 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 787 - 797 EMRP A169: Call 2011 SI Broader Scope 30 10.1364/JOSAB.32.000787 59 No, EURAMET is never allowed to make the publication publicly available. F.Stefani O.Lopez A.Bercy W.-K.Lee C.Chardonnet G.Santarelli P.-E.Pottie A.Amy-Klein article Opt. Lett. 2015 4 8 40 8 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 1705 (120.5790) Sagnac effect; (140.3370) Laser gyroscopes; (140.3560) Lasers, ring. https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-8-1705 EMRP A169: Call 2012 Open excellence call Optical Society of America

Washington, DC, USA

30 1539-4794 10.1364/OL.40.001705 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. USchreiber RThirkettle RHurst DFollman GCole MAspelmeyer J-PWells article MartinezCWHCL2015 IEEE Photonics Technology Letters 2015 4 27 7 IND53: Large Volume: Large volume metrology in industry 733-736 distance measurements, sweep laser applications, four wave mixing, FSI http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7014240 A169 EMRP A169: Call 2012 Metrology for Industry (II) 10.1109/LPT.2015.2390779 1 59 NA JuanMartinez MichaelCampbell MatthewWarden BenHughes NigelCopner AndrewLewis article MairaniMCVVPMRM2015 Medical Physics 2015 3 31 42 4 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 2085-2093 synthetic diamond detector, carbon ions, relative dosimetry EMRP A169: Call 2011 Metrology for Health Wiley-Blackwell 30 0094-2405 10.1118/1.4915544 NA A.Mairani A.Mirandola M.Ciocca G.Verona-Rinati C.Verona G.Prestopino M.Marinelli L.Raffaele G.Magro article AzumaBBBBBCDFFHKKKMMMMNNPRRSSVWWZ Metrologia 2015 3 25 52 2 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies fundamental constants, Avogadro constant, kilogram A169 EMRP A169: Call 2011 SI Broader Scope 30 0957-0233 10.1088/0026-1394/52/2/360 1 59 NA YAzuma PBarat GBartl HBettin MBorys IBusch LCibik GD’Agostino KFujii HFujimoto AHioki MKrumrey UKuetgens NKuramoto GMana EMassa RMeeß SMizushima TNarukawa ANicolaus APramann S ARabb ORienitz CSasso MStock R DVocke Jr AWaseda SWundrack SZakel article Int. J. Thermophysics 2015 3 22 36 8 SIB64: METefnet: Metrology for moisture in materials 2185-2198 Certified reference materials · Measurement traceability · Moisture content · Strategy · Water content http://link.springer.com/article/10.1007/s10765-015-1859-6 EMRP A169: Call 2012 SI Broader scope (II) Springer International Publishing AG

Teddington

30 NA 10.1007/s10765-015-1859-6 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SBell NBose RBosma MBuzoianu PCarroll VFrenicola EGeorgin MHeinonen AKentved CMelvad JNielsen proceedings Measuring, Modeling, and Reproducing Material Appearance 2015 2015 3 13 9393 93980E IND52: XD Reflect: Multidimensional reflectometry for industry 93980E-1 - 93980E-11 Goniospectrophotometry, BSSRDF, BRDF, fluorescence, sparkle, translucency, appearance EMRP A169: Call 2012 Metrology for Industry (II) SPIE

Bellingham WA, USA

San Francisco, California, USA IS&T/SPIE Electronic Imaging 9-10 February 2015 30 9781628414882 0277-786X 10.1117/12.2077084 1 59 No, EURAMET is never allowed to make the publication publicly available. BBernad AFerrero APons M. L.Hernanz JCampos article IEEE TRANSACTIONS ON MAGNETICS 2015 3 51 3 NEW07: THz Security: Microwave and terahertz metrology for homeland security Biological effects of electromagnetic radiation, finite element (FE) method, heating, propagation, scattering EMRP A169: Call 2011 Metrology for New Technologies 30 59 No option selected O.Bottauscio M.Chiampi L.Zilberti article IEEE TRANSACTIONS ON MAGNETICS 2015 3 51 3 NEW07: THz Security: Microwave and terahertz metrology for homeland security Dosimetry, millimeter wave propagation EMRP A169: Call 2011 Metrology for New Technologies 30 59 No, EURAMET is never allowed to make the publication publicly available. L.Zilberti D.Voyer O.Bottauscio M.Chiampi R.Scorretti article Rendiconti Lincei 2015 2 17 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI 1-10 Magnetic resonance imaging, Dosimetry, Magnetic nanoparticles, Biosensors EMRP A169: Call 2011 Metrology for Health 30 Print ISSN 2037-4631, Online ISSN 1720-0776 10.1007/s12210-015-0386-5 59 No, EURAMET is never allowed to make the publication publicly available. GBarrera MBorsero OBottauscio FCelegato MChiampi MCoı¨sso DGiordano MInguscio AManzin ESimonetto PTiberto LZilberti article Magnetic Resonance in Medicine 2015 2 17 early view HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI temperature elevation; hip prostheses; gradient coils MAT EMRP A169: Call 2011 Metrology for Health 30 1522-2594 10.1002/mrm.25687 59 No, EURAMET is never allowed to make the publication publicly available. LZilberti OBottauscio MChiampi JHand HSanchez Lopez RBrühl SCrozier article RoyROHCJIWG2015 Physical Review Letters 2015 2 11 114 6 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems Optical Spin-Transfer-Torque-Driven Domain-Wall Motion in a Ferromagnetic Semiconductor EMRP A169: Call 2012 Open excellence call American Physical Society (APS)

1 Research Rd, Ridge, NY 11961, USA

30 0031-9007, 1079-7114 10.1103/PhysRevLett.114.067202 NA P. E.Roy A. J.Ramsay R. M.Otxoa J. A.Haigh R. P.Campion T.Janda A. C.Irvine J.Wunderlich B. L.Gallagher article APL Materials 2015 2 10 3 IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale 026103 Electrodes, Field emitters, Piezoelectric effects, Piezoelectric devices, Piezoelectric films http://scitation.aip.org/content/aip/journal/aplmater/3/2/10.1063/1.4907954 EMRP A169: Call 2012 Metrology for Industry (II) AIP Publishing

Melville

30 10.1063/1.4907954 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. ESSN: 2166-532X MSStewart SLLepadatu LNMMcCartney MGCCain LWWright JCCrain DMNNewns GJMMartyna article Metrologia 2015 2 5 52 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 195-200 single electron pump, quantum current standard, QD electron pump http://m.iopscience.iop.org/0026-1394/52/2/195 EMRP A169: Call 2011 SI Broader Scope 30 10.1088/0026-1394/52/2/195 59 No, EURAMET is never allowed to make the publication publicly available. M.-H.Bae Y.-H.Ahn M.Seo Y.Chung J. D.Fletcher S. P.Giblin M.Kataoka N.Kim article Optics Letters 2015 1 15 40 2 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 131-134 EMRP A169: Call 2011 SI Broader Scope 30 10.1364/OL.40.000131 1 59 No, EURAMET is never allowed to make the publication publicly available. C. E.Calosso E. K.Bertacco D.Calonico C.Clivati G. A.Costanzo M.Frittelli F.Levi S.Micalizio A.Mura A.Godone article Applied Physics Letters 2015 1 12 106 2 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems 022402 Nucleation, Domain walls, Magnetic fields, Magnetic films, Magnetooptic Kerr effect http://scitation.aip.org/content/aip/journal/apl/106/2/10.1063/1.4905600 EMRP A169: Call 2012 Open excellence call AIP Publishing LLC

New York

30 1077-3118 10.1063/1.4905600 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 DPetit PRSeem MTillette RMansell RPCowburn proceedings Proceddings SPIE 9450, Photonics, Devices and Systems VI 2015 1 6 94501L 6 January 2015 SIB60: Surveying: Metrology for long distance surveying Fabry-Perot cavity, laser frequency comb, repetition rate multiplication http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2089426 EMRP A169: Call 2012 SI Broader scope (II) SPIE Prague 7th Internataional Conference on Photonics, Devices and Systems August 27-29, 2014 30 10.1117/12.2074415 1 59 No, EURAMET is never allowed to make the publication publicly available. A.Lešundák R.Smid D.Voigt M.Čížek S.van den Berg O.Číp article MorenoNJCZ2015 Journal of Quantitative Spectroscopy and Radiative Transfer 2015 1 151 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 251-259 Laser spectroscopy, Optical parametric oscillator, Line Parameters, Methane EMRP A169: Call 2010 Environment Elsevier BV

New York, USA

30 0022-4073 10.1016/j.jqsrt.2014.10.006 NA Marco P.Moreno LinhNguyen MohammadJahjah MaloCadoret Jean-JacquesZondy article ClaverleyL2015 Precision Engineering 2015 1 39 IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products 1 to 15 http://www.sciencedirect.com/science/article/pii/S0141635914001020 A169 EMRP A169: Call 2012 Metrology for Industry (II) 10.1016/j.precisioneng.2014.06.006 1 59 NA J.DClaverley R.KLeach article Clinical Chemistry 2015 1 61 1 SIB54: Bio-SITrace: Traceability for biologically relevant molecules 79-88 digital PCR, molecular diagnostic, nucleic acid, DNA, error, reproducibility, bias, translation, clinical, reference materials, partition size, http://www.clinchem.org/content/61/1/79.long EMRP A169: Call 2012 SI Broader scope (II) American Association For Clinical Chemistry

Washington

30 1530-8561 10.1373/clinchem.2014.221366 1 59 No, EURAMET is never allowed to make the publication publicly available. JFHuggett SCowen CAFoy article ManzinCSPCFSLPS20150 IEEE Transactions on Magnetics 2015 1 51 1 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems 1-4 Static and dynamic analysis of magnetic tunnel junctions with wedged MgO barrier EMRP A169: Call 2012 Open excellence call Institute of Electrical and Electronics Engineers (IEEE)

445 Hoes Ln, Piscataway Township, NJ 08854, USA

30 0018-9464, 1941-0069 10.1109/TMAG.2014.2359077 NA AlessandraManzin AmbraCaprile Hans W.Schumacher MassimoPasquale MarcoCoisson RicardoFerreira SybilleSievers NiklasLiebing ElviraPaz SantiagoSerrano-Guisan article Optics Express 2015 23 2 SIB01: InK: Implementing the new kelvin EMRP A169: Call 2011 SI Broader Scope 30 10.1364/OE.23.001757 59 No, EURAMET is never allowed to make the publication publicly available. H.Dinesan E.Fasci A.D’Addio A.Castrillo L.Gianfrani proceedings Proceedings of the 2013 International Conference on Electromagnetics in Advanced Applications (ICEAA) 2015 NEW07: THz Security: Microwave and terahertz metrology for homeland security 895 - 898 EMRP A169: Call 2011 Metrology for New Technologies Torino, Italy 2013 International Conference on Electromagnetics in Advanced Applications (ICEAA) 9-13 September 2013 30 59 No, EURAMET is never allowed to make the publication publicly available. L.Zilberti A.Arduino O.Bottauscio M.Chiampi article Review of Scientific Instruments 2015 86 IND14: Frequency: New generation of frequency standards for industry EMRP A169: Call 2010 Industry 30 0034-6748 10.1063/1.4904973 59 No, EURAMET is never allowed to make the publication publicly available. J.Galindo-Santos A. V.Velasco P.Corredera article GarciaToranoPCRABLD2015 Journal of Radioanalytical and Nuclear Chemistry 2015 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry Metal radioactivity; HPGe detectors; MDA; metallurgy; steel works http://www.springer.com/chemistry/journal/10967 A169 EMRP A169: Call 2010 Industry English 10.1007/s10967-014-3901-8 1 59 NA E.García-Toraño V.Peyres B.Caro M.Roteta D.Arnold O.Burda M-R.Loan P.De Felice article Mater. Res. Soc. Symp. Proc. Vol. 1771: Recent Advances in Photovoltaics 2015 1771 - ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells - Multi-junction solar cells, PV, metrology , SPM , Scanning Kelvin Probe http://journals.cambridge.org/action/displayAbstract?fromPage=online&aid=9683509&fileId=S1946427415003905 EMRP A169: Call 2013 Energy II Cambridge Journal online

Cambridge, UK

30 10.1557/opl.2015.390 1 59 No, EURAMET is never allowed to make the publication publicly available. Alexandre CuenatCuenat EkaterinaSelezneva article Measurement 2015 73 IND12: Vacuum: Vacuum metrology for production environments Micro flowrates; rectangular microchannels; secondary standard leaks; slip flow; transition flow. EMRP A169: Call 2010 Industry 30 59 No, EURAMET is never allowed to make the publication publicly available. M.Bergoglio D.Mari J.Chen H.Si Hadj Mohand S.Colin C.Barrot article IEEE Transactions on Instrumentation and Measurement 2015 64 6 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1466-1471 Impedance measurement, bridge circuits, digital-analog conversion, electromagnetic devices, precision measurements. - EMRP A169: Call 2012 SI Broader scope (II) Luca Callegaro

INRIM, Torino, Italy

30 0018-9456 10.1109/TIM.2015.2398953 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. LucaCallegaro V.D'Elia MassimoOrtolano FaranakPourdanesh proceedings Proceedings of the 2015 IEEE International Instrumentation and Measurement Technology Conference 2015 - - SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1658-1661 Impedance measurement, bridge circuits, digital-analog conversion, electromagnetic devices, precision measurements. - EMRP A169: Call 2012 SI Broader scope (II) Luca Callegaro

INRIM, Torino, Italy

Pisa, Italy 2015 IEEE International Instrumentation and Measurement Technology Conference 2015-05- 11-14 30 - 978-1-4799-6113-9 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. LucaCallegaro V.D'Elia FaranakPourdanesh BrunoTrinchera J.Kucera MassimoOrtolano article IEEE Transactions on Instrumentation and Measurement 2015 64 6 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1460 - 1465 Impedance measurement, bridge circuits, digital-analog conversion, electromagnetic devices, precision measurements. - EMRP A169: Call 2012 SI Broader scope (II) Luca Callegaro

INRIM, Torino, Italy

30 0018-9456 10.1109/TIM.2015.2401192 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. LucaCallegaro V.D'Elia MarianKampik Dan BeeKim MassimoOrtolano FaranakPourdanesh proceedings CIM 2015 2015 NA NA IND51: MORSE: Metrology for optical and RF communication systems NA temperature, antenna gain, thermal enclosure EMRP A169: Call 2012 Metrology for Industry (II) NA

NA

Paris Congrès International de Métrologie 21-24 sept 2015 37 NA NA 10.1051/metrology/20150012010 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Y.Le Sage M.Charles J.-M.Lerat article Metrologia Tech. Suppl. 2015 52 ENV09: MetroRWM: Metrology for Radioactive Waste Management 06017 Activity measurements; I-129; International comparisons http://iopscience.iop.org/0026-1394 EMRP A169: Call 2010 Environment Institute of Physcis Science

Bristol, UK

30 1681-7575 10.1088/0026-1394/52/1A/06017 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-1 E.Garcia-Toraño T.Altzitzoglou P.Pavel Auerbach M.M.Bé V.Lourenco C.Bobin P.Cassette R.Dersch K.Kossert O.Nähle V.Peyrés S.Pommé A.Rozkov A.Sanchez-Cabezudo J.Sochorová proceedings EDULEARN14 Proceedings 2015 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 5593-5602 Color technology, special-effect pigments, automotive coatings, training internships in company, Moodle platform, adaptive learning, b-learning http://library.iated.org/publications/EDULEARN14 EMRP A169: Call 2012 Metrology for Industry (II) IATED

Valencia, Spain

Barcelona, Spain 6th International Conference on Education and New Learning Technologies 6-7/07/2014 30 978-84-617-0557-3 2340-1117 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. FMMartínez-Verdú VViqueira EPerales EChorro proceedings Proceedings of 23rd Congress of the International Commission for Optics 2015 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 84-123 Color differences, Colorimetry, Color measurements, STRESS, Goniochormatism http://ico23.org/site/web/varios/welcome.php EMRP A169: Call 2012 Metrology for Industry (II) International Commission for Optics

Orlando

Santiago de Compostela, Spain 23rd Congress of the International Commission for Optics 26-29/08/2041 30 - - 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MMelgosa LGómez-Robledo GCui CLi EPerales FMMartínez-Verdí TDauser proceedings Proceedings of 23rd Congress of the International Commission for Optics 2015 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 1 Goniochormatism, Color measurements, BRDF http://hdl.handle.net/10261/111907 EMRP A169: Call 2012 Metrology for Industry (II) International Commission for Optics

Orlando

Santiago de Compostela, Spain 23rd Congress of the International Commission for Optics 26-29/08/2014 30 N/A N/A 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Ferrero J.Campos E.Perales A.Rabal F.Martínez-Verdú A.Pons E.Chorro M.L.Hernanz proceedings Proceedings of 23rd Congress of the International Commission for Optics 2015 1 1 IND52: XD Reflect: Multidimensional reflectometry for industry 1-4 effect coatings, goniochromatic , color measurement, BRDF http://hdl.handle.net/10261/111835 EMRP A169: Call 2012 Metrology for Industry (II) Proceedings of 23rd Congress of the International Commission for Optics

Orlando

Santiago de Compostela, Spain Proceedings of 23rd Congress of the International Commission for Optics 26-29/08/2014 30 N/A N/A 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.Perales A.Ferrero E.Chorro V.Viqueira A.Rabal F.Martínez-Verdú A.Pons J.Campos proceedings Proceedings of Forum des microscopies à sonde locale 2015 11 2015 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom p 11-12 metrological atomic force microscopy, virtual instrument, modelling, Monte Carlo method, measurement uncertainty http://www.sondeslocales.fr/livret2015 EMRP A169: Call 2012 Metrology for Industry (II) Rouilly-Sacey, France Forum des microscopies à sonde locale March 16-20, 2015 37 59 No, EURAMET is never allowed to make the publication publicly available. P.Ceria S.Ducourtieux Y.Boukellal article Measurement Science Review 2015 14 4 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 10.2478, p 213-218 laser spectroscopy, metrology, molecular iodine, absorption cells, frequency doubling, interferometry http://www.degruyter.com/view/j/msr.2014.14.issue-4/msr-2014-0029/msr-2014-0029.xml EMRP A169: Call 2012 Metrology for Industry (II) De Gruyter Open Sp. z o.o.

Berlin

30 10.2748/msr-2014-0029 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Hrabina O.Acef F.du Burck N.Chiodo Y.Candela M.Sarbort M.Hola J.Lazar proceedings RoscoeFVCW2015 23rd International Conference on Electricity Distribution 2015 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics Smart grids, Distribution grid sensor networks, Sensor placement algorithm, Power flow, Electrical engineering SEG http://cired.net/publications/cired2015/papers/CIRED2015_0779_final.pdf EMRP A169: Call 2013 Energy II Lyon, France International Conference on Electricity Distribution 15-06-2015 to 18-06-2015 30 2032-9644 NA AndrewRoscoe AlistairForbes AlbertoVenturi PaulClarkson PaulWright article IEEE Photon. Techn. Lett. 2015 25 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 1711-1714 Coherent optical links, frequency comparisons of optical clocks, optical amplifiers http://arxiv.org/abs/1211.3910 EMRP A169: Call 2011 SI Broader Scope 30 10.1109/LPT.2013.2273269 1 59 No, EURAMET is never allowed to make the publication publicly available. C.Clivati G.Bolognini D.Calonico S.Faralli F.Levi A.Murra N.Poli article Phys. Chem. Chem. Phys. 2015 17 14 HLT10: BiOrigin : Metrology for biomolecular origin of disease 8660-8669 http://pubs.rsc.org/en/content/articlelanding/2015/cp/c4cp05506c#!divAbstract EMRP A169: Call 2011 Metrology for Health RSC Publishing

Cambridge

30 10.1039/C4CP05506C 1 59 No, EURAMET is never allowed to make the publication publicly available. Flaviu S.Cipcigan Vlad P.Sokhan Andrew P.Jones JasonCrain Glenn J.Martyna article Applied Radiation and Isotopes 2015 107 2016 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities 206–213. Modeling Beta-rays Transmission Planar geometry http://www.journals.elsevier.com/applied-radiation-and-isotopes/ EMRP A169: Call 2013 Environment II ELSEVIER

Amsterdam, The Netherlands

30 0969-8043 10.1016/j.apradiso.2015.10.024 1 59 No, EURAMET is never allowed to make the publication publicly available. D.Stanga P.De Felice J.Keightley M.Capogni E.Ionescu article Low contact resistance in epitaxial graphene devices 2015 5 8 SIB51: GraphOhm: Quantum resistance metrology based on graphene 087134 epitaxial graphene, monolayer, measurement, Quantum Hall, bilayer, graphene, chemical sciences, Kemi http://urn.kb.se/resolve?urn=urn:nbn:se:liu:diva-122071 EMRP A169: Call 2012 SI Broader scope (II) AMER INST PHYSICS 30 10.1063/1.4928653 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.Yager A.Lartsev K.Cedergren R.Yakimova V.Panchal O.Kazakova A.Tzalenchuk K.Ho Kim Y.Woo Park S.Lara-Avila S.Kubatkin article J. Acoust. Soc. Am. 2015 136 4 HLT03: DUTy: Dosimetry for ultrasound therapy 1499-1510 Ultrasound, Modelling, Bone, Elastic, HIFU EMRP A169: Call 2011 Metrology for Health ASA 30 10.1121/1.4894790 1 59 No, EURAMET is never allowed to make the publication publicly available. BETreeby BTCox article Ultrasonics 2015 56 HLT03: DUTy: Dosimetry for ultrasound therapy 210–219 Sound speed Attenuation coefficient Tissue-mimicking material Uncertainty evaluation Ultrasound EMRP A169: Call 2011 Metrology for Health Elsevier 30 10.1016/j.ultras.2014.03.018 1 59 No, EURAMET is never allowed to make the publication publicly available. R.Cuccaro C.Musacchio P.A.Giuliano Albo A.Troia S.Lago proceedings Physics Procedia 2015 70 HLT03: DUTy: Dosimetry for ultrasound therapy 187 – 190 Temperature increase; attenuation coefficient; tissue-mimicking materials EMRP A169: Call 2011 Metrology for Health Elsevier B.V. Metz (France) 2015 International Congress on Ultrasonics 10-05-2015 to 14-05-2015 30 10.1016/j.phpro.2015.08.109 1 59 No, EURAMET is never allowed to make the publication publicly available. R.Cuccaro C.Magnetto P.A.Giuliano Albo A.Troia S.Lago article Medical Physics 2015 42 12 HLT11: MetroMRT: Metrology for molecular radiotherapy 6885-6894 nuclear medicine, GATE, Monte Carlo simulations, SPECT, dosimetry EMRP A169: Call 2011 Metrology for Health American Association of Physicists in Medicine

Alexandria

30 0094-2405 10.1118/1.4934828 1 59 No, EURAMET is never allowed to make the publication publicly available. MPGarcia DVilloing EMcKay LFerrer MCremonesi FBotta MFerrari MBardiès article Applied Radiation and Isotopes 2015 97 - HLT11: MetroMRT: Metrology for molecular radiotherapy 170 176 Radionuclide metrology, SIR-Spheres standardization, 90Y-labelled resin microspheres, Dissolution of ion exchange resin, TDCR method, Calibration factors of ionization chambers - EMRP A169: Call 2011 Metrology for Health ELSEVIER

Amsterdam

30 0969 8043 10.1016/j.apradiso.2014.12.024 1 59 No, EURAMET is never allowed to make the publication publicly available. http://www.sciencedirect.com/science/article/pii/S0969804314004515 VLLourenço CBBobin VCChisté DLLacour FRRigoulay MTTapner CTThiam LFFerreux inbook 2015 N/A SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 185-250 Vector Network Analyzers, Metallic waveguides, Network Analyzer Calibration Standards and Methods, Network Analyzer Errors and Uncertainties EMRP A169: Call 2012 SI Broader scope (II) Artech House

Norwood, USA

Terahertz Metrology 30 978-1-60807-777-9 59 No, EURAMET is never allowed to make the publication publicly available. http://www.artechhouse.com/International/books/2233.aspx R. G.Clarke N. M.Ridler article Applied Radiation and Isotopes 2015 109 SPECIAL ISSUE: ICRM 2015 HLT11: MetroMRT: Metrology for molecular radiotherapy 410-413 Short-lived radionuclides; 4πγ integral counting; TDCR; β–γ coincidences; SIRTI; IC calibration http://www.journals.elsevier.com/applied-radiation-and-isotopes EMRP A169: Call 2011 Metrology for Health Elsevier

AMSTERDAM (NETHERLANDS)

30 0969-8043 10.1016/j.apradiso.2015.12.055 1 59 No, EURAMET is never allowed to make the publication publicly available. http://www.sciencedirect.com/science/article/pii/S0969804315303961 M.C.CAPOGNI P.C.CARCONI P.DF.De FELICE A.F.FAZIO article Applied Physics B 2015 120 2 IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments 329-339 QUANTUM-CASCADE LASER; INJECTION-LASER; SEMICONDUCTOR-LASERS; NARROW-LINEWIDTH; SELF-LOCKING; MU-M; SPECTROMETER; REGIMES; NOISE; POWER http://link.springer.com/article/10.1007/s00340-015-6140-y EMRP A169: Call 2012 Metrology for Industry (II) Springer

New York

30 0946-2171 10.1007/s00340-015-6140-y 1 59 No, EURAMET is never allowed to make the publication publicly available. KMManfred LCiaffoni GADRitchie article ChenHG2015 2015 IEEE MTT-S International Microwave Workshop... 2015 SIB51: GraphOhm: Quantum resistance metrology based on graphene Graphene, Substrates, Resonant frequency, Microwave amplifiers, Dielectrics, Microwave oscillator, NEMS, Dielectric microwave resonators, graphene, carbon nanotubes EMRP A169: Call 2012 SI Broader scope (II) IEEE

US & Canada

30 10.1109/IMWS-AMP.2015.7324929 NA JieChen LingHao JohnGallop article LALEREHFCP2015 Revue française de métrologie 2015 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 3-12 HAP, méthode de référence, limite de quantification, incertitude, spe disque EMRP A169: Call 2010 Environment EDP Sciences 37 1772-1792, 1776-3215 10.1051/rfm/2015014 NA B.Lalère S.Hein C.FALLOT J.Cabillic R.Philipp article PHYSICAL REVIEW A 2014 12 22 90 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks EMRP A169: Call 2011 SI Broader Scope 30 10.1103/PhysRevA.90.061802 59 No, EURAMET is never allowed to make the publication publicly available. A.Bercy F.Stefani O.Lopez C.Chardonnet P.-E.Pottie A.Amy-Klein article Numerical Heat Transfer, Part A 2014 12 10 67 not available SIB64: METefnet: Metrology for moisture in materials 605–631 Benchmark solutions, Finite element method, Stability analysis, Laminar free convection, Time-periodic oscillating flow field, Heat transfer coefficient calculation. EMRP A169: Call 2011 Metrology for New Technologies Taylor & Francis

London

30 1040-7782 print=1521-0634 online 10.1080/10407782.2014.949133 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Arpino G.Cortellessa A.Mauro proceedings 84th ARFTG Microwave Measurement Conference (ARFTG) 2014 12 4 N/A N/A SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits N/A Measurement repeatability, Submillimeter-wave measurements, VNA measurements, Waveguide flanges, Waveguide interfaces, Waveguide measurements http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7013405 EMRP A169: Call 2012 SI Broader scope (II) Institute of Electrical and Electronics Engineers (IEEE)

New York, USA

Boulder, Colorado, USA 84th ARFTG Microwave Measurement Conference (ARFTG) 04-12-2014 to 05-12-2014 30 N/A N/A 10.1109/ARFTG.2014.7013405 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. N. M.Ridler R. G.Clarke article Journal of the Optical Society of America A 2014 12 3 32 1 IND52: XD Reflect: Multidimensional reflectometry for industry 1-11 OCIS codes: (330.1710) Color, measurement; (330.1720) Color vision; (290.1483) BSDF, BRDF, and BTDF. https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-1-1 EMRP A169: Call 2012 Metrology for Industry (II) OSA

Washington, DC, USA

30 1084-7529 (print), 1520-8532 (online) 10.1364/JOSAA.32.000001 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. AFerrero JCampos EPerales F. M.Martínez-Verdú Ivan der Lans EKirchner article Applied Physics B 2014 12 117 3 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 979 - 986 EMRP A169: Call 2011 SI Broader Scope 30 10.1007/s00340-014-5917-8 1 59 No, EURAMET is never allowed to make the publication publicly available. D.Calonico E. K.Bertacco C. E.Calosso C.Clivati G. A.Costanzo M.Frittelli A.Godone A.Mura N.Poli D. V.Sutyrin G.Tino M. E.Zucco F.Levi article RaffaeleLCCVVPPMRT2014 Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment 2014 12 767 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 310-317 synthetic diamond detector, proton beam, ocular therapy EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 0168-9002 10.1016/j.nima.2014.09.004 NA L.Raffaele R.M.La Rosa G.Cuttone G.A.P.Cirrone G.Verona-Rinati C.Verona G.Prestopino F.Pompili M.Marinelli F.Romano C.Tuvè article GilabertBLMRCMB2014 International Journal of Thermophysics 2014 11 28 36 2-3 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 589-601 Air temperature, Calibration facility, Calibration uncertainty, Climate, change analysis, Historical temperature data series, Metrology for meteorology and climate, Traceability EMRP A169: Call 2010 Environment Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-014-1806-y NA A.Gilabert F.Bertiglia G.Lopardo A.Merlone G.Roggero D.Cat Berro L.Mercalli M.Brunet article RastelloDSKCPSMIKSHKTBMPTACMKV2014 Metrologia 2014 11 20 51 6 IND06: MIQC: Metrology for Industrial Quantum Communications 10 Metrology, quantum cryptography, quantum communication http://iopscience.iop.org/0026-1394/ A169 EMRP A169: Call 2010 Industry English 0026-1394 10.1088/0026-1394/51/6/S267 1 59 NA M LRastello I PDegiovanni A GSinclair SKück C JChunnilall GPorrovecchio MSmid FManoocheri EIkonen TKubarsepp DStucki K SHong S KKim ATosi GBrida AMeda FPiacentini PTraina AAl Natsheh J YCheung IMüller RKlein AVaigu article ChunnilallLAHS2014 Metrologia 2014 11 20 51 6 IND06: MIQC: Metrology for Industrial Quantum Communications 10 Metrology, quantum key distribution, single-photon http://iopscience.iop.org/0026-1394/ A169 EMRP A169: Call 2010 Industry English 0026-1394 10.1088/0026-1394/51/6/S258 1 59 NA C JChunnilall GLepert J JAllerton C JHart A GSinclair article IEEE Transactions on Applied Superconductivity 2014 11 20 25 3 NEW08: MetNEMS: Metrology with/for NEMS 1602604 SQUIDs, nanoscale Dayem bridges, nanoSUQID, metrology http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=&arnumber=6960081&url=http%3A%2F%2Fieeexplore.ieee.org%2Fxpls%2Fabs_all.jsp%3Farnumber%3D6960081 EMRP A169: Call 2011 Metrology for New Technologies IEEE

New York

30 1051-8223 10.1109/TASC.2014.2371696 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SBechstein FRuede DDrung J.-H.Storm CKöhn O. F.Kieler J.Kohlmann T.Weimann TPatel BLi DCox J. C.Gallop L.Hao TSchurig article SchneidmillerBCTSSZRYSBY2014 Physical Review Special Topics - Accelerators and Beams 2014 11 18 17 11 SIB58: Angles: Angle metrology synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors EMRP A169: Call 2012 SI Broader scope (II) American Physical Society (APS) 30 1098-4402 10.1103/PhysRevSTAB.17.110705 NA E.Schneidmiller A.Buzmakov O.Chubar Th.Tschentscher H.Sinn L.Samoylova H.Zacharias S.Roling M. V.Yurkov F.Siewert S.Braun T.Yandayan article Review of Scientific Instruments 2014 11 12 85 IND14: Frequency: New generation of frequency standards for industry EMRP A169: Call 2010 Industry 30 0034-6748 10.1063/1.4898334 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Q.-F.Chen A.Nevsky M.Cardace S.Schiller T.Legero S.Häfner A.Uhde U.Sterr article GiordanoZBCB2014 IEEE TRANSACTIONS ON MAGNETICS 2014 11 11 50 11 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI Boundary element methods (BEM), electromagnetic (EM) fields, electromagnetic measurements, finite element methods (FEM), magnetic resonance imaging (MRI) A169 EMRP A169: Call 2011 Metrology for Health English 0018-9464 10.1109/TMAG.2014.2323428 1 59 NA DomenicoGiordano LucaZilberti MicheleBorser MarioChiampi OrianoBottauscio article IEEE Transactions on Applied Superconductivity 2014 11 6 25 3 NEW08: MetNEMS: Metrology with/for NEMS 2200304 Transition-edge sensors, photons, photon-number resolving detectors http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6949073 EMRP A169: Call 2011 Metrology for New Technologies IEEE

Unknown

30 1051-8223 10.1109/TASC.2014.2367469 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. ETaralli LLolli CPortesi MRajteri EMonticone T. S.Wang J. K.Chen XZhou article MaringerSKCPGCDVHRMSJDTAHM2014 Applied Radiation and Isotopes 2014 11 81 ENV09: MetroRWM: Metrology for Radioactive Waste Management Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal http://www.sciencedirect.com/ A169 EMRP A169: Call 2010 Environment English 0969-8043 10.1016/j.apradiso.2013.03.046 1 59 NA F.J.Maringer J.Šuráň P.Kovář B.Chauvenet V.Peyres E.García-Toraño M.L.Cozzella P.De Felice B.Vodenik M.Hult U.Rosengård M.Merimaa L.Szücs C.Jeffery J.C.J.Dean Z.Tymińsk D.Arnold R.Hincam G.Mirescu article ZilbertiBCHLC2014 IEEE TRANSACTIONS ON MAGNETICS 2014 11 50 11 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI Dosimetry, finite element–boundary element method, magnetic resonance imaging (MRI), medical implants, Pennes’ bioheat equation. A169 EMRP A169: Call 2011 Metrology for Health English 0018-9464 10.1109/TMAG.2014.2323119 1 59 NA LucaZilberti OrianoBottauscio MarioChiampi JeffHand Hector SanchezLopez StuartCrozier article CorteLeonKSMAK2014 IEEE 2014 11 50 11 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems Magnetic domain walls (DWs), magnetic sensors, micromagnetics, nanostructures, numerical simulations http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6971343 A169 EMRP A169: Call 2012 Open excellence call English 0018-9464 10.1109/TMAG.2014.2327803 1 59 NA H.Corte-León P.Krzysteczko H. W.Schumacher A.Manzin V.Antonov O.Kazakova article RoggeroBCVVM2014 Atmospheric and Climate Sciences 2014 11 04 05 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 796-802 Automatic Weather Station, Himalaya, Climate Monitoring, AWSs Calibration, QA/QC Procedure EMRP A169: Call 2010 Environment Scientific Research Publishing Inc 30 2160-0414, 2160-0422 10.4236/acs.2014.45070 NA G.Roggero P.Bonasoni P.Cristofanelli G.PVerza E.Vuillermoz A.Merlone article IEEE Transactions on Applied Superconductivity 2014 10 24 25 3 NEW08: MetNEMS: Metrology with/for NEMS 1602105 SQUIDs, Noise, Junctions, Critical current density (superconductivity), Nanoscale devices, Preamplifiers, Niobium http://ieeexplore.ieee.org/document/6936295/?reload=true&arnumber=6936295 EMRP A169: Call 2011 Metrology for New Technologies IEEE

Melville

30 1051-8223 10.1109/TASC.2014.2364920 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. TPatel BLi JGallop DCox KKirby ERomans JChen ANisbet LHao article TesaovaBGWERCTSJNMMN2014 Physical Review B 2014 10 23 90 15 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems Comparison of micromagnetic parameters of the ferromagnetic semiconductors (Ga,Mn)(As,P) and (Ga,Mn)As EMRP A169: Call 2012 Open excellence call American Physical Society (APS)

1 Research Rd, Ridge, NY 11961, USA

30 1098-0121, 1550-235X 10.1103/PhysRevB.90.155203 NA N.Tesařová D.Butkovičová B. L.Gallagher P.Wadley K. W.Edmonds A. W.Rushforth R. P.Campion F.Trojánek E.