% 
% This file was created by the TYPO3 extension
% bib
% --- Timezone: CEST
% Creation date: 2022-07-06
% Creation time: 13-07-41
% --- Number of references
% 171
% 

@Article { ChaeKKPTKPGYSCCS2022,
   subid = {2653},
   title = {Investigation of the stability of graphene devices for quantum resistance metrology at direct and alternating current},
   journal = {Measurement Science and Technology},
   year = {2022},
   month = {3},
   volume = {33},
   number = {6},
   number2 = {18SIB07: GIQS: Graphene impedance quantum standard},
   pages = {065012},
   keywords = {quantum Hall effect, quantized Hall resistance, graphene, impedance standard,F4-TCNQ doping, stability},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/ac4a1a},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ac4a1a},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chae, D-H. and Kruskopf, M. and Kucera, J. and Park, J. and Tran, N.T.M. and Kim, D.B. and Pierz, K. and G{\"o}tz, M. and Yin, Y. and Svoboda, P. and Chrobok, P. and Cou{\"e}do, F. and Schopfer, F.}
}

@Article { SunGLYCFJWBB2022,
   subid = {2588},
   title = {Establishment of X-ray computed tomography traceability for additively manufactured surface texture evaluation},
   journal = {Additive Manufacturing},
   year = {2022},
   month = {2},
   volume = {50},
   number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry},
   pages = {102558},
   keywords = {Additive manufacturing, Surface texture, Reference standard, X-ray computed tomography},
   web_url = {https://www.sciencedirect.com/science/article/pii/S2214860421007053?via\%3Dihub},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2214-8604},
   DOI = {10.1016/j.addma.2021.102558},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sun, W. and Giusca, C. and Lou, S. and Yang, X. and Chen, X. and Fry, T. and Jiang, X. and Wilson, A. and Brown, S. and Boulter, H.}
}

@Proceedings { ObatonQYLD2022,
   subid = {2583},
   title = {Comparison campaign of XCT systems using machined standards representative of additively manufactured parts},
   journal = {Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022,},
   year = {2022},
   month = {2},
   number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry},
   keywords = {Dimensional metrology, X-ray computed tomography (XCT), Additive Manufacturing (AM), Comparison campaign, round robin test, material measure},
   web_url = {https://www.ndt.net/search/docs.php3?id=26635},
   misc2 = {EMPIR 2017: Industry},
   event_place = {Wels, Austria},
   event_name = {Publication: 11th Conference on Industrial Computed Tomography (iCT) 2022},
   event_date = {08-02-2022 to 11-02-2022},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id207.pdf},
   author = {Obaton, A-F.  and Quagliotte, D. and Yardin, C. and Liltorp, K. and De Chiffre, L.}
}

@Article { DuKJMYCOMZ2022,
   subid = {2748},
   title = {SU(2)-in-SU(1,1) Nested Interferometer},
   journal = {Physical Review Letters},
   year = {2022},
   month = {1},
   day = {20},
   volume = {128},
   number = {3},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   keywords = {SU(1,1) interferometry, spin squeezing, entanglement},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2004.14266},
   author = {Du, W. and Kong, J. and  ., .  and  .,  . and Jia, J. and Ming, S. and Yuan, C-H. and Chen, J.F. and Ou, Z.Y. and Mitchell, M.W. and Zhang, W.}
}

@Article { ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022,
   subid = {2567},
   title = {2022 roadmap on neuromorphic computing and engineering},
   journal = {Neuromorphic Computing and Engineering},
   year = {2022},
   month = {1},
   day = {12},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   keywords = {neuromorphic computing, neuromorphic engineering},
   web_url = {https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2634-4386},
   DOI = {10.1088/2634-4386/ac4a83},
   stag_bib_extends_levelofaccess = {NA},
   author = {Christensen, D.V. and Dittmann, R. and Linares-Barranco, B. and Sebastian, A. and Le Gallo, M. and Redaelli, A. and Slesazeck, S. and Mikolajick, T. and Spiga, S. and Menzel, S. and Valov, I. and Milano, G. and Ricciardi, C. and Liang, S-J. and Miao, F. and Lanza, M. and Quill, T.J. and Keene, S.T. and Salleo, A. and Grollier, J. and Markovic, D. and Mizrahi, A. and Yao, P. and Yang, J.J. and Indiveri, G. and Strachan, J.P. and Datta, S. and Vianello, E. and Valentian, A. and Feldmann, J. and Li, X. and Pernice, W.H.P. and Bhaskaran, H. and Furber, S. and Neftci, E. and Scherr, F. and Maass, W. and Ramaswamy, S. and Tapson, J. and Panda, P. and Kim, Y. and Tanaka, G. and Thorpe, S. and Bartolozzi, C. and Cleland, T.A. and Posch, C. and Liu, S-C. and Panuccio, G. and Mahmud, M. and Mazumder, A.N. and Hosseini, M. and Mohsenin, T. and Donati, E. and Tolu, S. and Galeazzi, R. and Christensen, M.E. and Holm, S. and Ielmini, D. and Pryds, N.}
}

@Article { ClivatiMDVGLMPYSLDC2022,
   subid = {2524},
   title = {Coherent phase transfer for real-world twin-field quantum key distribution},
   journal = {Nature Communications},
   year = {2022},
   month = {1},
   day = {10},
   volume = {13},
   number = {1},
   number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware},
   pages = {s41467-021-27808-1},
   keywords = {QKD, Single photons and quantum effects, Optical metrology, Fibre optics and optical communications, Optoelectronic devices and components, Quantum information},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-021-27808-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clivati, C. and Meda, A. and Donadello, S. and Virz{\`i}, S. and Genovese, M. and Levi, F. and Mura, A. and Pittaluga, M. and Yuan, Z. and Shields, A.J. and Lucamarini, M. and Degiovanni, I.P. and Calonico, D.}
}

@Article { NugrohoHPRYIKPWS2021,
   subid = {2473},
   title = {Vertically Aligned n-Type Silicon Nanowire Array as a Free-Standing Anode for Lithium-Ion Batteries},
   journal = {Nanomaterials},
   year = {2021},
   month = {11},
   day = {20},
   volume = {11},
   number = {11},
   number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices},
   pages = {3137},
   keywords = {silicon nanowire, nanowire array, silicon anode, n-type silicon anode, Li-ion battery},
   misc2 = {EMPIR 2019: Energy},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2079-4991},
   DOI = {10.3390/nano11113137},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nugroho, A.P. and Hawari, N.H. and Prakoso, B. and Refino, A.D. and Yulianto, N. and Iskandar, F. and Kartini, E. and Peiner, E. and Wasisto, H.S. and Sumboja, A.}
}

@Article { ChenYG2021,
   subid = {2319},
   title = {Unidirectional spin-wave propagation and devices},
   journal = {Journal of Physics D: Applied Physics},
   year = {2021},
   month = {11},
   day = {12},
   volume = {55},
   number = {12},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {123001},
   keywords = {magnonics, spin waves, unidirectionality},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0022-3727, 1361-6463},
   DOI = {10.1088/1361-6463/ac31f4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chen, J. and Yu, H. and Gubbiotti, G.}
}

@Article { HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021,
   subid = {2336},
   title = {Frequency drift in MR spectroscopy at 3T},
   journal = {NeuroImage},
   year = {2021},
   month = {11},
   volume = {241},
   number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases},
   pages = {118430},
   keywords = {Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site},
   misc2 = {EMPIR 2018: Health},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1053-8119},
   DOI = {10.1016/j.neuroimage.2021.118430},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hui, S.C.N. and Mikkelsen, M. and Z{\"o}llner, H.J. and Ahluwalia, V. and Alcauter, S. and Baltusis, L. and Barany, D.A. and Barlow, L.R. and Becker, R. and Berman, J.I. and Berrington, A. and Bhattacharyya, P.K. and Blicher, J.U. and Bogner, W. and Brown, M.S. and Calhoun, V.D. and Castillo, R. and Cecil, K.M. and Choi, Y.B. and Chu, W.C.W. and Clarke, W.T. and Craven, A.R. and Cuypers, K. and Dacko, M. and de la Fuente-Sandoval, C. and Desmond, P. and Domagalik, A. and Dumont, J. and Duncan, N.W. and Dydak, U. and Dyke, K. and Edmondson, D.A. and Ende, G. and Ersland, L. and Evans, C.J. and Fermin, A.S.R. and Ferretti, A. and Fillmer, A. and Gong, T. and Greenhouse, I. and Grist, J.T. and Gu, M. and Harris, A.D. and Hat, K. and Heba, S. and Heckova, E. and Hegarty, J.P. and Heise, K-F. and Honda, S. and Jacobson, A. and Jansen, J.F.A. and Jenkins, C.W. and Johnston, S.J. and Juchem, C. and Kangarlu, A. and Kerr, A.B. and Landheer, K. and Lange, T. and Lee, P. and Levendovszky, S.R. and Limperopoulos, C. and Liu, F. and Lloyd, W. and Lythgoe, D.J. and Machizawa, M.G. and MacMillan, E.L. and Maddock, R.J. and Manzhurtsev, A.V. and Martinez-Gudino, M.L. and Miller, J.J. and Mirzakhanian, H. and Moreno-Ortega, M. and Mullins, P.G. and Nakajima, S. and Near, J. and Noeske, R. and Nordh{\o}y, W. and Oeltzschner, G. and Osorio-Duran, R. and Otaduy, M.C.G. and Pasaye, E.H. and Peeters, R. and Peltier, S.J. and Pilatus, U. and Polomac, N. and Porges, E.C. and Pradhan, S. and Prisciandaro, J.J. and Puts, N.A. and Rae, C.D. and Reyes-Madrigal, F. and Roberts, T.P.L. and Robertson, C.E. and Rosenberg, J.T. and Rotaru, D-G. and O'Gorman Tuura, R.L. and Saleh, M.G. and Sandberg, K. and Sangill, R. and Schembri, K. and Schrantee, A. and Semenova, N.A. and Singel, D. and Sitnikov, R. and Smith, J. and Song, Y. and Stark, C. and Stoffers, D. and Swinnen, S.P. and Tain, R. and Tanase, C. and Tapper, S. and Tegenthoff, M. and Thiel, T. and Thioux, M. and Truong, P. and van Dijk, P. and Vella, N. and Vidyasagar, R. and Vovk, A. and Wang, G. and Westlye, L.T. and Wilbur, T.K. and Willoughby, W.R. and Wilson, M. and Wittsack, H-J. and Woods, A.J. and Wu, Y-C. and Xu, J. and Lopez, M.Y. and Yeung, D.K.W. and Zhao, Q. and Zhou, X. and Zupan, G. and Edden, R.A.E.}
}

@Article { RefinoYSNHSKIVSPW2021,
   subid = {2474},
   title = {Versatilely tuned vertical silicon nanowire arrays by cryogenic reactive ion etching as a lithium-ion battery anode},
   journal = {Scientific Reports},
   year = {2021},
   month = {10},
   volume = {11},
   number = {1},
   number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices},
   keywords = {high-aspect-ratio silicon (Si), nanowire array, lithium ion batteries, ICP-RIE},
   web_url = {https://www.nature.com/articles/s41598-021-99173-4},
   misc2 = {EMPIR 2019: Energy},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-021-99173-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Refino, A.D. and Yulianto, N. and Syamsu, I. and Nugroho, A.P. and Hawari, N.H. and Syring, A. and Kartini, E. and Iskandar, F. and Voss, T. and Sumboja, A. and Peiner, E. and Wasisto, H.S.}
}

@Article { RottgerRGVCOHCCBIRKCAYFMM2021,
   subid = {2224},
   title = {New metrology for radon at the environmental level},
   journal = {Measurement Science and Technology},
   year = {2021},
   month = {9},
   day = {23},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   keywords = {radon, metrology, tracer, environmental measurements},
   misc2 = {EMPIR 2019: Environment},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ac298d},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"o}ttger, A. and R{\"o}ttger, S. and Grossi, C. and Vargas, A. and Curcoll, R. and Ot{\'a}hal, P. and Hern{\'a}ndez-Ceballos, M.{\'A}. and Cinelli, G. and Chambers, S. and Barbosa, S.A. and Ioan, M-R. and Radulescu, I. and Kikaj, D. and Chung, E. and Arnold, T. and Yver Kwok, C. and Fuente, M. and Mertes, F. and Morosh, V.}
}

@Proceedings { WeidingerDLYKZEMZ2021,
   subid = {2253},
   title = {Need for a traceable efficiency determination method of nacelles performed on test benches},
   journal = {Measurement: Sensors},
   year = {2021},
   month = {9},
   day = {23},
   volume = {18},
   number2 = {19ENG08: WindEFCY: Traceable mechanical and electrical power measurement for efficiency determination of wind turbines},
   pages = {100159},
   keywords = {nacelle test bench, wind turbine power curves, direct efficiency determination, mechanical power measurement, electrical power measurement},
   misc2 = {EMPIR 2019: Energy},
   publisher = {Elsevier BV},
   event_place = {Yokohama, JAPAN},
   event_name = {XXIII IMEKO World Congress},
   event_date = {30-08-2021 to 03-09-2021},
   language = {30},
   ISSN = {2665-9174},
   DOI = {10.1016/j.measen.2021.100159},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weidinger, P. and Dubowik, A. and Lehrmann, C. and Yogal, N. and Kumme, R. and Zweiffel, M. and Eich, N. and Mester, C. and Zhang, H.}
}

@Proceedings { SongWEZYK2021,
   subid = {2252},
   title = {10 MW mechanical power transfer standard for nacelle test benches using a torque transducer and an inclinometer},
   journal = {Measurement: Sensors},
   year = {2021},
   month = {9},
   day = {22},
   volume = {18},
   number2 = {19ENG08: WindEFCY: Traceable mechanical and electrical power measurement for efficiency determination of wind turbines},
   pages = {100249},
   keywords = {nacelle test bench, wind turbine, inclinometer, rotational speed measurement, mechanical power measurement},
   misc2 = {EMPIR 2019: Energy},
   publisher = {Elsevier BV},
   event_place = {Yokohama, JAPAN},
   event_name = {XXIII IMEKO World Congress},
   event_date = {30-08-2021 to 03-09-2021},
   language = {30},
   ISSN = {2665-9174},
   DOI = {10.1016/j.measen.2021.100249},
   stag_bib_extends_levelofaccess = {NA},
   author = {Song, Z. and Weidinger, P. and Eich, N. and Zhang, H. and Yogal, N. and Kumme, R.}
}

@Article { YaoMGZKK2021,
   subid = {2189},
   title = {Induced radiofrequency fields in patients undergoing MR examinations: insights for risk assessment},
   journal = {Physics in Medicine \& Biology},
   year = {2021},
   month = {9},
   day = {15},
   volume = {66},
   number = {18},
   number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations},
   pages = {185014},
   keywords = {MR safety, electromagnetic modelling, specific power absorption},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/ac212d},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yao, A. and Murbach, M. and Goren, T. and Zastrow, E. and Kainz, W. and Kuster, N.}
}

@Article { YamakawaATBFBKRD2021,
   subid = {2038},
   title = {Hg isotopic composition of one-year-old spruce shoots: Application to long-term Hg atmospheric monitoring in Germany},
   journal = {Chemosphere},
   year = {2021},
   month = {9},
   volume = {279},
   number2 = {16ENV01: MercOx: Metrology for oxidised mercury},
   pages = {130631},
   keywords = {Hg isotopic composition,  spruce shoots,  Hg atmospheric monitoring},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0045-6535},
   DOI = {10.1016/j.chemosphere.2021.130631},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yamakawa, A. and Amouroux, D. and Tessier, E. and B{\'e}rail, S. and Fettig, I. and Barre, J.P.G. and Koschorreck, J. and R{\"u}del, H. and Donard, O.F.X.}
}

@Article { FerreroBCVHYACMT2021,
   subid = {2146},
   title = {Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes},
   journal = {Nanomaterials},
   year = {2021},
   month = {8},
   day = {25},
   volume = {11},
   number = {9},
   number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept},
   pages = {2179},
   keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations},
   misc2 = {EMPIR 2018: Health},
   publisher = {MDPI},
   language = {30},
   ISSN = {2079-4991},
   DOI = {10.3390/nano11092179},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ferrero, R. and Barrera, G. and Celegato, F. and Vicentini, M. and H{\"u}seyin, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.}
}

@Article { CorcolesYK2021,
   subid = {2190},
   title = {Experimental and numerical optimization modelling to reduce radiofrequency-induced risks of magnetic resonance examinations on leaded implants},
   journal = {Applied Mathematical Modelling},
   year = {2021},
   month = {8},
   volume = {96},
   number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations},
   pages = {177-188},
   keywords = {MR safety, implant safety, RF induced heating},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0307-904X},
   DOI = {10.1016/j.apm.2021.02.036},
   stag_bib_extends_levelofaccess = {NA},
   author = {C{\'o}rcoles, J. and Yao, A. and Kuster, N.}
}

@Article { ZhangWLLWYLSC2021,
   subid = {2737},
   title = {Rabi Spectroscopy and Sensitivity of a Floquet Engineered Optical Lattice Clock},
   journal = {Chinese Physics Letters},
   year = {2021},
   month = {7},
   volume = {38},
   number = {7},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   pages = {073201},
   keywords = {Floquet, lattice clock, Rabi spectroscopy},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0256-307X, 1741-3540},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/pdf/2007.00851.pdf},
   author = {Zhang, X-F. and Wang, Y-B. and Li, T. and Lu, X-T. and Wang, T. and Yin, M-J. and Li, W-D. and Smerzi, A. and Chang, H.}
}

@Article { ZhangWLLWYLSC2021_2,
   subid = {2737},
   title = {Rabi Spectroscopy and Sensitivity of a Floquet Engineered Optical Lattice Clock},
   journal = {Chinese Physics Letters},
   year = {2021},
   month = {7},
   volume = {38},
   number = {7},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   pages = {073201},
   keywords = {Floquet, lattice clock, Rabi spectroscopy},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0256-307X, 1741-3540},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/pdf/2007.00851.pdf},
   author = {Zhang, X-F. and Wang, Y-B. and Li, T. and Lu, X-T. and Wang, T. and Yin, M-J. and Li, W-D. and Smerzi, A. and Chang, H.}
}

@Article { PrzyklenkBOEYAFPZCMRB2021,
   subid = {2104},
   title = {New European Metrology Network for Advanced Manufacturing},
   journal = {Measurement Science and Technology},
   year = {2021},
   month = {6},
   day = {21},
   number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing},
   keywords = {Advance Manufacturing, Metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), Stakeholder},
   misc2 = {EMPIR 2019: Support for Networks},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ac0d25},
   stag_bib_extends_levelofaccess = {NA},
   author = {Przyklenk, A. and Balsamo, A. and O'Connor, D. and Evans, A. and Yandayan, T. and Akg{\"o}z, A. and Flys, O. and Phillips, D. and Zelen{\'y}, V. and Czułek, D. and Meli, F. and Ragusa, C. and Bosse, H.}
}

@Proceedings { PrzyklenkBOEYAFZCPMRB2021,
   subid = {2123},
   title = {AdvManuNet: Support for a European Metrology Network for Advanced Manufacturing},
   journal = {Proceedings 21st euspen International Conference and Exhibition},
   year = {2021},
   month = {6},
   volume = {2021},
   number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing},
   keywords = {advanced manufacturing, metrology, European metrology networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0},
   misc2 = {EMPIR 2019: Support for Networks},
   event_place = {Online Conference},
   event_name = {21st euspen International Conference and Exhibition},
   event_date = {07-06-2021 to 10-06-2021},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base//ICE21292.pdf},
   author = {Przyklenk, A. and Balsamo, A. and O’Connor, D. and Evans, A. and Yandayan, T. and Akg{\"o}z, S. and Flys, O. and Zelen{\'y}, V. and Czułek, D. and Phillips, D. and Meli, F. and Ragusa, C. and Bosse, H.}
}

@Article { KusterYGKS2021,
   subid = {2191},
   title = {Radiofrequency‐induced heating of broken and abandoned implant leads during magnetic resonance examinations},
   journal = {Magnetic Resonance in Medicine},
   year = {2021},
   month = {6},
   volume = {86},
   number = {4},
   number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations},
   pages = {2156-2164},
   keywords = {magnetic resonance imaging, MR safety, implant safety, abandoned leads},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Wiley},
   language = {30},
   ISSN = {0740-3194, 1522-2594},
   DOI = {10.1002/mrm.28836},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kuster, N. and Yao, A. and Goren, T. and Kainz, W. and Samaras, T.}
}

@Article { KalincevDKYFM2021,
   subid = {2476},
   title = {Motional heating of spatially extended ion crystals},
   journal = {Quantum Science and Technology},
   year = {2021},
   month = {5},
   volume = {6},
   number = {3},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   pages = {034003},
   keywords = {multi-ion clocks, vibrational mode heating, ion Coulomb crystals, precision metrology, radio frequency noise},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2058-9565},
   DOI = {10.1088/2058-9565/abee99},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kalincev, D. and Dreissen, L.S. and Kulosa, A.P. and Yeh, C-H. and F{\"u}rst, H.A. and Mehlst{\"a}ubler, T.E.}
}

@Article { LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021,
   subid = {2093},
   title = {Roadmap on quantum nanotechnologies},
   journal = {Nanotechnology},
   year = {2021},
   month = {2},
   volume = {32},
   number = {16},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {162003},
   keywords = {Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-4484, 1361-6528},
   DOI = {10.1088/1361-6528/abb333},
   stag_bib_extends_levelofaccess = {NA},
   author = {Laucht, A. and Hohls, F. and Ubbelohde, N. and Fernando Gonzalez-Zalba, M. and Reilly, D.J. and Stobbe, S. and Schr{\"o}der, T. and Scarlino, P. and Koski, J.V. and Dzurak, A. and Yang, C-H. and Yoneda, J. and Kuemmeth, F. and Bluhm, H. and Pla, J. and Hill, C. and Salfi, J. and Oiwa, A. and Muhonen, J.T. and Verhagen, E. and LaHaye, M.D. and Kim, H.H. and Tsen, A.W. and Culcer, D. and Geresdi, A. and Mol, J.A. and Mohan, V. and Jain, P.K. and Baugh, J.}
}

@Article { YeZR2021,
   subid = {2533},
   title = {Verification of a Capacitive Voltage Divider With 6-\(\mu\)rad Uncertainty Up To 100 kV},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2021},
   volume = {70},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   pages = {1-9},
   keywords = {Uncertainty, Voltage measurement, Calibration, Capacitors, Current measurement, Power transformers,Loss measurement},
   tags = {SEG},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2021.3056647},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ye, G. and Zhao, W. and Rietveld, G.}
}

@Article { YrjanaSIKLB2020,
   subid = {2182},
   title = {Potentiometric Carboxylate Sensors Based on Carbazole-Derived Acyclic and Macrocyclic Ionophores},
   journal = {Chemosensors},
   year = {2020},
   month = {12},
   day = {24},
   volume = {9},
   number = {1},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   pages = {4},
   keywords = {ion-selective electrodesanion receptorsionophorescarboxylateelectrode shell material},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2227-9040},
   DOI = {10.3390/chemosensors9010004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yrj{\"a}n{\"a}, V. and Saar, I. and Ilisson, M. and Kadam, S.A. and Leito, I. and Bobacka, J.}
}

@Proceedings { DurgutYHMU2020,
   subid = {1974},
   title = {(50-400) MPa Aralığında İzlenebilir Dinamik Basın\c{c}{\"O}l\c{c}{\"u}mleri},
   journal = {Academic Perspective Procedia},
   year = {2020},
   month = {10},
   day = {25},
   volume = {3},
   number = {1},
   number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures},
   pages = {658-664},
   keywords = {Dinamik, basın\c{c}, kalibrasyon, dinamik sens{\"o}r, k{\"u}tle d{\"u}ş{\"u}rmesli sistem},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Academic Perspective},
   event_place = {Bursa, Turkey},
   event_name = {8th International Symposium on Innovative Technologies in Engineering and Science (ISITES2020)},
   event_date = {23-10-2020 to 25-10-2020},
   language = {126},
   ISSN = {2667-5862},
   DOI = {10.33793/acperpro.03.01.120},
   stag_bib_extends_levelofaccess = {NA},
   author = {Durgut, Y. and Yilmaz, R. and Hamarat, A. and Meral, İ. and Uslukılı\c{c}, U.}
}

@Article { FurstYKKDLBHPM2020,
   subid = {1650},
   title = {Coherent Excitation of the Highly Forbidden Electric Octupole Transition in Yb+172},
   journal = {Physical Review Letters},
   year = {2020},
   month = {10},
   day = {16},
   volume = {125},
   number = {16},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   pages = {163001},
   keywords = {Atomic spectra, Optical clocks, Coherent control, Cooling \& trapping, Laser spectroscopy, Trapped Ions},
   web_url = {https://link.aps.org/doi/10.1103/PhysRevLett.125.163001},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.125.163001},
   stag_bib_extends_levelofaccess = {NA},
   author = {F{\"u}rst, H.A. and Yeh, C.H. and Kalincev, D. and Kulosa, A.P. and Dreissen, L.S. and Lange, R. and Benkler, E. and Huntemann, N. and Peik, E. and Mehlst{\"a}ubler, T.E.}
}

@Article { HuntMSPYWD2020,
   subid = {2218},
   title = {Comparison of the Sentinel-3A and B SLSTR Tandem Phase Data Using Metrological Principles},
   journal = {Remote Sensing},
   year = {2020},
   month = {9},
   volume = {12},
   number = {18},
   number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate},
   pages = {2893},
   keywords = {Sentinel-3A, Copernicus, Tandem-phase data, Earth Observation},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2072-4292},
   DOI = {10.3390/rs12182893},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hunt, S.E. and Mittaz, J.P.D. and Smith, D. and Polehampton, E. and Yemelyanova, R. and Woolliams, E.R. and Donlon, C.}
}

@Proceedings { RietveldZY2020,
   subid = {2534},
   title = {Verification of High Voltage Divider with 10E-6 Uncertainty},
   journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)},
   year = {2020},
   month = {8},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {voltage divider, calibration, high voltage, voltage transformer, uncertainty, loss measurement, power transformer},
   tags = {SEG},
   web_url = {https://zenodo.org/record/5997015},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   event_place = {Denver, CO, USA},
   event_name = {2020 Conference on Precision Electromagnetic Measurements},
   event_date = {24-08-2020 to 28-08-2020},
   language = {30},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM49742.2020.9191889},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, G. and Zhao, W. and Ye, G.}
}

@Article { RuutelYKSIDHHTBL2020,
   subid = {2185},
   title = {Design, synthesis and application of carbazole macrocycles in anion sensors},
   journal = {Beilstein Journal of Organic Chemistry},
   year = {2020},
   month = {8},
   volume = {16},
   number = {2020},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   pages = {1901-1914},
   keywords = {anion sensors; carboxylates;ionophores; acrocycles; sensor prototype},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Beilstein Institut},
   language = {30},
   ISSN = {1860-5397},
   DOI = {10.3762/bjoc.16.157},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"u}{\"u}tel, A. and Yrj{\"a}n{\"a}, V. and Kadam, S.A. and Saar, I. and Ilisson, M. and Darnell, A. and Haav, K. and Haljasorg, T. and Toom, L. and Bobacka, J. and Leito, I.}
}

@Article { KazemipourWHHYRSGZ2020,
   subid = {1603},
   title = {Analytical Uncertainty Evaluation of Material Parameter Measurements at THz Frequencies},
   journal = {Journal of Infrared, Millimeter, and Terahertz Waves},
   year = {2020},
   month = {7},
   day = {24},
   volume = {41},
   number = {10},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {1199 - 1217},
   keywords = {Material characterization, Extraction method, THz domain, Sensitivity coefficient, Measurement uncertainty, RF metrology},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1866-6892, 1866-6906},
   DOI = {10.1007/s10762-020-00723-0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazemipour, A. and Wollensack, M. and Hoffmann, J. and Hudlicka, M. and Yee, S-K. and R{\"u}fenacht, J. and Stalder, D. and G{\"a}umann, G. and Zeier, M.}
}

@Manual { SchonhalsHMHYS2020,
   subid = {1536},
   title = {Good practice guides SmartCom validation},
   year = {2020},
   month = {7},
   number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks},
   keywords = {D-SI validation, DCC validation, SmartCom, TraCIM system, online validation, data exchange format, metrology data},
   web_url = {https://zenodo.org/record/3816696},
   misc2 = {EMPIR 2017: Industry},
   publisher = {SmartCom},
   language = {30},
   DOI = {10.5281/zenodo.3816696},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sch{\"o}nhals, S. and Hutzschenreuther, D. and Muller, B. and Heindorf, L. and Yuhui, L. and Smith, I.}
}

@Article { SixOMLLJHBBLHYTYM2020,
   subid = {1577},
   title = {What can we learn from N2O isotope data? - Analytics, processes and modelling},
   journal = {Rapid Communications in Mass Spectrometry},
   year = {2020},
   month = {6},
   day = {16},
   volume = {34},
   number = {20},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   pages = {14/e8858},
   keywords = {nitrous oxide, isotopic composition, isotope ratio mass spectrometry, laser spectroscopy},
   web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa:22957},
   misc2 = {EMPIR 2016: Environment},
   publisher = {John Wiley \& Sons},
   language = {30},
   DOI = {10.1002/rcm.8858},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yu, Longfei and Harris, Eliza and Lewicka‐Szczebak, Dominika and Barthel, Matti and Blomberg, Margareta and Harris, Stephen J. and Johnson, Matthew S. and Lehmann, Moritz F. and Liisberg, Jesper and M{\"u}ller, Christoph and Ostrom, Nathaniel E. and Six, Johan and Toyoda, Sakae and Yoshida, Naohiro and Mohn, Joachim}
}

@Proceedings { BosseEZCBOYBMRF2020,
   subid = {1665},
   title = {AdvManuNet: a networking project on metrology for advanced manufacturing},
   journal = {Proceedings 20th euspen International Conference and Exhibition},
   year = {2020},
   month = {6},
   volume = {2020},
   number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing},
   keywords = {Advanced Manufacturing, Key Enabling Technology (KET), Strategic Research Agenda (SRA), European Metrology Network (EMN)},
   misc2 = {EMPIR 2019: Support for Networks},
   event_place = {Online Conference},
   event_name = {20th euspen International Conference and Exhibition},
   event_date = {08-06-2020 to 12-06-2020},
   language = {30},
   ISBN = {978-0-9957751-7-6},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE20374.pdf},
   author = {Bosse, H. and Evans, A. and Zelen{\'y}, V. and Czulek, D. and Balsamo, A. and O'Connor, D. and Yandayan, T. and Billington, D. and Meli, F. and Ragusa, C. and Flys, O.}
}

@Article { LucasCTDABLYSMPF2020,
   subid = {1611},
   title = {Dynamic piezoelectric response of relaxor single crystal under electrically driven inter-ferroelectric phase transformations},
   journal = {Applied Physics Letters},
   year = {2020},
   month = {6},
   volume = {116},
   number = {22},
   number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications},
   pages = {222903},
   keywords = {-},
   web_url = {https://livrepository.liverpool.ac.uk/3091334/},
   misc2 = {EMPIR 2016: Energy},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/5.0007820},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lucas, C.A. and Cain, M.G. and Thompson, P.B.J. and Damjanovic, D. and Antonelli, L. and Blackmon, F. and Lofland, S.E. and Young, S. and Staruch, M. and Matis, B.R. and Patterson, E.A. and Finkel, P.}
}

@Article { HarrisLXWZYBWKCBSM2020,
   subid = {1578},
   title = {N2O isotopocule measurements using laser spectroscopy: analyzer characterization and intercomparison},
   journal = {Atmospheric Measurement Techniques},
   year = {2020},
   month = {5},
   day = {28},
   volume = {13},
   number = {-},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   pages = {2797–2831},
   keywords = {nitrous oxide, isotopic composition, laser spectroscopy, spectral interference, matrix effect},
   web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa\%3A22186},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Copernicus Gesellschaft mbH},
   address = {G{\"o}ttingen},
   language = {30},
   DOI = {10.5194/amt-13-2797-2020},
   stag_bib_extends_levelofaccess = {NA},
   author = {Harris, Stephen J. and Liisberg, Jesper and Xia, Longlong and Wei,  Jing and Zeyer, Kerstin and Yu, Longfei and Barthel, Matti and Wolf, Benjamin and Kelly, Bryce F. J. and Cend{\'o}n, Dioni I. and Blunier, Thomas and Six, Johan and Mohn, Joachim}
}

@Article { YamakawaBATBSNKYD2020,
   subid = {2039},
   title = {Hg isotopic composition and total Hg mass fraction in NIES Certified Reference Material No. 28 Urban Aerosols},
   journal = {Analytical and Bioanalytical Chemistry},
   year = {2020},
   month = {5},
   day = {18},
   volume = {412},
   number = {19},
   number2 = {16ENV01: MercOx: Metrology for oxidised mercury},
   pages = {4483-4493},
   keywords = {Hg isotopic composition,   Certified Reference Material, Urban Aerosols},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1618-2642, 1618-2650},
   DOI = {10.1007/s00216-020-02691-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yamakawa, A. and B{\'e}rail, S. and Amouroux, D. and Tessier, E. and Barre, J. and Sano, T. and Nagano, K. and Kanwal, S. and Yoshinaga, J. and Donard, O.F.X.}
}

@Article { FrisvadJMCYGMH2020,
   subid = {1849},
   title = {Survey of Models for Acquiring the Optical Properties of Translucent Materials},
   journal = {Computer Graphics Forum},
   year = {2020},
   month = {5},
   volume = {39},
   number = {2},
   number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance},
   pages = {729-755},
   keywords = {Appearance, graphics, BRDF, BTDF, BSSRDF,},
   web_url = {https://diglib.eg.org/handle/10.1111/cgf14023},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Wiley},
   language = {30},
   ISSN = {0167-7055, 1467-8659},
   DOI = {10.1111/cgf.14023},
   stag_bib_extends_levelofaccess = {NA},
   author = {Frisvad, J.R. and Jensen, S.A. and Madsen, J.S. and Correia, A. and Yang, L. and Gregersen, S.K.S. and Meuret, Y. and Hansen, P‐E.}
}

@Article { YacootKHDDRVN2020,
   subid = {1489},
   title = {Multiple fibre interferometry setup for probe sample interaction measurements in atomic force microscopy},
   journal = {Measurement Science and Technology},
   year = {2020},
   month = {4},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   keywords = {atomic force microscopy, Fibre interferometry, probe sample interaction, nanometrology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ab85d8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Klapetek, P. and Yacoot, A. and Hortv{\'i}k, V. and Duchoň, V. and Dongmo, H. and Rerucha, S. and Valtr, M. and Nečas, D.}
}

@Article { RussellPavierPPDYHK2020,
   subid = {1477},
   title = {Bringing real-time traceability to high-speed atomic force microscopy},
   journal = {Measurement Science and Technology},
   year = {2020},
   month = {3},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   keywords = {Metrology, high-speed atomic force microscopy, traceability, nanometrology, nanotechnology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ab7ca9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Heaps, E. and Yacoot, A. and Dongmo, H. and Picco, L. and Payton, O.D. and Russell-Pavier, F.S and Klapetek, P}
}

@Article { SalmiCVWVYKHS2020,
   subid = {1354},
   title = {AlOx surface passivation of black silicon by spatial ALD: Stability under light soaking and damp heat exposure},
   journal = {Journal of Vacuum Science \& Technology A},
   year = {2020},
   month = {3},
   volume = {38},
   number = {2},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {022401},
   keywords = {Spatial Atomic Layer Deposition, aluminum oxide, surface passivation, light soaking, damp heat},
   misc2 = {EMPIR 2016: Energy},
   publisher = {American Vacuum Society},
   language = {30},
   ISSN = {0734-2101, 1520-8559},
   DOI = {10.1116/1.5133896},
   stag_bib_extends_levelofaccess = {NA},
   author = {Heikkinen, I.T.S. and Koutsourakis, G.  and Virtanen, S. and Yli-Koski, M. and Wood, S. and V{\"a}h{\"a}nissi, V. and Salmi, E. and Castro, F.A. and Savin, H.}
}

@Article { LinYCWGCLXSHCFCTYC2020,
   subid = {1760},
   title = {Perpendicular Magnetic Anisotropy and Dzyaloshinskii-Moriya Interaction at an Oxide/Ferromagnetic Metal Interface},
   journal = {Physical Review Letters},
   year = {2020},
   volume = {124},
   number = {21},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {217202},
   keywords = {DMI, spin waves},
   web_url = {https://arxiv.org/abs/2006.14268},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007},
   DOI = {10.1103/PhysRevLett.124.217202},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lin , W. and Yang, B. and Chen, A.P. and Wu, X. and Guo, R. and Chen, S. and Liu, L. and Xie, Q. and Shu, X. and Hui, Y. and Chow, G.M. and Feng, Y.  and Carlotti, G. and Tacchi, S. and Yang, H. and Chen, J.}
}

@Proceedings { YilmazDH2020,
   subid = {2257},
   title = {Calibration of Digital Dynamic Pressure Sensors},
   journal = {SMSI 2020 Conference – Sensor and Measurement Science International},
   year = {2020},
   volume = {SMSI 2020},
   number = {-},
   number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future},
   pages = {376-377},
   keywords = {Dynamic, pressure, calibration, digital, sensor, DTI},
   web_url = {https://www.ama-science.org/proceedings/details/3805},
   misc2 = {EMPIR 2017: Industry},
   publisher = {AMA Association for Sensors and Measurement},
   event_place = {-},
   event_name = {SMSI 2020 Conference – Sensor and Measurement Science International},
   event_date = {22-06-2020 to 25-06-2020},
   language = {30},
   ISBN = {-},
   ISSN = {-},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {978-3-9819376-2-6},
   author = {Yilmaz, R. and Durgut, Y. and Hamarat, A.}
}

@Proceedings { HahtelaKLMMPYBGKMMPP2020,
   subid = {1810},
   title = {Coulomb Blockade Thermometry on a Wide Temperature Range},
   journal = {Proceedings of 2020 Conference on Precision Electromagnetic Measurements (CPEM 2020)},
   year = {2020},
   number2 = {18SIB02: Real-K: Realising the redefined kelvin},
   keywords = {Temperature measurement, thermometers, cryogenics, nanoelectronics, tunneling, single electron devices},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Denver (Aurora), CO, USA},
   event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM 2020)},
   event_date = {24-08-2020 to 28-08-2020},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2101.03932},
   author = {Hahtela, O.M. and Kemppinen, A. and Lehtinen, J. and Manninen, A.J. and Mykk{\"a}nen, E. and Prunnila, M. and Yurttag{\"u}l, N. and Blanchet, F. and Gramich, M. and Karimi, B. and Mannila, E.T. and Muhojoki, J. and Peltonen, J.T. and Pekola, J.P.}
}

@Article { HertwigNOYFGTC2020,
   subid = {2016},
   title = {ALD-ZnMgO and absorber surface modifications to substitute CdS buffer layers in co-evaporated CIGSe solar cells},
   journal = {EPJ Photovoltaics},
   year = {2020},
   volume = {11},
   number = {12},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {12},
   keywords = {Thin film solar cells Cu(In,Ga)Se2 bufferZnMgO ALDsurface treatment},
   misc2 = {EMPIR 2016: Energy},
   publisher = {EDP Sciences},
   language = {30},
   ISSN = {2105-0716},
   DOI = {10.1051/epjpv/2020010},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hertwig, R. and Nishiwaki, S. and Ochoa, M. and Yang, S-C. and Feurer, T. and Gilshtein, E. and Tiwari, A.N. and Carron, R.}
}

@Proceedings { KazemipourWHYRGHZ2019,
   subid = {1662},
   title = {Material Parameter Extraction in THz Domain, Simplifications and Sensitivity Analysis},
   journal = {2019 IEEE Asia-Pacific Microwave Conference (APMC)},
   year = {2019},
   month = {12},
   volume = {N/A},
   number = {N/A},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {276-278},
   keywords = {material characterization, extraction method, THz domain, sensitivity coefficient, measurement uncertainty},
   web_url = {https://doi.org/10.5281/zenodo.4243025},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Singapore},
   event_name = {019 IEEE Asia-Pacific Microwave Conference (APMC)},
   event_date = {10-12-2019 to 13-12-2019},
   language = {30},
   ISBN = {978-1-7281-3517-5},
   ISSN = {N/A},
   DOI = {10.1109/APMC46564.2019.9038523},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazemipour, A. and Wollensack, M. and Hoffmann, J. and Yee, S-K. and R{\"u}fenacht, J. and G{\"a}umann, G. and Hudlicka, M. and Zeier, M.}
}

@Proceedings { HoogenboomHRY2019,
   subid = {1301},
   title = {Reliable Power Transformer Efficiency Tests},
   journal = {Proceedings 5th International Colloquium “Transformer Research and Asset Management” Opatija/Croatia, October 09 – 12, 2019},
   year = {2019},
   month = {10},
   day = {11},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {power transformers, efficiency, loss, loss measurement, reliability, calibration, accuracy, uncertainty},
   tags = {SEG},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   event_place = {Opatija, Croatia},
   event_name = {5th International Colloquium “Transformer Research and Asset Management” Opatija/Croatia},
   event_date = {09-10-2019 to 12-10-2019},
   language = {30},
   DOI = {10.5281/zenodo.3559845},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hoogenboom, D. and Houtzager, E. and Rietveld, G. and Ye, G.}
}

@Proceedings { BagciHYTAGD2019,
   subid = {1325},
   title = {Improvement of dynamic pressure standard for calibration of dynamic pressure transducers},
   journal = {19th International Congress of Metrology (CIM2019)},
   year = {2019},
   month = {9},
   day = {23},
   number = {2019},
   number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures},
   keywords = {dynamic pressure, measurement, calibration, drop mass, dynamic calibration machine},
   misc2 = {EMPIR 2017: Industry},
   publisher = {EDP Sciences},
   address = {17 av. du Hoggar PA de Courtaboeuf BP 112 PA de Courtaboeuf BP 112 Les Ulis cedex A 91944 France},
   event_place = {Paris},
   event_name = {19th International Congress of Metrology},
   event_date = {24-09-2019 to 26-09-2019},
   language = {30},
   DOI = {10.1051/metrology/201927009},
   stag_bib_extends_levelofaccess = {NA},
   author = {Durgut, Y. and Ganioglu, O. and Aydemir, B. and Turk, A. and Yilmaz, R. and Hamarat, A. and Bağcı, E.}
}

@Proceedings { ViniciusdLYHHFL2019,
   subid = {1187},
   title = {Comparison of Measuring Systems for Puncture Test According to IEC 61211},
   journal = {21st International Symposium on High Voltage Engineering},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {puncture test, measurement},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary},
   event_name = {21st International Symposium on High Voltage Engineering},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3243452},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Yan, W. and Li, Y. and Vinicius, M. and Filho, O. and Laiho, M.}
}

@Article { AslanDSWZOY2019,
   title = {Comparison of two methods for the rapid radiochemical analysis of air dust samples in emergency situations},
   journal = {Applied Radiation and Isotopes},
   year = {2019},
   month = {8},
   volume = {150},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {120-126},
   keywords = {Emergency preparedness, airborne radioactivity, radiochemical analysis, extraction chromatography},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0969804317308229?dgcid=raven_sd_via_email},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   address = {230 Park Avenue Suite 800 Shantae McGee New York NY 10169-0935 United States},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2019.04.031},
   stag_bib_extends_levelofaccess = {NA},
   author = {Aslan, N. and Dirican, A. and Seferinoğlu, M. and Wershofen, H. and Zapata-Garc{\'i}a, D. and {\"O}z\c{c}ayan, G. and Y{\"u}cel, {\"U}.}
}

@Article { RedshawQPMIHGEDBSRY2019,
   subid = {1232},
   title = {Direct determination of the La138\(\beta\)-decay Q value using Penning trap mass spectrometry},
   journal = {Physical Review C},
   year = {2019},
   month = {7},
   day = {11},
   volume = {100},
   number = {1},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {014308},
   keywords = {138La, high-precision Q-values, mass spectrometry, Penning trap},
   web_url = {https://arxiv.org/abs/1904.12076v2},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9985, 2469-9993},
   DOI = {10.1103/PhysRevC.100.014308},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sandler, R. and Bollen, G. and Dissanayake, J. and Eibach, M. and Gulyuz, K. and Hamaker, A. and Izzo, C. and Mougeot, X. and Puentes, D. and Quarati, F. G. A. and Redshaw, M. and Ringle, R. and Yandow, I.}
}

@Article { MottonenRKBYFGK2019,
   subid = {1110},
   title = {Evidence for universality of tunable-barrier electron pumps},
   journal = {Metrologia},
   year = {2019},
   month = {6},
   day = {13},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Single electron pumps, electrical metrology, quantum electrical standards},
   web_url = {https://arxiv.org/abs/1901.05218},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab29a5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Giblin, S. and Fujiwara, A. and Yamahata, G. and Bae, M.H. and Kim, N. and Rossi, A. and M{\"o}tt{\"o}nen, M. and Kataoka, M.}
}

@Article { LazzeriniDGVKYB2019,
   subid = {1074},
   title = {Design and performance of a test rig for evaluation of nanopositioning stages},
   journal = {Measurement Science and Technology},
   year = {2019},
   month = {2},
   volume = {30},
   number = {3},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   pages = {035002},
   keywords = {multi-axis positioning stages, traceability, nanopositioning, dimensional metrology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aafd03},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yacoot, Andrew and Klapetek, Petr and Valtr, Miroslav and Grolich, Petr and Dongmo, Herve and Lazzerini, Giovanni M and Bridges, Angus}
}

@Article { GodDCBYDDRW2019,
   subid = {1238},
   title = {High-rank Symmetries in Nuclei: Challenges for Prediction Capacities of the Nuclear Mean-field Theories},
   journal = {Acta Physica Polonica B},
   year = {2019},
   volume = {50},
   number = {3},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {685},
   keywords = {Nuclear mean field theory, modeling prediciton capacities, nuclear point group symmetreis, high-rank symmetries},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Jagiellonian University},
   language = {30},
   ISSN = {0587-4254, 1509-5770},
   DOI = {10.5506/APhysPolB.50.685},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dudek, J. and Dedes, I. and Yang, J. and Baran, A. and Curien, D. and Dickel, T. and G{\'o}źdź, A. and Rouvel, D. and Wang, H.L.}
}

@Article { LuoLYHLSPZGCGHP2018,
   subid = {1170},
   title = {Ultra-stable pressure is realized for Chinese single pressure refractive index gas thermometry in the range 30–90 kPa},
   journal = {Science Bulletin},
   year = {2018},
   month = {12},
   volume = {63},
   number = {24},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {1601-1603},
   keywords = {primary thermometry, low temperature, refractive index, microwave resonator},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2095-9273},
   DOI = {10.1016/j.scib.2018.12.001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Han, D. and Gao, B. and Chen, H. and Gambette, P. and Zhang, H. and Pan, C. and Song, Y. and Liu, W. and Liu, Y. and Hu, J. and Yu, B. and Luo, E. and Pitre, L.}
}

@Article { NewellHMRLKHCPYKE2018,
   subid = {994},
   title = {Confocal laser scanning microscopy for rapid optical characterization of graphene},
   journal = {Communications Physics},
   year = {2018},
   month = {11},
   day = {20},
   volume = {1},
   number = {1},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   keywords = {Confocal microscopy, graphene.},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer Nature America, Inc},
   language = {30},
   ISSN = {2399-3650},
   DOI = {10.1038/s42005-018-0084-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Panchal, V. and Yang, Y. and Cheng, G. and Hu, J. and Kruskopf, M. and Liu, C.I. and Rigosi, A.F. and Melios, C. and Hight Walker, A.R. and Newell, D.B. and Kazakova, O. and Elmquist, R.E.}
}

@Article { HisamotoRHLASTYTLSK2018,
   subid = {595},
   title = {Quantum Dipole Effects in a Silicon Transistor under High Electric Fields},
   journal = {Journal of the Physical Society of Japan},
   year = {2018},
   month = {9},
   day = {15},
   volume = {87},
   number = {9},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {094801},
   keywords = {Si, CMOS, transistor, quantum dipole, Heisenberg model},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Physical Society of Japan},
   language = {30},
   ISSN = {0031-9015, 1347-4073},
   DOI = {10.7566/jpsJ.87.094801},
   stag_bib_extends_levelofaccess = {NA},
   author = {Saito, S. and Li, Z. and Yoshimoto, H, and Tomita, I. and Tsuchiya, Y. and Sasago, Y. and Arimoto, H. and Liu, F. and Husain, M.K. and Hisamoto, D. and Rutt, H.N. and Kurihara, S.}
}

@Article { YangBJCJTS2018,
   title = {Individualized magnetoencephalography using optically pumped magnetometers with an anatomy derived sensor holder},
   journal = {Biomedical Engineering / Biomedizinische Technik},
   year = {2018},
   month = {9},
   volume = {63},
   number = {s1},
   number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound},
   pages = {240},
   keywords = {OPM, SQUID, SQUID-MEG, signal-to-noise ratio},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Walter de Gruyter GmbH},
   address = {Berlin},
   language = {30},
   ISSN = {1862-278X, 0013-5585},
   DOI = {10.1515/bmt-2018-6045},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yang, T. and Br{\"u}hl, R. and  Jodko-Władzińska, A. and Cotic Smole, P. and Jazbinšek, V. and Trahms, L. and Sander-Th{\"o}mmes, T.}
}

@Article { SieversYSHGBTCBF2018,
   subid = {996},
   title = {Excitation and coherent control of magnetization dynamics in magnetic tunnel junctions using acoustic pulses},
   journal = {Applied Physics Letters},
   year = {2018},
   month = {8},
   day = {13},
   volume = {113},
   number = {7},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   keywords = {Excitation, Coherent control, Magnetization dynamics, magnetic tunnel junctions, acoustic pulses},
   web_url = {https://arxiv.org/abs/1804.10503},
   misc2 = {EMPIR 2015: SI Broader Scope},
   language = {30},
   DOI = {10.1063/1.5037780},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yang, H.F. and Garcia-Sanchez, F. and Hu, X.K. and Sievers, S. and B{\"o}hnert, T. and Costa, J.D. and Tarequzzaman, M. and Ferreira, R. and Bieler, M. and Schumacher, H.W.}
}

@Article { YooSWWIAKR2018,
   subid = {842},
   title = {Extrusion 3D Printing of Paracetamol Tablets from a Single Formulation with Tunable Release Profiles Through Control of Tablet Geometry},
   journal = {AAPS PharmSciTech},
   year = {2018},
   month = {8},
   day = {10},
   volume = {19},
   number = {11},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   keywords = {3D printing; paracetamol; sustained release; immediate release; personalised medicine; geometry},
   web_url = {https://link.springer.com/article/10.1208/s12249-018-1107-z},
   misc2 = {EMPIR 2015: Health},
   publisher = {American Association of Pharmaceutical Scientists (AAPS)},
   language = {30},
   ISSN = {1530-9932},
   DOI = {10.1208/s12249-018-1107-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Khaled, S.A. and Alexander, M.R. and Irvine, D.J. and Wildman, R.D. and Wallace, M.J. and Sharpe, S. and Yoo, J. and Roberts, C.J.}
}

@Article { KazakovaMYEPL2018,
   subid = {991},
   title = {Detection of Ultralow Concentration NO2 in Complex Environment Using Epitaxial Graphene Sensors},
   journal = {ACS Sensors},
   year = {2018},
   month = {8},
   volume = {3},
   number = {9},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   pages = {1666-1674},
   keywords = {air quality; environmental monitoring; epitaxial graphene; graphene sensors; Hall effect; nitrogen dioxide},
   web_url = {https://arxiv.org/abs/1808.09776},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2379-3694, 2379-3694},
   DOI = {10.1021/acssensors.8b00364},
   stag_bib_extends_levelofaccess = {NA},
   author = {Melios, C. and Panchal, V. and Edmonds, K. and Lartsev, A. and Yakimova, R. and Kazakova, O.}
}

@Thesis { Yi2018,
   subid = {1194},
   title = {Progress towards GaAs multiplexed single-electron pump arrays},
   year = {2018},
   month = {7},
   day = {15},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Single electron pump, Quantum multiplexer, Pump arrays},
   web_url = {https://www.repository.cam.ac.uk/handle/1810/294606},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Apollo - University of Cambridge Repository},
   address = {Cambridge (UK)},
   school = {University of Cambridge},
   language = {30},
   DOI = {10.17863/CAM.41714},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yi, T.}
}

@Article { YuWMGDCBBTCOGM2018,
   subid = {955},
   title = {Preliminary assessment of stable nitrogen and oxygen isotopic composition of USGS51 and USGS52 nitrous oxide reference gases and perspectives on calibration needs},
   journal = {Rapid Communications in Mass Spectrometry},
   year = {2018},
   month = {6},
   day = {26},
   volume = {32},
   number = {15},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   pages = {1207-1214},
   keywords = {N2O, reference material, isotope delta value, USGS51, USGS52},
   web_url = {https://onlinelibrary.wiley.com/doi/10.1002/rcm.8257},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Wiley},
   language = {30},
   ISSN = {0951-4198},
   DOI = {10.1002/rcm.8157},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ostrom, N.E. and Gandhi, H. and Coplen, T.B. and Toyoda, S. and B{\"o}hlke, J.K. and Brand, W.A. and Casciotti, K.L. and Dyckmans, J. and Giesemann, A. and Mohn, J. and Mohn, J. and Well, R. and Yu, L.}
}

@Proceedings { RobinsonMCY2018,
   subid = {850},
   title = {Traceable instruments for Encircled Angular Flux measurements},
   journal = {Proc. SPIE},
   year = {2018},
   month = {5},
   day = {17},
   volume = {10683},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {106831B},
   keywords = {Encircled Angular Flux, modal distribution, far field intensity pattern, step-index fibres},
   web_url = {https://arxiv.org/abs/1806.09839},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Strasbourg},
   event_name = {Fiber Lasers and Glass Photonics: Materials through Applications},
   event_date = {22-04-2018 to 26-04-2018},
   language = {30},
   DOI = {10.1117/12.2306430},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, E. and Yang, H. and Castagna, N. and Morel, J.}
}

@Article { SaitoTTHSYHLSL2018,
   subid = {596},
   title = {Random telegraph noise from resonant tunnelling at low temperatures},
   journal = {Scientific Reports},
   year = {2018},
   month = {1},
   day = {10},
   volume = {8},
   number = {1},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Random telegraph noise, Quantum dot, transistor},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-18579-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Yoshimoto, H. and Sasago, Y. and Hisamoto, D. and Tomita, I. and Tsuchiya, Y. and Saito, S.}
}

@Article { BurnsRMNBFLADYHR2017,
   subid = {499},
   title = {Antimicrobial peptide capsids of de novo design},
   journal = {Nature Communications},
   year = {2017},
   month = {12},
   day = {22},
   volume = {8},
   number = {1},
   number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance},
   pages = {2263},
   keywords = {Antimicrobials, Protein design, Self-assembly, Biometrology},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-017-02475-3},
   stag_bib_extends_levelofaccess = {NA},
   author = {De Santis, E. and Alkassem, H. and Lamarre, B. and Faruqui, N. and Bella, A. and Noble, J.E. and Micale, N. and Ray, S. and Burns, J.R. and Yon, A.R. and Hoogenboom, B.W. and Ryadnov, M.G.}
}

@Article { SterrRZSOBHLYMR2017,
   subid = {720},
   title = {Ultrastable Silicon Cavity in a Continuously Operating Closed-Cycle Cryostat at 4 K},
   journal = {Physical Review Letters},
   year = {2017},
   month = {12},
   day = {15},
   volume = {119},
   number = {24},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   keywords = {ultrastable laser, silicon cavity, 4K cryocooler, time and frequency standards},
   web_url = {https://arxiv.org/abs/1708.05161},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.119.243601},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhang, W. and Robinson, J. M. and Sonderhouse, L. and Oelker, E. and Benko, C. and Hall, J. L. and Legero, T. and Matei, D. G. and Riehle, F. and Sterr, U. and Ye, J.}
}

@Article { TakasuBBCJYKTT2017,
   subid = {775},
   title = {Beyond-Born-Oppenheimer effects in sub-kHz-precision photoassociation spectroscopy of ytterbium atoms},
   journal = {Physical Review A},
   year = {2017},
   month = {12},
   volume = {96},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {063405},
   keywords = {photoassociation, spectroscopy, ytterbium,},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.96.063405},
   stag_bib_extends_levelofaccess = {NA},
   author = {Borkowski, M. and Buchachenko, A.A. and Ciuryło, R. and Julienne, P.S. and Yamada, H. and Kikuchi, Y. and Takahashi, K. and Takahashi, Y. and Takasu, Y.}
}

@Article { LestremauLKvBMBCBRYAB2017,
   title = {Suitability of vessels and adsorbents for the short-term storage of biogas/biomethane for the determination of impurities – Siloxanes, sulfur compounds, halogenated hydrocarbons, BTEX},
   journal = {Biomass and Bioenergy},
   year = {2017},
   month = {10},
   volume = {105},
   number2 = {ENG54: Biogas: Metrology for biogas},
   pages = {127-135},
   keywords = {BiogasCompositionImpuritiesVesselsSampling},
   tags = {EnG},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0961953417302118},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   DOI = {10.1016/j.biombioe.2017.06.025},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lestremau, F. and Li, J. and Krom, I. and van der Veen, A.M.H. and Brewer, B. and Murugan, A. and Bartlett, S. and Culleton, L. and B{\"u}ker, O. and Rosell, L. and Yaghooby, H. and Arrhenius, K. and Beranek, J.}
}

@Article { BoudotdYTCBA2017,
   title = {High-contrast sub-Doppler absorption spikes in a hot atomic vapor cell exposed to a dual-frequency laser field},
   journal = {New Journal of Physics},
   year = {2017},
   month = {7},
   day = {25},
   volume = {19},
   number = {7},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   pages = {073028},
   keywords = {Counterpropagating light waves, saturation spectroscopy,  dark resonances, diode-lasers; d-1 line, d1 line, d2 line},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/aa7258},
   stag_bib_extends_levelofaccess = {NA},
   author = {Boudot, R. and de Clercq, E. and Yudin, V. and Taichenachev, A. and Coget, G. and Brazhnikov, D. and Abdel Hafiz, M.}
}

@Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017,
   subid = {477},
   title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks},
   journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)},
   year = {2017},
   month = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {optical fibre, network, clock, time, dissemination, service},
   web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/FCS.2017.8089004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Krehlik, P. and Śliwczyński, L. and Dostal, J. and Radil, J. and Smotlacha, V. and Velc, R. and Vojtech, J. and Campanella, M. and Calonico, D. and Clivati, C. and Levi, F. and Č{\'i}p, O. and Rerucha, S. and Holzwarth, R. and Lessing, M. and Camargo, F. and Desruelle, B. and Lautier-Gaud, J. and English, E.L. and Kronj{\"a}ger, J. and Whibberley, P. and Pottie, P.E. and Tavares, R. and Tuckey, P. and John, F. and Snajder, M. and Stefl, J. and Nogaś, P. and Urbaniak, R. and Binczewski, A. and Bogacki, W. and Turza, K. and Grosche, G. and Schnatz, H. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.}
}

@Article { FanQYFZ2017,
   title = {Thermal/luminescence characterization and degradation mechanism analysis on phosphor-converted white LED chip scale packages},
   journal = {Microelectronics Reliability},
   year = {2017},
   month = {4},
   volume = {74},
   number = {July 2017},
   number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting},
   pages = {179–185},
   keywords = {Phosphor-converted white LED, Chip scale packages, Multicolor phosphors, Thermal/luminescence characterization, Degradation mechanisms},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0026271417301026},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {dongsheng ZHAO},
   address = {New York},
   language = {30},
   ISSN = {0026-2714},
   DOI = {10.1016/j.microrel.2017.04.012},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fan, X. and Qian, C. and Yu, C. and Fan, J. and ZHAO, G.}
}

@Article { HusainLTYBSSTKFH2017,
   subid = {30},
   title = {Single Carrier Trapping and De-trapping in Scaled Silicon Complementary Metal-Oxide-Semiconductor Field-Effect Transistors at Low Temperatures},
   journal = {Semiconductor Science and Technology},
   year = {2017},
   month = {3},
   day = {24},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Coulomb blockade, MOSFETs, Carrier Trapping and De-trapping, quantum dots},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0268-1242, 1361-6641},
   DOI = {10.1088/1361-6641/aa6910},
   stag_bib_extends_levelofaccess = {NA},
   author = {Li, Zuo  and Husain, Muhammad and Yoshimoto, Hiroyuki  and Tani, Kazuki and Sasago, Yoshitaka and Hisamoto, Digh and Fletcher, Jonathan and Kataoka, Masaya and Tsuchiya, Yoshishige and Saito, Shinichi}
}

@Article { FujiwaraKKGY2017,
   subid = {407},
   title = {High-accuracy current generation in the nanoampere regime from a silicon single-trap electron pump},
   journal = {Scientific Reports},
   year = {2017},
   month = {3},
   day = {21},
   volume = {7},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {45137},
   keywords = {Single-electron pump, silicon, trap level, current standard},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/srep45137},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yamahata, G. and Giblin, S.P. and Kataoka, M. and Karasawa, T. and Fujiwara, A.}
}

@Article { deClercqGYCAB2017,
   title = {A high-performance Raman-Ramsey Cs vapor cell atomic clock},
   journal = {Journal of Applied Physics},
   year = {2017},
   month = {3},
   day = {14},
   volume = {121},
   number = {10},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   pages = {104903},
   keywords = {Frequency standard, laser, resonances, stability, shift},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0021-8979, 1089-7550},
   DOI = {10.1063/1.4977955},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Clercq, E. and Gu{\'e}randel, S. and Yun, P. and Coget, G. and Abdel Hafiz, M. and Boudot, R.}
}

@Proceedings { LiSLHZYTSHTFKS2017,
   subid = {1123},
   title = {Random-telegraph-noise by resonant tunnelling at low temperatures},
   journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)},
   year = {2017},
   month = {2},
   day = {28},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Random-telegraph-noise, charge trap, low temperatures},
   web_url = {https://eprints.soton.ac.uk/418401/},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Toyama},
   event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)},
   event_date = {28-02-2017 to 02-03-2017},
   language = {30},
   DOI = {10.1109/EDTM.2017.7947569},
   stag_bib_extends_levelofaccess = {NA},
   author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Zeimpekis, I. and Yoshimoto, H. and Tani, K. and Sasago, Y. and Hisamoto, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.}
}

@Article { YacootRPCHCL2017,
   title = {Laser source for dimensional metrology: investigation of an iodine stabilized system based on narrow linewidth 633 nm DBR diode},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {2},
   day = {16},
   volume = {28},
   number = {4},
   number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom},
   pages = {045204},
   keywords = {optical metrology, DBR laser diode, frequency stabilization, laser interferometry, dimensional metrology, iodine stabilization, displacement measurement},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   address = {Temple Circus,Temple Way, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa5ab9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yacoot, Andrew and Rerucha, Simon and Pham, Tuan M and Cizek, Martin and Hucl, Vaclav and Č{\'i}p, Ondřej and Lazar, Josef}
}

@Article { RobinsonSGWZMRLHSY2017,
   title = {1.5 \(\mu\)m lasers with sub 10 mHz linewidth},
   journal = {APS Physics},
   year = {2017},
   month = {2},
   day = {15},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   keywords = {tiem and frequency metrology, ultra-stable laser, oprical clock},
   web_url = {https://arxiv.org/abs/1702.04669},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   language = {30},
   DOI = {10.1103/PhysRevLett.118.263202},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, J.M.  and Sonderhouse, L. and Grebing, C. and Weyrich, R.  and Zhang, W. and Matei, D.G. and Riehle, F. and Legero, T. and H{\"a}fner, S. and Sterr, U. and Ye, J.}
}

@Article { deClercqGBFMCTY2017,
   title = {High-Performance Coherent Population Trapping Clock with Polarization Modulation},
   journal = {Physical Review Applied},
   year = {2017},
   month = {1},
   day = {25},
   volume = {7},
   number = {1},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   keywords = {Frequency standards, atomic clock, ramsey fringes, dark-line, vapor, laser spectroscopy},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.7.014018},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Clercq, E. and Gu{\'e}randel, S. and Boudot, R. and Fran\c{c}ois, B. and Micalizio, S. and Calosso, C.E. and Tricot, F. and Yun, P.}
}

@Proceedings { PokatilovPNETLICDYNPVTC2017_2,
   subid = {1152},
   title = {EMPIR project TracePQM: Traceability routes for electrical power quality measurements},
   journal = {18th International Congress of Metrology},
   year = {2017},
   number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements},
   pages = {8},
   keywords = {power quality; metrology; power; traceability; measurement},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {EDP Sciences},
   event_place = {Paris},
   event_name = {18th International Congress of Metrology},
   event_date = {19-09-2017 to 21-09-2017},
   language = {30},
   DOI = {10.1051/metrology/201704001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nov{\'a}kov{\'a} Zachovalov{\'a}, V. and Yovcheva, A. and Diaz de Aguilar, J. and Caballero Santos, R. and Ilić, D. and Lončarević, J. and Trinchera, B. and Ellingsberg, K. and Ndilimabaka, H. and Philominraj, A. and Pokatilov, A. and Power, O. and Voljc, B. and Tarasso, V. and \c{C}aycı, H.}
}

@Article { MuelanerRYM2017,
   title = {Thermal compensation for large volume metrology and structures},
   journal = {International Journal of Metrology and Quality Engineering},
   year = {2017},
   volume = {8},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {21},
   keywords = {thermal compensation, large volume metrology, finite element analysis , assembly},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {EDP Sciences},
   language = {30},
   ISSN = {2107-6847},
   DOI = {10.1051/ijmqe/2017004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Muelaner, J. and Ross-Pinnock, D. and Yang, B. and Mullineux, G.}
}

@Article { GenoveseBYTDM2016,
   subid = {233},
   title = {Quantifying backflash radiation to prevent zero-error attacks in quantum key distribution},
   journal = {Light: Science \& Applications},
   year = {2016},
   month = {12},
   volume = {6},
   number = {6},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {e16261},
   keywords = {Backflash, Quantum Key Distribution, Single-photon avalanche diode, Zero-error attack},
   web_url = {http://www.nature.com/lsa/journal/v6/n6/full/lsa2016261a.html},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2047-7538},
   DOI = {10.1038/lsa.2016.261},
   stag_bib_extends_levelofaccess = {NA},
   author = {Meda, A. and Degiovanni, I.P. and Tosi, A. and Yuan, Z. and Brida, G. and Genovese, M.}
}

@Article { YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016,
   subid = {321},
   title = {Versailles Project on Advanced Materials and Standards Interlaboratory Study on Measuring the Thickness and Chemistry of Nanoparticle Coatings Using XPS and LEIS},
   journal = {The Journal of Physical Chemistry C},
   year = {2016},
   month = {10},
   day = {27},
   volume = {120},
   number = {42},
   number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles},
   pages = {24070-24079},
   keywords = {VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory},
   web_url = {https://spiral.imperial.ac.uk/handle/10044/1/40824},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Chemical Society (ACS)},
   address = {CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States},
   language = {30},
   ISSN = {1932-7447, 1932-7455},
   DOI = {10.1021/acs.jpcc.6b06713},
   stag_bib_extends_levelofaccess = {NA},
   author = {Belsey, N.A. and Cant, D. and Cant, D.J.H. and Minelli, C. and Araujo, J.R. and Bock, B. and Br{\"u}ner, P. and Castner, D.G. and Ceccone, G. and Counsell, J.D.P. and Dietrich, P.M. and Engelhard, M.H. and Fearn, S. and Galhardo, C.E. and Kalbe, H. and Kim, J.W. and Lartundo-Rojas, L. and Luftman, H.S. and Nunney, T.S. and Pseiner, J. and Smith, E.F. and Spampinato, V. and Sturm, J.M. and Thomas, A.G. and Treacy, J.P.W. and Veith, L. and Wagstaffe, M. and Wang, H. and Wang, M. and Wang, Y.C. and Werner, W. and Yang, L.}
}

@Article { YoshidaWDKLSGIHTGMB2016,
   title = {Reassessment of the NH4NO3thermal decomposition technique for calibration of the N2O isotopic composition},
   journal = {Rapid Communications in Mass Spectrometry},
   year = {2016},
   month = {10},
   day = {20},
   volume = {30},
   number = {23},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {2487-2496},
   keywords = {thermal decomposition, isotopic composition},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {0951-4198},
   DOI = {10.1002/rcm.7736},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yoshida, N. and Werner, R.A. and Decock, C. and Kuhn, T. and Lehmann, M.F. and Schleppi, P. and Geilmann, H. and Ibraim, E. and Harris, E. and Toyoda, S. and Gutjahr, W. and Mohn, J. and Brand, W.A.}
}

@Article { HuangGYKLZF2016,
   title = {Lumen degradation modeling of white-light LEDs in step stress accelerated degradation test},
   journal = {Reliability Engineering \& System Safety},
   year = {2016},
   month = {10},
   volume = {154},
   number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting},
   pages = {152-159},
   keywords = {Accelerated test, Brownian motion, Degradation test, Light-emitting diodes, Step stress, Wiener process},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   address = {Suite 800, 230 Park Avenue, New York, NY 10169, USA},
   language = {30},
   ISSN = {0951-8320},
   DOI = {10.1016/j.ress.2016.06.002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Huang, Jianlin and Golubović, Dušan S and Yang, Daoguo and Koh, Sau and Li, Xiupeng and Zhang, G.Q. and Fan, Xuejun}
}

@Proceedings { ,
   title = {Fabrication of graphene quantum Hall resistance standard in a cryogen-freee table-top system},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Epitaxial layers, Graphene, measurement standards, microfabrication, quantum hall effect},
   web_url = {http://ieeexplore.ieee.org/document/7540516/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540516},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {He, H. and Janssen, T.J.B.M. and Rozhko, S. and Tzalenchuk, A. and Lara-Avila, S. and Yakimova, R. and Kubatkin, S.}
}

@Proceedings { ,
   title = {Towards a cryogen-free table-top primary resistance standard},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {quantum Hall effect, graphene, primary resistance metrology, cryogenic current comparators.},
   web_url = {http://ieeexplore.ieee.org/document/7540654/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540654},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Janssen, T.J.B.M. and Rhozhko, S. and Williams, J.M. and Ireland, J. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Tzalenchuk, A.}
}

@Article { ,
   title = {Characterization of a Multi-Element Clinical HIFU System Using Acoustic Holography and Nonlinear Modeling},
   journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control},
   year = {2016},
   month = {8},
   volume = {60},
   number = {8},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {1683-98},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Institute of Electrical and Electronics Engineers},
   language = {30},
   ISSN = {0885–3010},
   DOI = {10.1109/TUFFC.2013.2750},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Krieder, w and Yuldashev, P and Sapoznikov, OA and Farr, N and Partinen, A and Bailey, MR and Khokhlova, VA}
}

@Article { ,
   title = {Giant quantum Hall plateaus generated by charge transfer in epitaxial graphene},
   journal = {Nature: Scientific Reports},
   year = {2016},
   month = {7},
   day = {26},
   volume = {6},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {30296},
   keywords = {graphene, measurement, QHE,},
   web_url = {http://www.nature.com/articles/srep30296?WT.feed_name=subjects_physical-sciences},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Scientific reports},
   language = {30},
   DOI = {10.1038/srep30296},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Alexander-Webber, J.A. and Huang, J. and Maude, D.K. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.}
}

@Article { WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016,
   title = {Five-year records of Total Mercury Deposition flux at GMOS sites in the Northern and Southern Hemispheres},
   journal = {Atmospheric Chemistry and Physics Discussions},
   year = {2016},
   month = {7},
   day = {20},
   number2 = {ENV51: MeTra: Traceability for mercury measurements},
   pages = {1-33},
   keywords = {mercury, wet deposition flux,},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1680-7375},
   DOI = {10.5194/acp-2016-517},
   stag_bib_extends_levelofaccess = {NA},
   author = {W{\"a}ngberg, I. and Walters, C. and Vard{\`e}, M. and Spandow, P. and Somerset, V. and Sena, F. and Islas, M.R. and Obolkin, V. and Munthe, J. and Mkololo, T. and Mashyanov, N. and Martin, L. and Magand, O. and Labuschagne, C. and Kotnik, J. and Horvat, M. and Hansson, K. and Hagestr{\"o}m, U. and Gawlik, B. and Garcia, P.E. and Fu, X. and Feng, X.B. and Ebinghaus, R. and Dommergue, A. and Di{\'e}guez, M.D.C. and Comero, S. and Cairns, W. and Arcega-Cabrera, F. and Brunke, E.G. and Barbante, C. and Angot, H. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Weigelt, A. and Yang, X. and Fisicaro, P.}
}

@Article { ,
   title = {A second generation of low thermal noise cryogenic silicon  resonators},
   journal = {Journal of Physics: Conference Series},
   year = {2016},
   month = {7},
   day = {4},
   volume = {723},
   number = {1},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {012031},
   keywords = {ultrastable laser, thermal noise, coating, silicon resonator},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012031/meta},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {1742-6596},
   DOI = {10.1088/1742-6596/723/1/012031},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Matei, D and Legero, T and Grebing, C and H{\"a}fner, S and Lisdat, C and Weyrich, R and Zhang, W and Sonderhouse, L and Robinson, J M and Riehle, F and Ye, J and Sterr, U}
}

@Article { ,
   title = {High-performance near- and mid-infrared crystalline coatings},
   journal = {Optica},
   year = {2016},
   month = {6},
   day = {13},
   volume = {3},
   number = {6},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {647},
   keywords = {(300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings;
(310.1860) Deposition and fabrication; (140.4780) Optical resonators.},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Optical Society of America},
   address = {Washington, D.C. 20036-1012 USA},
   language = {30},
   ISSN = {2334-2536},
   DOI = {10.1364/OPTICA.3.000647},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {COLE, G D and ZHANG, W and BJORK, B J and FOLLMAN, D and HEU, P and DEUTSCH, C and SONDERHOUSE, L and ROBINSON, J and FRANZ, C and ALEXANDROVSKI, A and NOTCUTT, M and HECKL, O H and YE, J and ASPELMEYER, M}
}

@Article { ,
   title = {Aperture alignment in autocollimator-based deflectometric profilometers},
   journal = {REVIEW OF SCIENTIFIC INSTRUMENTS},
   year = {2016},
   month = {5},
   day = {24},
   volume = {87},
   number = {051906 (2016)},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-9},
   keywords = {Apertures, Calibration Charge coupled devices, Ray tracing, Optical aberrations},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4950734},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Institute of Physics},
   address = {Melville, NY 11747-4300 USA},
   language = {30},
   ISSN = {Print: 0034-6748, Online: 1089-7623},
   DOI = {10.1063/1.4950734},
   extern = {1},
   stag_bib_extends_fe_group = {55,59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Geckeler, R. D. and Artemiev, N. A. and Barber, S. K. and Just, A and Lacey, I. and Kranz, O and Smith, B. V. and Yaschckuk, V. V.}
}

@Article { ,
   title = {Linear chirped slope profile for spatial calibration in slope measuring deflectometry},
   journal = {REVIEW OF SCIENTIFIC INSTRUMENTS},
   year = {2016},
   month = {5},
   day = {24},
   volume = {87},
   number = {051907 (2016)},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-9},
   keywords = {Spatial resolution, Modulation transfer functions, Topography, Calibration, Spatial dimensions},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4950737},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Institute of Physics},
   address = {Melville, NY 11747-4300 USA},
   language = {30},
   ISSN = {ISSN: Print: 0034-6748, Online: 1089-7623},
   DOI = {10.1063/1.4950737},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Siewert, F and Zeschke, T and Arnold, T and Paetzelt, H and Yashchuk, VV}
}

@Article { ,
   title = {High precision tilt stage as a key element to a universal test mirror for characterization and calibration of slope measuring instruments},
   journal = {REVIEW OF SCIENTIFIC INSTRUMENTS},
   year = {2016},
   month = {5},
   day = {20},
   volume = {87},
   number = {051904 (2016)},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-12},
   keywords = {Calibration, Mirrors, X-ray optics, Apertures, Comparators},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4950729},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Institute of Physics},
   address = {Melville, NY 11747-4300 USA},
   language = {30},
   ISSN = {Print: 0034-6748, Online: 1089-7623},
   DOI = {10.1063/1.4950729},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yashchuk, VV and Artemiev, NA and Centers, G and Chaubard, A and Geckeler, RD and Lacey, I and Marth, H and McKinney, WR and Noll, T and Siewert, F and Winter, M and Zeschke, T}
}

@Article { ,
   title = {Application of advanced shearing techniques to the calibration of autocollimators with small angle generators and investigation of error source},
   journal = {REVIEW OF SCIENTIFIC INSTRUMENTS},
   year = {2016},
   month = {5},
   day = {20},
   volume = {87},
   number = {051903 (2016)},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {1-14},
   keywords = {Calibration, Error analysis, Data sets, Data analysis, Time measurement},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4950720},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Institute of Physics},
   address = {Melville, NY 11747-4300 USA},
   language = {30},
   ISSN = {Print: 0034-6748, Online: 1089-7623},
   DOI = {10.1063/1.4950720},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yandayan, T and Geckeler, RD and Aksulu, M and Akgoz, SA and Ozgur, B}
}

@Proceedings { ,
   title = {SI-Traceable High-Accuracy EDM based on Multi-Wavelength Interferometry},
   journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring},
   year = {2016},
   month = {4},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {Submission 15},
   keywords = {EDM,  multi-wavelength  interferometry, index of refraction, EMRP JRP SIB60 Surveying},
   web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Vienna, Austria},
   event_name = {Joint International Symposium on Deformation Monitoring},
   event_date = {30-03-2016 to 01-04-2016},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_15.pdf},
   author = {Pollinger, F. and Mildner, J. and K{\"o}chert, P. and Yang, R. and Bosnjakovic, A. and Meyer, T. and Wedde, M. and Meiners-Hagen, K.}
}

@Article { ,
   title = {DABAM: an open-source database of x-ray mirrors metrology},
   journal = {Journal of Synchrotron Radiation},
   year = {2016},
   month = {3},
   day = {24},
   volume = {23},
   number = {23},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {665-678},
   keywords = {X-ray mirror; metrology; database; Python; statistics.},
   web_url = {http://scripts.iucr.org/cgi-bin/paper?S1600577516005014},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IUCr Journals},
   address = {Chester CH1 2HU, England},
   language = {30},
   ISSN = {1600-5775},
   DOI = {10.1107/S1600577516005014},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Sanchez del Rio, M and Bianchi, D and Cocco, D and Glass, M and Idir, M and Metz, J and Raimondi, L and Rebuffi, L and Reininger, R and Shi, X and Siewert, F and Spielmann-Jaeggi, S and Takacs, P and Tomasset, M and Tonnessen, T and Tonnessenivo, A and Yashchuk, VV}
}

@Article { ,
   title = {The kelvin redefinition and its mise en pratique},
   journal = {Phiolosophical Transactions of the Royal Society A},
   year = {2016},
   month = {2},
   day = {22},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {20150037},
   keywords = {International System of Units, kelvin, mise en pratique, temperature, temperature scale, thermodynamic temperature},
   web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150037},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society},
   address = {London},
   language = {30},
   ISSN = {NA},
   DOI = {10.1098/rsta.2015.0037},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Fellmuth, B and Fischer, J and Machin, G and Picard, S and Steur, P.P.M and Tamura, O and White, D.R and Yoon, H}
}

@Article { ,
   title = {Traceable atomic force microscopy of high-quality solvent-free crystals of [6,6]-phenyl-C61-butyric acid methyl ester},
   journal = {Appliced Physics Letters},
   year = {2016},
   month = {2},
   day = {4},
   volume = {108},
   number = {(2016)},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   pages = {053303},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {AIP Publishing},
   language = {30},
   DOI = {10.1063/1.4941227},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lazzerini, G.M. and Patern{\`o}, G.M. and Tregnago, G. and Treat, N. and Stingelin, N. and Yacoot, A. and Cacialli, F.}
}

@Article { OzgurAHYaCCY2016,
   title = {Application of the differential Fabry–Perot interferometer in angle metrology},
   journal = {Measurement Science and Technology},
   year = {2016},
   month = {1},
   day = {20},
   volume = {27},
   number = {3},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {035201},
   keywords = {Angle metrology, Differential Fabry–Perot interferometry, small angle generators, autocollimators, Synchrotron and X-FEL optics},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/0957-0233/27/3/035201},
   stag_bib_extends_levelofaccess = {NA},
   author = {{\"O}zg{\"u}r, B. and Akg{\"o}z, A. and Hamid, R. and Yandayan, T. and Şahin, E. and \c{C}elik, M. and \c{C}etintaş, M. and Yandyan, T.}
}

@Article { ,
   title = {Detailed analysis of the UV adjustment techniques used in paper and graphic industries},
   journal = {Color Research and Application},
   year = {2016},
   month = {1},
   day = {13},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   keywords = {colour measurement, fluorescence, reflectance, UV adjustment, optical calibration.},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/col.22015/pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {John Wiley \& Sons},
   language = {30},
   DOI = {10.1002/col.22015},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yang, Li}
}

@Article { WeigeltSRRMGGDY2016,
   title = {Microfocusing at the PG1 beamline at FLASH},
   journal = {Journal of Synchrotron Radiation},
   year = {2016},
   month = {1},
   volume = {23},
   number = {1},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {123-131},
   keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {International Union of Crystallography (IUCr)},
   language = {30},
   ISSN = {1600-5775},
   DOI = {10.1107/S1600577515023127},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weigelt, H. and Siewert, F. and R{\"u}bhausen, M. and Reininger, R. and Mey, T. and Goderich, R. and Gerasimova, N. and Dziarzhytski, S. and Yandayan, T.}
}

@Article { ,
   title = {Depth Profiling and Melting of Nanoparticles in Secondary Ion Mass Spectrometry (SIMS)},
   journal = {J. Phys. Chem. C},
   year = {2016},
   volume = {117},
   number = {31},
   number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices},
   pages = {16042-16052},
   keywords = {cluster ion beams, core-shell, melting, SEM, St{\"o}ber silica, SiO2},
   web_url = {http://pubs.acs.org/doi/abs/10.1021/jp4048538},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {American chemical society},
   address = {Washington DC},
   language = {30},
   ISSN = {1932-7447},
   DOI = {10.1021/jp4048538},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2014-7-13},
   author = {Yang, L and Seah, M and Gilmore, I .S and Morris, R.J.H and Dowsett, M.G and Boarino, L and Sparnacci, K and Laus, M}
}

@Article { ,
   title = {A comparison of irradiance responsivity and thermodynamic temperature measurement between PTB and NIM},
   journal = {AIP Conference Proceedings},
   year = {2016},
   volume = {1552},
   number = {728},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {728-733},
   keywords = {Comparison; Filter radiometer; Irradiance responsivity; Thermodynamic temperature measurement},
   web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821404},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {AIP Scitation},
   address = {Melville},
   language = {30},
   ISSN = {0094-243X},
   DOI = {10.1063/1.4821404},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lu, X and Anhalt, K and Taubert, R D and Yuan, Z}
}

@Article { ,
   title = {The role of acoustic nonlinearity in tissue heating behind a rib cage using a high-intensity focused ultrasound phased array},
   journal = {PHYSICS IN MEDICINE AND BIOLOGY},
   year = {2016},
   volume = {58},
   number = {2013},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {2537–2559},
   keywords = {HIFU, ultrasound surgery, ribs, nonlinear propagation, focusing, diffraction, shock heating},
   web_url = {http://iopscience.iop.org/article/10.1088/0031-9155/58/8/2537/pdf},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {IOP PUBLISHING},
   address = {Bristol, Tokyo, Philadelphia, Beijing},
   language = {30},
   ISSN = {1088/0031},
   DOI = {10.1088/0031-9155/58/8/2537},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yuldashev, P V and Shmeleva, S M and Ilyin, S A and Sapozhnikov, O A and Gavrilov, L R and Khokhlova, V A}
}

@Techreport { ,
   title = {Key criteria for the determination of geometrical properties of nano-objects under different adhesion levels},
   year = {2015},
   month = {11},
   number = {2015},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   keywords = {Nano-objects, AFM},
   web_url = {http://www.ptb.de/emrp/2618.html},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Lazzerini, M. and Yacoot, A.}
}

@Article { ,
   title = {Correlated Emission Lasing in Harmonic Oscillators Coupled via a Single Three-Level Artificial Atom},
   journal = {PHYSICAL REVIEW LETTERS},
   year = {2015},
   month = {11},
   volume = {115},
   number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip},
   pages = {223603},
   keywords = {Lasing
Artificial atom
Decoherence
Three-level atom
Harmonic oscillator},
   web_url = {http://journals.aps.org/prl/pdf/10.1103/PhysRevLett.115.223603},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {PHYSICAL REVIEW LETTERS},
   language = {30},
   DOI = {10.1103/PhysRevLett.115.223603},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No option selected},
   author = {Peng, Z. H. and Liu, Yu-xi and Peltonen, J. T. and Yamamoto, T. and Tsai, J.S. and Astafiev, O.V.}
}

@Article { ViefhausNSRHAHPYY2015,
   title = {A new compact soft x-ray spectrometer for resonant inelastic x-ray scattering studies at PETRA III},
   journal = {Review of Scientific Instruments},
   year = {2015},
   month = {9},
   volume = {86},
   number = {9},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {093109},
   keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.4930968},
   stag_bib_extends_levelofaccess = {NA},
   author = {Viefhaus, J. and Nordgren, J. and Siewert, F. and Reininger, R. and Hage, A. and Ag{\aa}ker, M. and Hahn, U. and Peters, H. B. and Yin, Z. and Yandayan, Tanfer}
}

@Article { KimNHLAHLHMLHJBCPYKSPPHK2015,
   title = {A Facile Route for Patterned Growth of Metal–Insulator Carbon Lateral Junction through One-Pot Synthesis},
   journal = {ACS Nano},
   year = {2015},
   month = {8},
   day = {25},
   volume = {9},
   number = {8},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {8352-8360},
   keywords = {amorphous carbon, bottom-up growth, graphene, graphene growth from polymer, graphene-based heterostructure},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Chemical Society (ACS)},
   address = {Washington, USA},
   language = {30},
   ISSN = {1936-0851, 1936-086X},
   DOI = {10.1021/acsnano.5b03037},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kim, Kwang S. and Novoselov, Konstantin S. and Hwang, Chanyong and Lee, Zonghoon and Ahn, Jong-Hyun and Han, Sang Woo and Lee, Tae Geol and Hyun, Seung and Mishchenko, Artem and Lee, Seoung-Ki and Huh, Sung and Jeon, Gumhye and Byun, Jinseok and Chae, Dong-Hun and Park, Hyo Ju and Yu, Seong Uk and Kim, Yong-Jin and Son, Jin Gyeong and Park, Jaesung and Park, Beomjin and Hong, Byung Hee and Kim, Jin Kon}
}

@Article { ,
   title = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system},
   journal = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system},
   year = {2015},
   month = {8},
   day = {19},
   volume = {2},
   number = {3},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {035015},
   keywords = {graphene, Quantum Hall, cryogen-free, measurement},
   web_url = {http://iopscience.iop.org/2053-1583/2/3/035015/video/abstract},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing Ltd},
   language = {30},
   ISSN = {2053-1583},
   DOI = {10.1088/2053-1583/2/3/035015},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Janssen, T.J.B.M. and Rozhko, S. and Antonov, I. and Tzalenchuk, A. and Williams, J. M. and Melhem, Z. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R.}
}

@Article { ,
   title = {Improving acoustic determinations of the Boltzmann constant with mass spectrometer measurements of the molar mass of argon},
   journal = {Metrologia},
   year = {2015},
   month = {8},
   day = {19},
   volume = {52},
   number = {5},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {S394–S409},
   keywords = {Boltzmann constant, molar mass of argon, mass spectrometer, argon isotope, acoustic gas thermometer},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S394/meta},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Science},
   address = {Bristol},
   language = {30},
   ISSN = {NA},
   DOI = {10.1088/0026-1394/52/5/S394},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Yang, I and Pitre, L and Moldover, M R and Zhang, J and Feng, X and Kim, J S}
}

@Article { ,
   title = {Influence of impurity spin dynamics on quantum transport in epitaxial graphene},
   year = {2015},
   month = {7},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {epitaxial graphene, measurements, graphene, magnetotransport, magnetic field B∥,},
   web_url = {http://arxiv.org/abs/1507.03841v1},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {arXiv.org},
   language = {30},
   DOI = {10.1103/PhysRevLett.115.106602},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Lara-Avila, S. and Kubatkin, S. and Kashuba, O. and Folk, J. A. and L{\"u}scher, S. and Yakimova, R. and Janssen, T.J.B.M. and Tzalenchuk, A. and Fal'ko, V.}
}

@Article { ,
   title = {A prototype of RK=200 quantum Hall array resistance standard on epitaxial graphene},
   journal = {A prototype of RK=200 quantum Hall array resistance standard on epitaxial graphene},
   year = {2015},
   month = {7},
   volume = {118},
   number = {4},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {044506},
   keywords = {Epitaxial graphene, silicon carbide, Hall, graphene, measurement,},
   web_url = {http://scitation.aip.org/content/aip/journal/jap/118/4/10.1063/1.4927618},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0021-8979},
   DOI = {10.1063/1.4927618},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Lartsev, A. and Lara-Avila, S. and Danilov, A. and Tzalenchuk, A. and Yakimova, R. and Kubatkin, S.}
}

@Article { ,
   title = {Design and Calibration of a Compact Quasi-Optical System for Material Characterization in Millimeter/Sub-millimeter Wave Domain},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2015},
   month = {6},
   volume = {64},
   number = {6},
   number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security},
   pages = {1438-1445},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   language = {30},
   ISSN = {0018-9456},
   DOI = {10.1109/TIM.2014.2376115},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Kazemipour, A. and Hudlicka, M. and Yee, S.-K. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.}
}

@Article { ,
   title = {The Effect of Bilayer Regions on the Response of Epitaxial Graphene Devices to Environmental Gating},
   journal = {Carbon},
   year = {2015},
   month = {5},
   day = {23},
   volume = {93},
   number = {n/a},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {896–902},
   keywords = {grapheme, metrology, scanning Kelvin probe microscopy},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0008622315004686},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1016/j.carbon.2015.05.061},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-5-23},
   author = {Hill-Pearce, R. E. and Eless, V and Lartsev, A and Martin, N. A. and Barker-Snook, I. L. and Helmore, J. J. and Yakimova, R. and Gallop, J. C. and Hao, L}
}

@Article { ,
   title = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements},
   journal = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements},
   year = {2015},
   month = {5},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Dirac-point physics, epitaxial graphene, magneto-transport, measurement, graphene, hall effect, electron-hole puddles,},
   web_url = {http://arxiv.org/abs/1505.03747},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {arXiv.org},
   language = {30},
   DOI = {10.1103/PhysRevB.92.075407},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Huang, J. and Alexander-Webber, J.A. and Baker, A.M.R. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.}
}

@Article { ,
   title = {Evaluation and Selection of High-Temperature Fixed-Point Cells for Thermodynamic Temperature Assignment},
   journal = {Int J Thermophys},
   year = {2015},
   month = {4},
   day = {5},
   volume = {36},
   number = {8},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {1834-1847},
   keywords = {High-temperature fixed points · Metal-carbon eutectics · Radiation thermometry · Temperature standards · Thermodynamic temperature},
   web_url = {http://link.springer.com/article/10.1007/s10765-015-1860-0},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer Link},
   address = {Europe/Asia/Africa},
   language = {30},
   ISSN = {NA},
   DOI = {10.1007/s10765-015-1860-0},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Yamada, Y and Anhalt, K and Battuello, M and Bloembergen, P and Khlevnoy, B and Machin, G and Matveyev, M and Sadli, M and Todd, A and Wang, T}
}

@Article { PhilippFRAFFYD2015,
   title = {Experimental design for TBT quantification by isotope dilution SPE–GC–ICP–MS under the European water framework directive},
   journal = {Talanta},
   year = {2015},
   month = {3},
   volume = {134},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {576-586},
   keywords = {experimental design, isotope dilution, organotin compounds, solid-phase extraction, tributyltin, water framework directive},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0039-9140},
   DOI = {10.1016/j.talanta.2014.11.064},
   stag_bib_extends_levelofaccess = {NA},
   author = {Philipp, R. and Fisicaro, P. and Richter, J. and Alasonati, E. and Fabbri, B. and Fettig, I. and Yardin, C. and Del Castillo Busto, M.E.}
}

@Article { ,
   title = {Wafer-scale homogeneity of transport properties in epitaxial graphene on SiC},
   journal = {Carbon},
   year = {2015},
   month = {2},
   day = {23},
   volume = {87},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {409-414},
   keywords = {wafer-scale, graphene, SiC},
   web_url = {http://liu.diva-portal.org/smash/record.jsf?pid=diva2\%3A811295\&dswid=-258},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Elsevier},
   language = {30},
   ISSN = {0008-6223},
   DOI = {10.1016/j.carbon.2015.02.058},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Yager, T. and Lartsev, A. and Yakimova, R. and Lara-Avila, S. and Kubatkin, S.}
}

@Article { KubatkinLYLY2015,
   title = {The effect of bilayer domains on electronic transport properties of epitaxial graphene on SiC},
   journal = {arXiv.org},
   year = {2015},
   month = {2},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {bilayer domains, epitaxial graphene, SiC, Magnetotransport, epitaxial graphene, Silicon Carbide (SiC/G), bilayer graphene,},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Mesoscale and Nanoscale Physics (cond-mat.mes-hall)},
   address = {Ithaca, NY 14850, USA},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1502.02013},
   author = {Kubatkin, Sergey and Lara-Avila, Samuel and Yakimova, Rosita and Lartsev, Arseniy and Yager, Tom}
}

@Article { ,
   title = {High mobility epitaxial graphene devices via aqueous-ozone processing},
   journal = {High mobility epitaxial graphene devices via aqueous-ozone processing},
   year = {2015},
   month = {2},
   volume = {106},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {063503},
   keywords = {graphene, aqueous-ozone, monolayer,},
   web_url = {http://scitation.aip.org/content/aip/journal/apl/106/6/10.1063/1.4907947},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951},
   DOI = {10.1063/1.4907947},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Yager, T. and Webb, M.J. and Grennberg, H. and Yakimova, R. and Lara-Avila, S. and Kubatkin, S.}
}

@Proceedings { ,
   title = {A calibration procedure for electronic calibration units},
   journal = {84th ARFTG Microwave Measurement Conference},
   year = {2015},
   month = {1},
   day = {19},
   volume = {84},
   number = {n/a},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {n/a},
   keywords = {Vector Network Analyzer (VNA), calibration, metrology, uncertainties, ripple technique},
   web_url = {http://ieeexplore.ieee.org/document/7013414/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Melville},
   event_place = {Boulder, Colorado, USA},
   event_name = {84th ARFTG Microwave Measurement Conference},
   event_date = {04-12-2014 to 05-12-2015},
   language = {30},
   ISBN = {978-1-4799-7085-8},
   ISSN = {n/a},
   DOI = {10.1109/ARFTG.2014.7013414},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Stenarson, J and Eio, C and Yhland, K}
}

@Article { KlapetekVPPMYM2015,
   title = {Large area high-speed metrology SPM system},
   journal = {Nanotechnology},
   year = {2015},
   volume = {26},
   number = {065501},
   number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom},
   keywords = {scanning probe microscopy, high-speed SPM, metrology},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   language = {English},
   DOI = {10.1088/0957-4484/26/6/065501},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Klapetek, P and Valtr, M and Picco, L and Payton, O D and Martinek, J and Yacoot, A and Miles, M}
}

@Article { ,
   title = {Absolute distance measurementby dual-comb interferometry with multi-channel digital lock-in phase detection},
   journal = {Meas. Sci. Technol.},
   year = {2015},
   volume = {26 (8)},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {30},
   DOI = {10.1088/0957-0233/26/8/084001},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yang, R. and Pollinger, F. and Meiners-Hagen, K. and Krystek, M. and Tan, J. and Bosse, H.}
}

@Article { ,
   title = {Low contact resistance in epitaxial graphene devices for quantum metrology},
   journal = {Low contact resistance in epitaxial graphene devices},
   year = {2015},
   volume = {5},
   number = {8},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {087134},
   keywords = {epitaxial graphene, monolayer, measurement, Quantum Hall, bilayer, graphene, chemical sciences, Kemi},
   web_url = {http://urn.kb.se/resolve?urn=urn:nbn:se:liu:diva-122071},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AMER INST PHYSICS},
   language = {30},
   DOI = {10.1063/1.4928653},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Yager, T. and Lartsev, A. and Cedergren, K. and Yakimova, R. and Panchal, V. and Kazakova, O. and Tzalenchuk, A. and Ho Kim, K. and Woo Park, Y. and Lara-Avila, S. and Kubatkin, S.}
}

@Article { YunDHdG2014,
   title = {Constructive polarization modulation for coherent population trapping clock},
   journal = {Applied Physics Letters},
   year = {2014},
   month = {12},
   day = {9},
   volume = {105},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   language = {English},
   DOI = {10.1063/1.4903862},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yun, Peter and Danet, Jean-Marie and Holleville, David and de Clercq, Emeric and Guerandel, Stephane}
}

@Article { SchneidmillerBCTSSZRYSBY2014,
   title = {Time-dependent wave front propagation simulation of a hard x-ray split-and-delay unit: Towards a measurement of the temporal coherence properties of x-ray free electron lasers},
   journal = {Physical Review Special Topics - Accelerators and Beams},
   year = {2014},
   month = {11},
   day = {18},
   volume = {17},
   number = {11},
   number2 = {SIB58: Angles: Angle metrology},
   keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {1098-4402},
   DOI = {10.1103/PhysRevSTAB.17.110705},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schneidmiller, E. and Buzmakov, A. and Chubar, O. and Tschentscher, Th. and Sinn, H. and Samoylova, L. and Zacharias, H. and Roling, S. and Yurkov, M. V. and Siewert, F. and Braun, S. and Yandayan, T.}
}

@Article { ,
   title = {Heterodyne multi-wavelength absolute interferometry based on a cavity-enhanced electro-optic frequency comb pair},
   journal = {Optics Letters},
   year = {2014},
   month = {10},
   volume = {39},
   number = {20},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {5834-5837},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {30},
   DOI = {10.1364/OL.39.005834},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yang, R. and Pollinger, F. and Meiners-Hagen, K. and Tan, J. and Bosse, H.}
}

@Article { ChoiRDYKSPLRNGECLSELS2014,
   title = {Field trial of a quantum secured 10 Gb/s DWDM transmission system over a single installed fiber},
   journal = {Optics Express},
   year = {2014},
   month = {9},
   day = {15},
   volume = {22},
   number = {19},
   number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications},
   pages = {23121-23128},
   web_url = {http://www.opticsinfobase.org/oe/home.cfm},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.22.023121},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Choi, Iris and Rong Zhou, Yu and Dynes, James F. and Yuan, Zhiliang and Klar, Andreas and Sharpe, Andrew and Plews, Alan and Lucamarini, Marco and Radig, Christian and Neubert, J{\"o}rg and Griesser, Helmut and Eiselt, Michael and Chunnilall, Christopher and Lepert, Guillaume and Sinclair, Alastair and Elbers, J{\"o}rg-Peter and Lord, Andrew and Shields, Andrew}
}

@Proceedings { KazemipourHYSKS2014,
   title = {Wideband Frequency-Domain Material Characterization Up To 500 GHz},
   year = {2014},
   month = {9},
   day = {14},
   number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security},
   web_url = {http://www.irmmw-thz2014.org/sites/default/files/M5-P7.12_Kazemipour.pdf},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   event_place = {The University of Arizona, Tucson, AZ, USA},
   event_name = {39th International Conference on Infrared, Millimeter, and THz Waves},
   event_date = {September 14, 2014},
   language = {English},
   DOI = {10.1109/IRMMW-THz.2014.6956130},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazemipour, A. and Hudlicka, M. and Yee, S.-K. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.}
}

@Article { ,
   title = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene},
   journal = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene},
   year = {2014},
   month = {9},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {hot carriers, bilayer graphene, energy loss rate, magnetotransport},
   web_url = {http://arxiv.org/abs/1409.6267v1},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {arXiv.org},
   language = {30},
   DOI = {10.1088/0953-8984/27/16/164202},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Huang, J. and Alexander-Webber, J.A. and Janssen, T.J.B.M. and Tzalenchuk, A. and Yager, T. and Lara Avila, S. and Kubatkin, S. and Myers-Ward, R. L. and Gaskill, D. K. and Nicholas, R.J.}
}

@Article { ,
   title = {Ultrastable laser with average fractional frequency drift rate below 5 \(\times\) 10−19/s},
   journal = {Optics Letters},
   year = {2014},
   month = {8},
   day = {22},
   volume = {39},
   number = {17},
   number2 = {IND14: Frequency: New generation of frequency standards for industry},
   pages = {5102 - 5105},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {30},
   ISSN = {0146-9592},
   DOI = {10.1364/OL.39.005102},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hagemann, C. and Grebing, C. and Lisdat, C. and Falke, St. and Legero, T. and Sterr, U. and Riehle, F. and Martin, M. J. and Ye, J.}
}

@Article { ,
   title = {Tuning carrier density across Dirac point in epitaxial graphene on SiC by corona discharge.},
   journal = {Applied Physics Letters},
   year = {2014},
   month = {8},
   day = {12},
   volume = {105},
   number = {6},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {063106},
   keywords = {dirac point, graphene, SiC},
   web_url = {http://scitation.aip.org/content/aip/journal/apl/105/6/10.1063/1.4892922},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   DOI = {10.1063/1.4892922},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Lartsev, A. and Yager, T. and Bergsten, T. and Tzalenchuk, A. and Janssen, T.J.B.M. and Yakimova, R. and Lara-Avila, S. and Kubatkin, S.}
}

@Article { ,
   title = {Nanodosimetric characterization of ion beams},
   journal = {European Physics Journal D},
   year = {2014},
   month = {8},
   day = {11},
   volume = {68},
   number = {217},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Nanodosimetry, track structure, biological effectiveness, radiation quantities},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1434-6060},
   DOI = {10.1140/epjd/e2014-50015-9},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Bug, Marion U. and Hilgers, Gerhard and Yong Bae, Woon and Rabus, Hans}
}

@Article { KaiserRDYWGFCOSDSWBLLTMWY2014,
   title = {Interlaboratory assessment of nitrous oxide isotopomer analysis by isotope ratio mass spectrometry and laser spectroscopy: current status and perspectives},
   journal = {Rapid Communications in Mass Spectrometry},
   year = {2014},
   month = {8},
   volume = {28},
   number = {18},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {1995-2007},
   keywords = {mass spectroscopy, laser spectroscopy},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {0951-4198},
   DOI = {10.1002/rcm.6982},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kaiser, J. and Ridley, A.R. and Doucett, R.R. and Yarnes, C.T. and Well, R. and Giesemann, A. and Forbes, M. and Casciotti, K.L. and Ostrom, N.E. and Szwec, L. and Dyckmans, J. and Steiker, A.E. and Wissel, H. and Br{\"u}ggemann, N. and Liang, M.C. and Lin, C.T. and Toyoda, S. and Mohn, J. and Wolf, B. and Yoshida, N.}
}

@Article { PanchalLMYTK2014,
   title = {Visualisation of edge effects in side-gated graphene nanodevices},
   journal = {SCIENTIFIC REPORTS},
   year = {2014},
   month = {7},
   day = {30},
   volume = {4 : 5881},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {English},
   DOI = {10.1038/srep05881},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Panchal, Vishal and Lartsev, Arseniy and Manzin, Alessandra and Yakimova, Rositza and Tzalenchu, Alexander and Kazakova, Olga}
}

@Article { ,
   title = {Stable isotope imaging of biological samples with high resolution secondary ion mass spectrometry and complementary techniques},
   journal = {Methods},
   year = {2014},
   month = {7},
   day = {1},
   volume = {68},
   number = {2},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {317-324},
   keywords = {Stable isotope; NanoSIMS; Atomic force microscopy; Backscattered electron imaging; Correlative analysis},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1046202314000425},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Elsevier Inc.},
   address = {Amsterdam},
   language = {30},
   DOI = {10.1016/j.ymeth.2014.02.012},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Jiang, H. and Favaro, E. and Goulbourne, C.N. and Rakowska, P.D. and Hughes, G.M. and Ryadnov, M.G. and Fong, L.G. and Young, S.G. and Ferguson, D.J.P. and Harris, A.L. and Grovenor, C.R.M.}
}

@Article { ByunKBHSOCYCBSSCSP2014,
   title = {Electrical control of nanoscale functionalization in graphene by the scanning probe technique},
   journal = {NPG Asia Materials (2014) 6},
   year = {2014},
   month = {5},
   day = {23},
   volume = {102},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {atomic force microscopy lithography; graphene; graphene functionalization; graphene hydrogenation; graphene oxidation; scanning photoelectron microscope; X-ray photoemission spectroscopy},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {English},
   DOI = {10.1038/am.2014.24},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Byun, Ik-Su and Kim, Wondong and Boukhvalov, Danil W and Hwang, Inrok and Son, Jong Wan and Oh, Gwangtaek and Choi, Jin Sik and Yoon, Duhee and Cheong, Hyeonsik and Baik, Jaeyoon and Shin, Hyun-Joon and Shiu, Hung Wei and Chen, Chia-Hao and Son, Young-Woo and Park, Bae Ho}
}

@Article { ChuaCLYLKKFYPJTS2014,
   title = {Quantum Hall Effect and Quantum Point Contact in Bilayer-Patched Epitaxial Graphene},
   journal = {Nano Letters},
   year = {2014},
   month = {5},
   day = {21},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {SiC epitaxial graphene, quantum hall e ff ect, scanning gate microscopy, monolayer and bilayer graphene, resistance metrology, quantum point contact},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {English},
   DOI = {10.1021/nl5008757},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chua, Cassandra and Connolly, Malcolm and Lartsev, Arseniy and Yager, Tom and Lara-Avila, Samuel and Kubatkin, Sergey and Kopylov, Sergey and Falko, Vladimir and Yakimova, Rositza and Pearce, Ruth and Janssen, T. J. B. M. and Tzalenchuk, Alexander and Smith, Charles G.}
}

@Article { YuJPKHCKHK2014,
   title = {Structural analysis of graphene synthesized by chemical vapor deposition on copper foil using nematic liquid crystal texture},
   journal = {Science Direct, Elsevier Carbon},
   year = {2014},
   month = {4},
   day = {24},
   volume = {76},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {133-122},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {English},
   DOI = {10.1016/j.carbon.2014.04.057},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yu, Jeong-Seon and Jin, Xiaozhan and Park, Jaesung and Kim, Dong Hyun and Ha, Dong-Han and Chae, Dong-Hun and Kim, Wan-Seop and Hwang, Chanyong and Kim, Jong-Hyun}
}

@Article { ,
   title = {Current Sensing Noise Thermometry: A Fast Practical Solution to Low Temperature Measurement},
   journal = {Journal of Low Temperature Physics},
   year = {2014},
   month = {3},
   day = {18},
   volume = {175},
   number = {5-6},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {764-775},
   keywords = {Johnson noise, Fixed point device, Precision, SQUID},
   web_url = {http://link.springer.com/article/10.1007/s10909-014-1147-z},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer US},
   address = {New York},
   language = {30},
   ISSN = {1573-7357},
   DOI = {10.1007/s10909-014-1147-z},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Casey, A and Arnold, F and Levitin, L V and Lusher, C P and Nyeki, J and Saunders, J and Shibahara, A and van der Vliet, H and Yager, B and Drung, D and Schurig, Th and Batey, G and Cuthbert, M N and Matthews, A J}
}

@Article { ,
   title = {Measure low level and high frequency ultrasonic power by self-reciprocity technique},
   journal = {Acta Acustica united with Acustica},
   year = {2014},
   month = {2},
   day = {17},
   volume = {100},
   number = {3},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {583-588},
   keywords = {Ultrasonic Power, Self-reciprocity technique, Low level, High frequency},
   web_url = {http://www.ingentaconnect.com/content/dav/aaua/2014/00000100/00000003/art00022},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {S. Hirzel Verlag, EAA},
   address = {Stuttgart},
   language = {30},
   ISSN = {1619-1928},
   DOI = {10.3813/AAA.918737},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Xing, Guangzhen and Yang, Ping and Shou, Wende}
}

@Article { PanchalGLYK2014,
   title = {Local electric field screening in bi-layer graphene devices},
   journal = {Front. Physics 2:3.},
   year = {2014},
   month = {2},
   day = {3},
   volume = {2},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {epitaxial graphene, scanning gate microscopy, single-layer graphene, double-layer graphene, electrical gating},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {English},
   DOI = {10.3389/fphy.2014.00003},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Panchal, V and Giusca, CE and Lartsev, A and Yakimova, R and Kazakova, O}
}

@Proceedings { ,
   title = {xD-Reflect - ''Multidimensional Reflectometry for Industry'' a research project of the European Metrology Research Program (EMRP)},
   journal = {Proceedings of NEWRAD 2014},
   year = {2014},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {295-297},
   web_url = {http://newrad2014.aalto.fi/Newrad2014_Proceedings.pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Seongchong Park},
   address = {Yuseong-gu},
   event_place = {Helsinki},
   event_name = {NEWRAD 2014},
   event_date = {2014},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {H{\"o}pe, A. and Koo, A. and Forthmann, C. and Verd{\'u}, F. M. and Manoocheri, F. and Leloup, F. B. and Obein, G. and W{\"u}bbeler, G. and Ged, G. and Campos, J. and Hauer, K. O. and Yang, L. and Šm{\'i}d, M. and Langovoy, M. and Iacomussi, P. and Jaanson, P. and K{\"a}llberg, S.}
}

@Proceedings { ,
   title = {Performance verification of a dual sensor stage},
   journal = {Proceedings of the 14th euspen International Conference – Dubrovnik – June 2014},
   year = {2014},
   volume = {I},
   number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom},
   pages = {P4.38, 309V1},
   keywords = {nanopositioning, nanometrology, optical interferometry},
   web_url = {http://www.euspen.eu/Portals/0/Content/2000-2013/Resources/Proceedings/2014\%20Dubrovnik\%20Contents\%20Pages.pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {EUSPEN},
   address = {Bedford},
   event_place = {Dubrovnik, Croatia},
   event_name = {14th international conference of the european society for precision engineering and nanotechnology},
   event_date = {June 2-6, 2014},
   language = {30},
   ISBN = {978-0-9566790-3-1},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yacoot, A. and Mountford, J. and Tedaldi, M. and Reid, B. and Levy, S.}
}

@Proceedings { ,
   title = {Towards Quantum Resistance Metrology Based on Graphene},
   journal = {The EMRP Project GraphOhm - Towards Quantum Resistance Metrology Based on Graphene},
   year = {2014},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {548-549},
   keywords = {Measurement standards, resistance, quantum hall effect, graphene, C, Calibration, EMRP project GraphOhm, Electrical resistance measurement, Hall effect devices, JRP, Materials, Metrology, Resistance, Standards, electric resistance measurement, electrical measurement, intrinsically referenced resistance standard disse, joint research project, quantum resistance metrology standard, semiconductor quantum Hall device},
   web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898502},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Rio de Janeiro},
   event_date = {24-29 Aug. 2014},
   language = {30},
   ISBN = {978-1-4799-2479-0},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898502},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ahlers, F. and Kučera, J. and Poirier, W. and Jeanneret, B. and Satrapinski, A. and Tzalenchuk, A. and Vrabček, P. and Bergsten, T. and Hwang, C. and Yakimova, R. and Kubatkin, S.}
}

@Article { ,
   title = {Microwave surface impedance measurements on reduced graphene oxide},
   journal = {Applied Physics Letters},
   year = {2013},
   month = {9},
   day = {17},
   volume = {103},
   number = {n/a},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {123103},
   keywords = {grapheme, permittivity, quartz, sapphire},
   web_url = {http://scitation.aip.org/content/aip/journal/apl/103/12/10.1063/1.4821268},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {AIP Publishing},
   address = {Melville, NY},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1063/1.4821268},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2014-9-17},
   author = {Hao, L and Gallop, J and Goniszewski, S and Shaforost, O and Klein, N and Yakimova, R}
}

@Proceedings { ,
   title = {Thermodynamic temperature measurements of silver freezing point and HTFPs},
   journal = {AIP Conference Proceedings},
   year = {2013},
   month = {9},
   day = {11},
   volume = {1552},
   number = {56},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {56-59},
   keywords = {Thermodynamic temperature; Absolute radiation thermometer; High temperature fixed point},
   web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821371},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {AIP Scitation},
   address = {Melville},
   event_place = {Los Angeles, California, USA},
   event_name = {TEMPERATURE: ITS MEASUREMENT AND CONTROL IN SCIENCE AND INDUSTRY},
   event_date = {19-03-2012 to 23-03-2012},
   language = {30},
   ISBN = {NA},
   ISSN = {NA},
   DOI = {10.1063/1.4821371},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yuan, Z and Lu, X and Hao, X and Dong, W and Wang, T and Lin, Y and Wang, J and Duan, Y}
}

@Article { ,
   title = {Lens transmission measurement for an absolute radiation thermometer},
   journal = {AIP Conference Proceedings},
   year = {2013},
   month = {9},
   day = {11},
   volume = {1552},
   number = {649},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {648-653},
   keywords = {Radiance Absolute Radiance Thermometer; Thermodynamic temperature; Lens Transmission; Uncertainty.},
   web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821399},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {AIP Scitation},
   address = {Melville},
   language = {30},
   ISSN = {NA},
   DOI = {10.1063/1.4821399},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Hao, X and Yuan, Z and Lu, X}
}

@Article { PanchalILYAK2013,
   title = {Magnetic Scanning Probe Calibration Using Graphene Hall Sensor},
   journal = {IEEE TRANSACTIONS ON MAGNETICS},
   year = {2013},
   month = {7},
   volume = {49},
   number = {7},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   keywords = {Epitaxial graphene, Hall sensor, Kelvin probe force microscopy (KPFM), magnetic probe calibration},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6558904},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   ISSN = {0018-9464},
   DOI = {10.1109/TMAG.2013.2243127},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Panchal, Vishal and Iglesias-Freire, {\'O}scar and Lartsev, Arseniy and Yakimova, Rositza and Asenjo, Agustina and Kazakova, Olga}
}

@Article { KazakovaBPYY2013,
   title = {Epitaxial graphene on SiC(0001): Functional electrical microscopy studies and effect of atmosphere},
   journal = {Nanotechnology},
   year = {2013},
   month = {4},
   volume = {24},
   number = {21},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   web_url = {http://iopscience.iop.org/0957-4484/24/21/215702/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {0957-4484},
   DOI = {10.1088/0957-4484/24/21/215702},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazakova, O and Burnett, T. L and Patten, J and Yang, L and Yakimova, R}
}

@Article { PanchalCYK2013,
   title = {Epitaxial Graphene Sensors for Detection of Small Magnetic Moments},
   journal = {IEEE TRANSACTIONS ON MAGNETICS},
   year = {2013},
   month = {1},
   volume = {49},
   number = {1},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   keywords = {Dynal bead, electron beam irradiation, epitaxial graphene, Hall sensor, single particle detection},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6392383},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   ISSN = {0018-9464},
   DOI = {10.1109/TMAG.2012.2218277},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Panchal, Vishal and Cox, David and Yakimova, Rositza and Kazakova, Olga}
}

@Proceedings { ,
   title = {A temperature sensor based on a whispering gallery mode resonator},
   journal = {AIP Conf. Proc. 1552, 920 (2013)},
   year = {2013},
   volume = {1552},
   number = {8},
   number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination},
   pages = {920-924},
   keywords = {Temperature Sensor, Whispering Gallery Mode, Microwave Resonator, Sapphire},
   web_url = {http://proceedings.aip.org/dbt/dbt.jsp?KEY=APCPCS\&Volume=1552\&Issue=1},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {AIP Publishing LLC},
   address = {New York, USA},
   event_place = {Los Angeles, USA},
   event_name = {Temperature: Its Measurement and Control in Science and Industry, Volume 8},
   event_date = {March 19-23, 2012},
   language = {30},
   ISBN = {978-0-7354-1178},
   ISSN = {978-0-7354-1178},
   DOI = {10.1063/1.4819667},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yu, L and Fernicola, V.}
}

@Article { ,
   title = {Sputtering Yields for Gold Using Argon Gas Cluster Ion Beams},
   journal = {The journal of Physical Chemistry},
   year = {2012},
   month = {10},
   day = {11},
   volume = {116},
   number = {44},
   number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices},
   pages = {23735 – 23741},
   keywords = {Air cluster; GCIB; Gold; Sputtering yield},
   web_url = {http://pubs.acs.org/doi/abs/10.1021/jp307203f},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {ACS},
   address = {Washington DC},
   language = {30},
   ISSN = {1932-7447},
   DOI = {10.1021/jp307203f},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-1},
   author = {Yang, L. and Seah, M.P. and Gilmore, I.S.}
}

@Article { BurnettYK2012,
   title = {Identification of epitaxial graphene domains and adsorbed species in ambient conditions using quantified topography measurements},
   journal = {Journal of Applied Physics},
   year = {2012},
   month = {7},
   volume = {112},
   number = {5},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   keywords = {epitaxial graphene},
   web_url = {http://jap.aip.org/resource/1/japiau/v112/i5/p054308_s1},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   ISSN = {0021-8979},
   DOI = {10.1063/1.4748957},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Burnett, Tim L and Yakimova, Rositza and Kazakova, Olga}
}

@Proceedings { MohnsYZMS2012,
   title = {A Current Transformer Test Set for the Audio Frequency Range},
   journal = {National Institute of Standards and Technology},
   year = {2012},
   month = {6},
   day = {1},
   number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current},
   keywords = {Current transformers, differential amplifiers,bridge, voltage ratio},
   tags = {SEG},
   misc = {A169},
   misc2 = {EMRP A169: Call 2009 Energy},
   event_place = {Gaylord National Resort, Washington DC, USA},
   event_name = {Conference on precision electromagnetic measurements, IEEE},
   event_date = {1 to 6 July 2012},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mohns, E and Yue, C and Zhou, F and M{\"o}hring, T and Schmidt, M}
}

@Article { PanchalCYTK2012,
   title = {Small epitaxial graphene devices for magnetosensing applications},
   journal = {Journal of Applied Physics},
   year = {2012},
   month = {3},
   volume = {111},
   number = {7},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   web_url = {http://jap.aip.org/resource/1/japiau/v111/i7/p07E509_s1},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {0021-8979},
   DOI = {10.1063/1.3677769},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Panchal, V and Cedergren, K and Yakimova, R and Tzalenchuk, A and Kubatkin, S}
}

@Article { GorenADKMY2012,
   title = {Fatty acid composition and chemotaxonomic evaluation of species of Stachys},
   journal = {Natural Product Research},
   year = {2012},
   volume = {26},
   number2 = {ENG09: Biofuels: Metrology for Biofuels},
   pages = {84-90},
   tags = {EnG},
   misc2 = {EMRP A169: Call 2009 Energy},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {G{\"o}ren, A. C. and Ak\c{c}icek, E. and Dirmenci, T. and Kilic, T. and Mozioglu, E. and Yilmaz, H.}
}

@Proceedings { BodermannBDBSKWKHKvYSEBS2011,
   title = {Joint Research on Scatterometry and AFM Wafer Metrology},
   journal = {AIP Conference Proceedings},
   year = {2011},
   month = {11},
   day = {10},
   volume = {1395},
   number = {319 (2011)},
   number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices},
   keywords = {Scatterometry, CD metrology, AFM, reference standard, rigorous modelling, inverse diffraction problem},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {American Institute of Physics},
   event_place = {Grenoble, France},
   event_name = {International Conference on Frontiers of Characterisation and Metrology for Nanoelectronics FCMN 2011},
   event_date = {23-26 May 2011},
   language = {30},
   DOI = {10.1063/1.3657910},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bodermann, B. and Buhr, E. and Danzebrink, H.-U. and B{\"a}r, M. and Scholze, F. and Krumrey, M. and Wurm, M. and Klapetek, P. and Hansen, P.-E. and Korpelainen, V. and van Veghel, M. and Yacoot, A. and Siitonen, S. and El Gawhary, O. and Burger, S. and Saastamoinen, T.}
}

@Article { ,
   title = {Spectral Radiation Drift of LEDs Under Step-Mode Operation and Its Effect on the Measurement of the Non-Linearity of Radiation Thermometers},
   journal = {International Journal of Thermophysics},
   year = {2011},
   month = {9},
   day = {28},
   volume = {32},
   number = {11},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {2587-2599},
   keywords = {Drift, LEDs, Non-linearity, Radiation thermometry},
   web_url = {http://link.springer.com/article/10.1007\%2Fs10765-011-1090-z},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer Link},
   address = {Europe/Asia/Africa},
   language = {30},
   ISSN = {NA},
   DOI = {10.1007/s10765-011-1090-z},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Dong, W and Yuan, Z and Bloembergen, P and Lu, X and Duan, Y}
}

@Proceedings { ,
   title = {Nonlinearity measurement of filter radiometers using water-cooled LED radiation sources},
   journal = {Proceedings of NEWRAD 2011},
   year = {2011},
   month = {9},
   day = {23},
   volume = {NEWRAD},
   number = {2011},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {189-190},
   keywords = {Nonlinearity measurement of filter radiometers using water-cooled LED radiation sources},
   web_url = {http://physics.nist.gov/newrad2011/NewRAD2011_AbstractCollection_20110704.pdf},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {NEWRAD},
   address = {Maui},
   event_place = {Maui},
   event_name = {NEWRAD 2011},
   event_date = {19-09-2011 to 23-09-2011},
   language = {30},
   ISBN = {NA},
   ISSN = {NA},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Dong, W and Yuan, Z and Bloembergen, P and Lu, X and Duan, Y}
}

@Article { ,
   title = {Study of the spectral responsivity for the 900 nm centered filter radiometer},
   journal = {Applied Mechanics and Materials},
   year = {2011},
   month = {7},
   day = {18},
   volume = {66},
   number = {68},
   number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies},
   pages = {1444-1449},
   keywords = {Filter radiometer; spectral responsivity; repeatability},
   web_url = {http://www.scientific.net/AMM.66-68.1444},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Trans Tech Publications},
   address = {Pfaffikon},
   language = {30},
   ISSN = {NA},
   DOI = {10.4028/www.scientific.net/AMM.66-68.1444},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Zhang, J and Lu, X and Guo, M and Yang, J and Yuan, Z}
}

@Article { ,
   title = {Calibration of the Irradiance Responsivity of a Filter Radiometer for T Measurement at NIM},
   journal = {International Journal of Thermophysics},
   year = {2011},
   month = {1},
   day = {19},
   volume = {32},
   number = {1-2},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {278-284},
   keywords = {Filter radiometer · Monochromator · Spectral responsivity · Thermodynamic temperature},
   web_url = {http://link.springer.com/article/10.1007/s10765-011-0911-4},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer},
   address = {Europe/Asia/Africa},
   language = {30},
   ISSN = {0195-928X},
   DOI = {10.1007/s10765-011-0911-4},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lu, X and Yuan, Z and Hao, X and Lin, Y and Yang, J}
}

@Article { StoicaYVF2011,
   title = {Evaluation of standard potential of Ag/AgCl electrode in a 50 wt\% water-ethanol mixture},
   journal = {Journal of Solution Chemistry},
   year = {2011},
   volume = {40},
   number2 = {ENG09: Biofuels: Metrology for Biofuels},
   pages = {1819-1834},
   tags = {EnG},
   misc2 = {EMRP A169: Call 2009 Energy},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stoica, D. and Yardin, Y. and Vaslin-Reimann, S. and Fisicaro, P.}
}

@Article { NouiraEYAS201,
   title = {Metrological characterization of optical confocal sensors measurements (20 and 350 travel ranges)},
   journal = {Journal of Physics: Conference Series},
   year = {201},
   month = {4},
   day = {7},
   volume = {483},
   number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization},
   pages = {12},
   web_url = {http://iopscience.iop.org/1742-6596/483/1/012015},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   ISSN = {1742-6596},
   DOI = {10.1088/1742-6596/483/1/012015},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nouira, H and El-Hayek, N and Yuan, X and Anwer, N and Salgado, J}
}

@Miscellaneous { ElsterMKMYF,
   subid = {1588},
   title = {EMUE-D4-3-QuantifyUncertaintiesInCalibration},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Measurement uncertainty; Measurement model; GUM; Monte Carlo, Straight-line regression; Calibration; Covariance; Weighted total least-squares; Sonic nozzle},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   DOI = {10.5281/zenodo.4016916},
   stag_bib_extends_levelofaccess = {NA},
   author = {Elster, C. and Martens, S. and Klauenberg, K. and Mickan, B. and Yardin, C. and Fischer, N.}
}

@Miscellaneous { FurstYKKDLBHPM,
   subid = {1872},
   title = {Data associated with the publication ''Coherent excitation of the highly forbidden electric octupole transition in 172Yb+''},
   journal = {https://oar.ptb.de/resources/show/10.7795/720.20201221},
   volume = {-},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   pages = {-},
   keywords = {atomic spectra, atomic clocks, optical clocks, coherent control, cooling and trapping, laser spectroscopy, trapped ions},
   web_url = {https://oar.ptb.de/resources/show/10.7795/720.20201221},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {-},
   address = {-},
   ISSN = {-},
   DOI = {https://doi.org/10.7795/720.20201221},
   stag_bib_extends_levelofaccess = {NA},
   author = {Furst, H. and Yeh, C-H. and Kalincev, D. and Kulosa, A. and Dreissen, L. and Lange, R. and Benkler, E. and Huntemann, N. and Peik, E. and Mehlstaubler, T.}
}

@Miscellaneous { FerreroCBVSYACMT,
   subid = {2164},
   title = {Dataset: Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes},
   journal = {Zenodo},
   number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept},
   keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations},
   misc2 = {EMPIR 2018: Health},
   DOI = {10.5281/zenodo.5040394},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ferrero, R. and Celegato, F. and Barrera, G. and Vicentini, M. and S{\"o}zeri, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.}
}

@Miscellaneous { ChaeKKPMKPGYSCCF,
   subid = {2654},
   title = {Dataset of D.-H. Chae et al., Meas. Sci.Technol 33 (2022) 065012, ''Investigation of the stability of graphene devices for quantum resistance metrology at direct and alternating current''},
   journal = {zenodo},
   number2 = {18SIB07: GIQS: Graphene impedance quantum standard},
   keywords = {quantum Hall effect, quantized Hall resistance, graphene, impedance standard, F4-TCNQ doping, stability},
   web_url = {https://zenodo.org/record/6368003},
   misc2 = {EMPIR 2018: SI Broader Scope},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {10.5281/zenodo.6368002},
   author = {Chae, D-H. and Kruskopf, M. and Kucera, J. and Park, J. and Mai Tran, N.T. and Kim, D.B. and Pierz, K. and G{\"o}tz, M. and Yin, Y. and Svoboda, P. and Chrobok, P. and Cou{\"e}do, F. and F{\'e}licien, S.}
}