% % This file was created by the TYPO3 extension % bib % --- Timezone: CEST % Creation date: 2022-08-18 % Creation time: 21-39-32 % --- Number of references % 558 % @Article { MierRVL2023, subid = {2838}, title = {Magnetic and electric antennas synergy for partial discharge measurements in gas-insulated substations: Power flow and reflection suppression}, journal = {International Journal of Electrical Power \& Energy Systems}, year = {2023}, month = {8}, day = {12}, volume = {144}, number = {January 20}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, keywords = {partial discharges, PD sensors, GIS, pulse overlapping, UHF antenna, magnetic antenna}, misc2 = {EMPIR 2019: Energy}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.ijepes.2022.108530}, stag_bib_extends_levelofaccess = {NA}, author = {Mier, C. and Rodrigo Mor, A. and Vaessen, P. and Lathouwers, A.} } @Article { SolcJMOPSTV2022, subid = {2839}, title = {Monte Carlo modelling of pixel clusters in Timepix detectors using the MCNP code}, journal = {Physica Medica}, year = {2022}, month = {9}, volume = {101}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {79-86}, keywords = {Monte Carlo simulation, Pixel detector, UHDpulse, Charge sharing}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2022.08.002}, stag_bib_extends_levelofaccess = {NA}, author = {Solc, J. and Jakubek, J. and Marek, L. and Oancea, C. and Pivec, J. and Smoldasova, J. and Tesař, J. and Vykydal, Z.} } @Article { KurizkiKOGPAVGCDG2022, subid = {2818}, title = {Quantum Zeno and Anti-Zeno Probes of Noise Correlations in Photon Polarization}, journal = {Physical Review Letters}, year = {2022}, month = {7}, day = {13}, volume = {129}, number = {3}, number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware}, keywords = {Quantum measurements, Weak measurements}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.129.030401}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.129.030401}, stag_bib_extends_levelofaccess = {NA}, author = {Kurizki, G. and Kofman, A.G. and Opatrn{\'y}, T. and Gramegna, M. and Piacentini, F. and Avella, A. and Virz{\`i}, S. and Gherardini, S. and Caruso, F. and Degiovanni, I.P. and Genovese, M.} } @Article { IrwinHSBSBSV2022, subid = {2623}, title = {Characterising the silver particle generator; a pathway towards standardising silver aerosol generation}, journal = {Journal of Aerosol Science}, year = {2022}, month = {6}, volume = {163}, number2 = {19ENV09: MetroPEMS: Improved vehicle exhaust quantification by portable emission measurement systems metrology}, pages = {105978}, keywords = {silver particle generator, calibration, reference aerosol, CPC calibration, DMA calibration}, web_url = {https://www.sciencedirect.com/science/article/pii/S002185022200026X?via\%3Dihub}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2022.105978}, stag_bib_extends_levelofaccess = {NA}, author = {Irwin, M. and Hammer, T. and Swanson, J. and Berger, V. and Sonkamble, U. and Boies, A. and Schulz, H. and Vasilatou, K.} } @Article { RubenVogtRGDKMKKSBBMPFCRVSH2022, subid = {2751}, title = {PV Module Energy Rating Standard IEC 61853-3 Intercomparison and Best Practice Guidelines for Implementation and Validation}, journal = {IEEE Journal of Photovoltaics}, year = {2022}, month = {5}, volume = {12}, number = {3}, number2 = {19ENG01: Metro-PV: Metrology for emerging PV applications}, pages = {844-852}, keywords = {Standards, Meteorology, IEC Standards, Temperature measurement, Power measurement, Photovoltaic systems, Mathematical models}, web_url = {https://www.techrxiv.org/articles/preprint/PV_module_energy_rating_standard_IEC_61853-3_intercomparison_and_best_practice_guidelines_for_implementation_and_validation/19635333/1}, misc2 = {EMPIR 2019: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2021.3135258}, stag_bib_extends_levelofaccess = {NA}, author = {Ruben Vogt, M. and Riechelmann, S. and Gracia-Amillo, A.M. and Driesse, A. and Kokka, A. and Maham, K. and K{\"a}rh{\"a}, P. and Kenny, R. and Schinke, C. and Bothe, K. and Blakesley, J. and Music, E. and Plag, F. and Friesen, G. and Corbellini, G. and Riedel-Lyngskar, N. and Valckenborg, R. and Schweiger, M. and Herrmann, W.} } @Article { VolkovaHTBCMARERBPN2022, subid = {2712}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {color centers, optical quantum technology}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { VolkovaHTBCMARERBPN2022_2, subid = {2721}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { vanHeerenSPB2022, subid = {2698}, title = {Metrology challenges for microfluidics}, journal = {CMM Magazine}, year = {2022}, month = {4}, day = {13}, volume = {15}, number = {2}, number2 = {20NRM02: MFMET: Establishing metrology standards in microfluidic devices}, pages = {20-25}, keywords = {Microfluidics, metrology, fabrication, testing}, web_url = {http://www.cmmmagazine.com/cmm-articles/metrology-challenges-for-microfluidics/}, misc2 = {EMPIR 2020: Pre-Co-Normative}, publisher = {MST Global Ltd}, language = {30}, ISSN = {2634-9167}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISSN 2634-9167}, author = {van Heeren, H. and Silverio, V. and Pecnik, C. and Batista, E.} } @Article { RabagoQVSRICCRCFFRG2022, subid = {2671}, title = {Intercomparison of Radon Flux Monitors at Low and at High Radium Content Areas under Field Conditions}, journal = {International Journal of Environmental Research and Public Health}, year = {2022}, month = {4}, volume = {19}, number = {7}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, pages = {4213}, keywords = {exhalation; traceRadon; proficiency test; interlaboratory comparison}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1660-4601}, DOI = {10.3390/ijerph19074213}, stag_bib_extends_levelofaccess = {NA}, author = {Rabago, D. and Quindos, L. and Vargas, A. and Sainz, C. and Radulescu, I. and Ioan, M-R. and Cardellini, F. and Capogni, M. and Rizzo, A. and Celaya, S. and Fuente, I. and Fuente, M. and Rodriguez, M. and Grossi, C.} } @Article { LivreriEFGRVFMG2022, subid = {2789}, title = {Microwave Quantum Radar using a Josephson Traveling Wave Parametric Amplifier}, journal = {2022 IEEE Radar Conference (RadarConf22)}, year = {2022}, month = {3}, day = {21}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, keywords = {Microwave quantum radar, Josephson traveling parametric amplifier, quantum microwave illumination, two-mode squeezing, non-classical light source, entanglement}, web_url = {https://arxiv.org/abs/2111.03409}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IEEE}, language = {30}, DOI = {10.1109/RadarConf2248738.2022.9764353}, stag_bib_extends_levelofaccess = {NA}, author = {Livreri, P. and Enrico, E. and Fasolo, L. and Greco, A. and Rettaroli, A. and Vitali, D. and Farina, A. and Marchetti, Com. F. and Giacomin, A. Sq. D.} } @Article { RottgerRGVKCCKRMR2022, subid = {2625}, title = {Radon metrology for use in climate change observation and radiation protection at the environmental level}, journal = {Advances in Geosciences}, year = {2022}, month = {3}, day = {10}, volume = {57}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, pages = {37-47}, keywords = {Radon, climate observation, radon monitor, radiation protection, radon tracer method (RTM), radon emanation source, activity concentration, traceability}, misc2 = {EMPIR 2019: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7359}, DOI = {10.5194/adgeo-57-37-2022}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, S. and R{\"o}ttger, A. and Grossi, C. and Vargas, A. and Karstens, U. and Cinelli, G. and Chung, E. and Kikaj, D. and Rennick, C. and Mertes, F. and Radulescu, I.} } @Article { KlenovskyVKVKF2022, subid = {2689}, title = {Interplay between multipole expansion of exchange interaction and Coulomb correlation of exciton in colloidal II–VI quantum dots}, journal = {Electronic Structure}, year = {2022}, month = {3}, volume = {4}, number = {1}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {015006}, keywords = {quantum dots}, web_url = {https://iopscience.iop.org/article/10.1088/2516-1075/ac5b7e}, misc2 = {EMPIR 2020: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {2516-1075}, DOI = {10.1088/2516-1075/ac5b7e}, stag_bib_extends_levelofaccess = {NA}, author = {Klenovsk{\'y}, P. and Valdhans, J. and Krejč{\'i}, L. and Valtr, M. and Klapetek, P. and Fedotova, O.} } @Article { KlenovskyVKVKF20220, subid = {2689}, title = {Interplay between multipole expansion of exchange interaction and Coulomb correlation of exciton in colloidal II–VI quantum dots}, journal = {Electronic Structure}, year = {2022}, month = {3}, volume = {4}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {015006}, keywords = {quantum dots}, web_url = {https://iopscience.iop.org/article/10.1088/2516-1075/ac5b7e}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2516-1075}, DOI = {10.1088/2516-1075/ac5b7e}, stag_bib_extends_levelofaccess = {NA}, author = {Klenovsk{\'y}, P. and Valdhans, J. and Krejč{\'i}, L. and Valtr, M. and Klapetek, P. and Fedotova, O.} } @Article { KlenovskyVKVKF20221, subid = {2689}, title = {Interplay between multipole expansion of exchange interaction and Coulomb correlation of exciton in colloidal II–VI quantum dots}, journal = {Electronic Structure}, year = {2022}, month = {3}, volume = {4}, number = {1}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {015006}, keywords = {quantum dots}, web_url = {https://iopscience.iop.org/article/10.1088/2516-1075/ac5b7e}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2516-1075}, DOI = {10.1088/2516-1075/ac5b7e}, stag_bib_extends_levelofaccess = {NA}, author = {Klenovsk{\'y}, P. and Valdhans, J. and Krejč{\'i}, L. and Valtr, M. and Klapetek, P. and Fedotova, O.} } @Article { KlenovskyVKVKF20222, subid = {2689}, title = {Interplay between multipole expansion of exchange interaction and Coulomb correlation of exciton in colloidal II–VI quantum dots}, journal = {Electronic Structure}, year = {2022}, month = {3}, volume = {4}, number = {1}, number2 = {20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light}, pages = {015006}, keywords = {quantum dots}, web_url = {https://iopscience.iop.org/article/10.1088/2516-1075/ac5b7e}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2516-1075}, DOI = {10.1088/2516-1075/ac5b7e}, stag_bib_extends_levelofaccess = {NA}, author = {Klenovsk{\'y}, P. and Valdhans, J. and Krejč{\'i}, L. and Valtr, M. and Klapetek, P. and Fedotova, O.} } @Article { MarlettoVKPBRAGDG2022, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2020: Industry}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { MarlettoVKPBRAGDG20220, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { MarlettoVKPBRAGDG20221, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2020: Fundamental}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { WeingartnerHVVROKMD2022, subid = {2519}, title = {Comparing black-carbon- and aerosol-absorption-measuring instruments – a new system using lab-generated soot coated with controlled amounts of secondary organic matter}, journal = {Atmospheric Measurement Techniques}, year = {2022}, month = {2}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, keywords = {soot , black carbon, absorption photometer, photo-thermal interferometer, calibration}, misc2 = {EMPIR 2018: Health}, language = {30}, DOI = {10.5194/amt-15-561-2022}, stag_bib_extends_levelofaccess = {NA}, author = {Weingartner, E. and Hyv{\"a}rinen, A-P. and Vasilatou, K. and Visser, B. and R{\"o}rhbein, J. and Oscity, M. and Kalbermatter, D. and Močnik, G. and Drinovec, L.} } @Article { JuradoCLLVdM2022, subid = {2544}, title = {The Spectral Extent of Phasic Suppression of Loudness and Distortion-Product Otoacoustic Emissions by Infrasound and Low-Frequency Tones}, journal = {Journal of the Association for Research in Otolaryngology}, year = {2022}, month = {2}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, keywords = {loudness, DPOAE, infrasound}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1525-3961, 1438-7573}, DOI = {10.1007/s10162-021-00830-2}, stag_bib_extends_levelofaccess = {NA}, author = {Jurado, C. and Chow, M.Y.P. and Leung, K.M.L. and Larrea, M. and Vizuete, J. and de Cheveign{\'e}, A. and Marquardt, T.} } @Proceedings { SinghRathoreLBSV2022, subid = {2587}, title = {Benchmarking of different reconstruction algorithms for industrial cone-beam CT}, journal = {Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022,}, year = {2022}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {reconstruction, tomography, iterative, Analytical}, web_url = {https://www.ndt.net/search/docs.php3?id=26640}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {11th Conference on Industrial Computed Tomography (iCT) 2022}, event_date = {08-02-2022 to 11-02-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id244.pdf}, author = {Singh Rathore, J. and Laquai, R. and Biguri, A. and Soleimani, M. and Vienne, C. } } @Article { MarinelliFGGGHPPVVVV2022, subid = {2659}, title = {Design, realization, and characterization of a novel diamond detector prototype for FLASH radiotherapy dosimetry}, journal = {Medical Physics}, year = {2022}, month = {1}, day = {31}, volume = {49}, number = {3}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {1902-1910}, keywords = {diamond detector, dosimetry, FLASH radiotherapy}, misc2 = {EMPIR 2018: Health}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.15473}, stag_bib_extends_levelofaccess = {NA}, author = {Marinelli, M. and Felici, G. and Galante, F. and Gasparini, A. and Giuliano, L. and Heinrich, S. and Pacitti, M. and Prestopino, G. and Vanreusel, V. and Verellen, D. and Verona, C. and Verona Rinati, G.} } @Article { MilanoBVR2022, subid = {2556}, title = {Memristive devices based on single ZnO nanowires—from material synthesis to neuromorphic functionalities}, journal = {Semiconductor Science and Technology}, year = {2022}, month = {1}, day = {28}, volume = {37}, number = {3}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {034002}, keywords = {nanowires, ZnO, chemical vapor deposition (CVD), resistive switching,memristive devices, neuromorphic devices}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6641/ac4b8a}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0268-1242, 1361-6641}, DOI = {10.1088/1361-6641/ac4b8a}, stag_bib_extends_levelofaccess = {NA}, author = {Milano, G. and Boarino, L. and Valov, I. and Ricciardi, C.} } @Article { VillegasQUTL2022, subid = {2535}, title = {Identification of Model Particle Mixtures Using Machine-Learning-Assisted Laser Diffraction}, journal = {Photonics}, year = {2022}, month = {1}, day = {28}, volume = {9}, number = {2}, number2 = {20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light}, pages = {74}, keywords = {Particle characterization; Laser diffraction; Machine learning; Neural networks}, web_url = {https://www.mdpi.com/2304-6732/9/2/74}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2304-6732}, DOI = {10.3390/photonics9020074}, stag_bib_extends_levelofaccess = {NA}, author = {Villegas, A. and Quiroz-Ju{\'a}rez, M.A. and U’Ren, A.B. and Torres, J.P. and Le{\'o}n-Montiel, R. de J.} } @Article { KrokerVKGSKB2022, subid = {2815}, title = {Mueller Matrix Ellipsometric Approach on the Imaging of Sub-Wavelength Nanostructures}, journal = {Frontiers in Physics}, year = {2022}, month = {1}, day = {21}, volume = {9}, number2 = {20FUN02: POlight: Pushing boundaries of nano-dimensional metrology by light}, pages = {814559}, keywords = {metrology, nanometrology, ellipsometry, mueller ellipsometry, imaging ellipsometry, nanostructures,mueller matrix ellipsometry}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2021.814559}, stag_bib_extends_levelofaccess = {NA}, author = {Kroker, S. and Valtr, M. and Klapetek, P. and Grundmann, J. and Siefke, T. and K{\"a}seberg, T. and Bodermann, B.} } @Article { KellerSKFCVCOBHMMNORBCNCDDGLVWZK2022, subid = {2778}, title = {RNA reference materials with defined viral RNA loads of SARS-CoV-2—A useful tool towards a better PCR assay harmonization}, journal = {PLOS ONE}, year = {2022}, month = {1}, day = {20}, volume = {17}, number = {1}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {e0262656}, keywords = {SARS-CoV-2, RNA, PCR}, misc2 = {EMPIR 2018: Health}, publisher = {Public Library of Science (PLoS)}, language = {30}, ISSN = {1932-6203}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6637818}, author = {Keller, T. and Schellenberg, I. and Kummrow, A. and Falak, S. and Cleveland, M.H. and Vallone, P.M. and Cowen, S. and O’Sullivan, D. and Busby, E. and Huggett, J. and Mielke, M. and Michel, J. and Nitsche, A. and Obermeier, M. and Rabenau, H.F. and Berger, A. and Ciesek, S. and Niemeyer, D. and Corman, V. and Duehring, U. and Drosten, C. and Grunert, H-P. and Lindig, V. and Vierbaum, L. and Wojtalewicz, N. and Zeichhardt, H. and Kammel, M.} } @Article { ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022, subid = {2567}, title = {2022 roadmap on neuromorphic computing and engineering}, journal = {Neuromorphic Computing and Engineering}, year = {2022}, month = {1}, day = {12}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, keywords = {neuromorphic computing, neuromorphic engineering}, web_url = {https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2634-4386}, DOI = {10.1088/2634-4386/ac4a83}, stag_bib_extends_levelofaccess = {NA}, author = {Christensen, D.V. and Dittmann, R. and Linares-Barranco, B. and Sebastian, A. and Le Gallo, M. and Redaelli, A. and Slesazeck, S. and Mikolajick, T. and Spiga, S. and Menzel, S. and Valov, I. and Milano, G. and Ricciardi, C. and Liang, S-J. and Miao, F. and Lanza, M. and Quill, T.J. and Keene, S.T. and Salleo, A. and Grollier, J. and Markovic, D. and Mizrahi, A. and Yao, P. and Yang, J.J. and Indiveri, G. and Strachan, J.P. and Datta, S. and Vianello, E. and Valentian, A. and Feldmann, J. and Li, X. and Pernice, W.H.P. and Bhaskaran, H. and Furber, S. and Neftci, E. and Scherr, F. and Maass, W. and Ramaswamy, S. and Tapson, J. and Panda, P. and Kim, Y. and Tanaka, G. and Thorpe, S. and Bartolozzi, C. and Cleland, T.A. and Posch, C. and Liu, S-C. and Panuccio, G. and Mahmud, M. and Mazumder, A.N. and Hosseini, M. and Mohsenin, T. and Donati, E. and Tolu, S. and Galeazzi, R. and Christensen, M.E. and Holm, S. and Ielmini, D. and Pryds, N.} } @Article { ClivatiMDVGLMPYSLDC2022, subid = {2524}, title = {Coherent phase transfer for real-world twin-field quantum key distribution}, journal = {Nature Communications}, year = {2022}, month = {1}, day = {10}, volume = {13}, number = {1}, number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware}, pages = {s41467-021-27808-1}, keywords = {QKD, Single photons and quantum effects, Optical metrology, Fibre optics and optical communications, Optoelectronic devices and components, Quantum information}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-021-27808-1}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Meda, A. and Donadello, S. and Virz{\`i}, S. and Genovese, M. and Levi, F. and Mura, A. and Pittaluga, M. and Yuan, Z. and Shields, A.J. and Lucamarini, M. and Degiovanni, I.P. and Calonico, D.} } @Article { CelikovicPVNiCGBQR2022, subid = {2428}, title = {Outdoor Radon as a Tool to Estimate Radon Priority Areas—A Literature Overview}, journal = {International Journal of Environmental Research and Public Health}, year = {2022}, month = {1}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {outdoor radon concentrations; literature overview; radiation risk; indoor radonconcentrations; radon priority areas}, misc2 = {EMPIR 2019: Environment}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.3390/ijerph19020662}, author = {Čeliković, I. and Pantelić, G. and Vukanac, I. and Nikolić, J.K. and Živanović, M. and Cinelli, G. and Gruber, V. and Baumann, S. and Quindos Poncela, L.S. and Rabago, D.} } @Article { Villajos2022, subid = {2472}, title = {Experimental Volumetric Hydrogen Uptake Determination at 77 K of Commercially Available Metal-Organic Framework Materials}, journal = {C-Journal of Carbon Research}, year = {2022}, month = {1}, volume = {8}, number = {1}, number2 = {19ENG03: MefHySto: Metrology for Advanced Hydrogen Storage Solutions}, pages = {5}, keywords = {hydrogen adsorption, commercial metal-organic frameworks, hydrogen uptake reproducibility, volumetric uptake, packing density}, misc2 = {EMPIR 2019: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2311-5629}, DOI = {10.3390/c8010005}, stag_bib_extends_levelofaccess = {NA}, author = {Villajos, J.A.} } @Article { KellerKWSSRKHV2022, subid = {2842}, title = {The organic coating unit, an all-in-one system for reproducible generation of secondary organic matter aerosol}, journal = {AEROSOL SCIENCE AND TECHNOLOGY}, year = {2022}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, keywords = {oxidation flow reactor, ozonolysis, secondary organic matter, soot, pinene, atmospheric ageing, aged soot}, web_url = {https://www.tandfonline.com/doi/full/10.1080/02786826.2022.2110448}, misc2 = {EMPIR 2018: Health}, language = {30}, DOI = {10.1080/02786826.2022.2110448}, stag_bib_extends_levelofaccess = {NA}, author = {Keller, A. and Kalbermatter, D. and Wolfer, K. and Specht, P. and Steigmeier, P. and Resch, J. and Kalberer, M. and Hammer, T. and Vasilatou, K.} } @Article { FasoloBBCCCCCDEFFFFGGGGKLLLMMMMMMMNOPPPRRRSUV2022, subid = {2612}, title = {Bimodal Approach for Noise Figures of Merit Evaluation in Quantum-Limited Josephson Traveling Wave Parametric Amplifiers}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2022}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, keywords = {Physics, Gain, Microwave amplifiers, Noise figure, Superconducting microwave devices, Microwave photonics, Bandwidth}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2022.3148692}, stag_bib_extends_levelofaccess = {NA}, author = {Fasolo, L. and Barone, C. and Borghesi, M. and Carapella, G. and Caricato, A.P. and Carusotto, I. and Chung, W. and Cian, A. and Di Gioacchino, D. and Enrico, E. and Falferi, P. and Faverzani, M. and Ferri, E. and Filatrella, G. and Gatti, C. and Giachero, A. and Giubertoni, D. and Greco, A. and Kutlu, C. and Leo, A. and Ligi, C. and Livreri, P. and Maccarone, G. and Margesin, B. and Maruccio, G. and Matlashov, A. and Mauro, C. and Mezzena, R. and Monteduro, A.G. and Nucciotti, A. and Oberto, L. and Pagano, S. and Pierro, V. and Piersanti, L. and Rajteri, M. and Rettaroli, A. and Rizzato, S. and Semertzidis, Y.K. and Uchaikin, S.V. and Vinante, A.} } @Article { MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022, subid = {2764}, title = {Versailles project on advanced materials and standards (VAMAS) interlaboratory study on measuring the number concentration of colloidal gold nanoparticles}, journal = {Nanoscale}, year = {2022}, volume = {14}, number = {12}, number2 = {18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration}, pages = {4690-4704}, keywords = {nanoparticle, concentration, standardization, VAMAS, interlaboratory}, misc2 = {EMPIR 2018: Support for Impact}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/D1NR07775A}, stag_bib_extends_levelofaccess = {NA}, author = {Minelli, C. and Wywijas, M. and Bartczak, D. and Cuello-Nu{\~n}ez, S. and Infante, H.G. and Deumer, J. and Gollwitzer, C. and Krumrey, M. and Murphy, K.E. and Johnson, M.E. and Montoro Bustos, A.R. and Strenge, I.H. and Faure, B. and H{\o}gh{\o}j, P. and Tong, V. and Burr, L. and Norling, K. and H{\"o}{\"o}k, F. and Roesslein, M. and Kocic, J. and Hendriks, L. and Kestens, V. and Ramaye, Y. and Contreras Lopez, M.C. and Auclair, G. and Mehn, D. and Gilliland, D. and Potthoff, A. and Oelschl{\"a}gel, K. and Tentschert, J. and Jungnickel, H. and Krause, B.C. and Hachenberger, Y.U. and Reichardt, P. and Luch, A. and Whittaker, T.E. and Stevens, M.M. and Gupta, S. and Singh, A. and Lin, F-h. and Liu, Y-H. and Costa, A.L. and Baldisserri, C. and Jawad, R. and Andaloussi, S.E.L. and Holme, M.N. and Lee, T.G. and Kwak, M. and Kim, J. and Ziebel, J. and Guignard, C. and Cambier, S. and Contal, S. and Gutleb, A.C. and “Kuba” Tatarkiewicz, J. and Jankiewicz, B.J. and Bartosewicz, B. and Wu, X. and Fagan, J.A. and Elje, E. and Rund{\'e}n-Pran, E. and Dusinska, M. and Kaur, I.P. and Price, D. and Nesbitt, I. and O\(\prime\) Reilly, S. and Peters, R.J.B. and Bucher, G. and Coleman, D. and Harrison, A.J. and Ghanem, A. and Gering, A. and McCarron, E. and Fitzgerald, N. and Cornelis, G. and Tuoriniemi, J. and Sakai, M. and Tsuchida, H. and Maguire, C. and Prina-Mello, A. and Lawlor, A.J. and Adams, J. and Schultz, C.L. and Constantin, D. and Thanh, N.T.K. and Tung, L.D. and Panariello, L. and Damilos, S. and Gavriilidis, A. and Lynch, I. and Fryer, B. and Carrazco Quevedo, A. and Guggenheim, E. and Briffa, S. and Valsami-Jones, E. and Huang, Y. and Keller, A.A. and Kinnunen, V-T. and Per{\"a}m{\"a}ki, S. and Krpetic, Z. and Greenwood, M. and Shard, A.G.} } @Article { XieDv2021, subid = {2478}, title = {Design of “Universal Module” Based Time and Frequency System using White Rabbit Technology}, journal = {IEEE TechRxiv}, year = {2021}, month = {12}, day = {10}, number2 = {17IND14: WRITE: Precision Time for Industry}, keywords = {White Rabbit; time and frequency transfer; frequency distribution; frequency stability measurement}, misc2 = {EMPIR 2017: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, DOI = {10.36227/techrxiv.17122154.v1}, stag_bib_extends_levelofaccess = {NA}, author = {Xie, Y. and Dierikx, E. and van Veghel, M.} } @Article { LieberherrACCCGKMMMOSSTV2021, subid = {2368}, title = {Assessment of real-time bioaerosol particle counters using reference chamber experiments}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {12}, volume = {14}, number = {12}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {7693-7706}, keywords = {bioaerosol monitors, calibration, counting efficiency, fluorescence}, web_url = {https://amt.copernicus.org/articles/14/7693/2021/}, misc2 = {EMPIR 2019: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-7693-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Lieberherr, G. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Gysel-Beer, M. and Konzelmann, T. and Manzano, J. and Mihajlovic, A. and Moallemi, A. and O'Connor, D. and Sikoparija, B. and Sauvageat , E. and Tummon, F. and Vasilatou, K.} } @Article { OlbrichHLvBOS2021, subid = {2175}, title = {Comparing temporal characteristics of slug flow from tomography measurements and video observations}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {100222}, keywords = {slug flow, interface dynamics, tomography, video observation}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001859}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100222}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and Hunt, A. and Leonard, T. and van Putten, D.S. and B{\"a}r, M. and Oberleithner, K. and Schmelter, S.} } @Article { FasoloGEILVL2021, subid = {2582}, title = {Josephson Traveling Wave Parametric Amplifiers as non-classical light source for Microwave Quantum Illumination}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, pages = {100349}, keywords = {Microwave quantum illumination, Josephson traveling wave parametric amplifiers, Entangled quantum states, Detection probability improvement}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100349}, stag_bib_extends_levelofaccess = {NA}, author = {Fasolo, L. and Greco, A. and Enrico, E. and Illuminati, F. and Lo Franco, R. and Vitali, D. and Livreri, P.} } @Article { DizdarAV2021, subid = {2673}, title = {Establishment of continuous force calibration system at TUBITAK UME force laboratory in Turkey}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services}, pages = {100216}, keywords = {Piezoelectric force sensor; Continuous force calibration}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001793}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100216}, stag_bib_extends_levelofaccess = {NA}, author = {Dizdar, H. and Aydemir, B. and Vatan, C.} } @Article { ChenV2021, subid = {2452}, title = {Design of Materials Configuration for Optimizing Redox‐Based Resistive Switching Memories}, journal = {Advanced Materials}, year = {2021}, month = {11}, day = {21}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {2105022}, keywords = {capping layers, electrode materials, redox reactions, resistive switching, thicknesses}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/adma.202105022}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {0935-9648, 1521-4095}, DOI = {10.1002/adma.202105022}, stag_bib_extends_levelofaccess = {NA}, author = {Chen, S. and Valov, I.} } @Article { RottgerVSPDISBAGGBWPiN2021, subid = {2317}, title = {Metrology for radiation protection: a new European network in the foundation phase}, journal = {Advances in Geosciences}, year = {2021}, month = {11}, day = {17}, volume = {57}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, pages = {1-7}, keywords = {supportBSS, EMN for Radiation Protection, metrology, regulation, EURAMET, EURATOM}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7359}, DOI = {10.5194/adgeo-57-1-2021}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and Veres, A. and Sochor, V. and Pinto, M. and Derlacinski, M. and Ioan, M-R. and Sabeta, A. and Bernat, R. and Adam-Guillermin, C. and Gracia Alves, J.H. and Glavič-Cindro, D. and Bell, S. and Wens, B. and Persson, L. and Živanović, M. and Nylund, R.} } @Article { HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021, subid = {2336}, title = {Frequency drift in MR spectroscopy at 3T}, journal = {NeuroImage}, year = {2021}, month = {11}, volume = {241}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {118430}, keywords = {Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2021.118430}, stag_bib_extends_levelofaccess = {NA}, author = {Hui, S.C.N. and Mikkelsen, M. and Z{\"o}llner, H.J. and Ahluwalia, V. and Alcauter, S. and Baltusis, L. and Barany, D.A. and Barlow, L.R. and Becker, R. and Berman, J.I. and Berrington, A. and Bhattacharyya, P.K. and Blicher, J.U. and Bogner, W. and Brown, M.S. and Calhoun, V.D. and Castillo, R. and Cecil, K.M. and Choi, Y.B. and Chu, W.C.W. and Clarke, W.T. and Craven, A.R. and Cuypers, K. and Dacko, M. and de la Fuente-Sandoval, C. and Desmond, P. and Domagalik, A. and Dumont, J. and Duncan, N.W. and Dydak, U. and Dyke, K. and Edmondson, D.A. and Ende, G. and Ersland, L. and Evans, C.J. and Fermin, A.S.R. and Ferretti, A. and Fillmer, A. and Gong, T. and Greenhouse, I. and Grist, J.T. and Gu, M. and Harris, A.D. and Hat, K. and Heba, S. and Heckova, E. and Hegarty, J.P. and Heise, K-F. and Honda, S. and Jacobson, A. and Jansen, J.F.A. and Jenkins, C.W. and Johnston, S.J. and Juchem, C. and Kangarlu, A. and Kerr, A.B. and Landheer, K. and Lange, T. and Lee, P. and Levendovszky, S.R. and Limperopoulos, C. and Liu, F. and Lloyd, W. and Lythgoe, D.J. and Machizawa, M.G. and MacMillan, E.L. and Maddock, R.J. and Manzhurtsev, A.V. and Martinez-Gudino, M.L. and Miller, J.J. and Mirzakhanian, H. and Moreno-Ortega, M. and Mullins, P.G. and Nakajima, S. and Near, J. and Noeske, R. and Nordh{\o}y, W. and Oeltzschner, G. and Osorio-Duran, R. and Otaduy, M.C.G. and Pasaye, E.H. and Peeters, R. and Peltier, S.J. and Pilatus, U. and Polomac, N. and Porges, E.C. and Pradhan, S. and Prisciandaro, J.J. and Puts, N.A. and Rae, C.D. and Reyes-Madrigal, F. and Roberts, T.P.L. and Robertson, C.E. and Rosenberg, J.T. and Rotaru, D-G. and O'Gorman Tuura, R.L. and Saleh, M.G. and Sandberg, K. and Sangill, R. and Schembri, K. and Schrantee, A. and Semenova, N.A. and Singel, D. and Sitnikov, R. and Smith, J. and Song, Y. and Stark, C. and Stoffers, D. and Swinnen, S.P. and Tain, R. and Tanase, C. and Tapper, S. and Tegenthoff, M. and Thiel, T. and Thioux, M. and Truong, P. and van Dijk, P. and Vella, N. and Vidyasagar, R. and Vovk, A. and Wang, G. and Westlye, L.T. and Wilbur, T.K. and Willoughby, W.R. and Wilson, M. and Wittsack, H-J. and Woods, A.J. and Wu, Y-C. and Xu, J. and Lopez, M.Y. and Yeung, D.K.W. and Zhao, Q. and Zhou, X. and Zupan, G. and Edden, R.A.E.} } @Article { ZeichhardtFDBHSHIVHVMCGSOEBHK2021, subid = {2777}, title = {The Dangers of Using Cq to Quantify Nucleic Acid in Biological Samples: A Lesson From COVID-19}, journal = {Clinical Chemistry}, year = {2021}, month = {10}, day = {22}, volume = {68}, number = {1}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {153-162}, keywords = {SARS-CoV-2, RT-qPC, EQA}, web_url = {https://academic.oup.com/clinchem/article/68/1/153/6385233\#325300656\&\#10;https://zenodo.org/record/6637873/files/18HLT03\%20Septimet\%20Supplementary\%20Funding\%20Acknowledgement\%20CLIN\%20CHEM.pdf?download=1}, misc2 = {EMPIR 2018: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0009-9147, 1530-8561}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6637873}, author = {Zeichhardt, H. and Foy, C.A. and D{\"u}hring, U. and Bae, Y-K. and Hingley-Wilson, S. and Storey, N. and Hong, K.H. and In, J. and Vandesompele, J. and Harris, K. and Verwilt, J. and Moran-Gilad, J. and Cowen, S. and Grunert, H-P. and Stewart, G. and O’Sullivan, D.M. and Evans, D. and Braybrook, J. and Huggett, Ji.F. and Kammel, M.} } @Article { RefinoYSNHSKIVSPW2021, subid = {2474}, title = {Versatilely tuned vertical silicon nanowire arrays by cryogenic reactive ion etching as a lithium-ion battery anode}, journal = {Scientific Reports}, year = {2021}, month = {10}, volume = {11}, number = {1}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, keywords = {high-aspect-ratio silicon (Si), nanowire array, lithium ion batteries, ICP-RIE}, web_url = {https://www.nature.com/articles/s41598-021-99173-4}, misc2 = {EMPIR 2019: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-99173-4}, stag_bib_extends_levelofaccess = {NA}, author = {Refino, A.D. and Yulianto, N. and Syamsu, I. and Nugroho, A.P. and Hawari, N.H. and Syring, A. and Kartini, E. and Iskandar, F. and Voss, T. and Sumboja, A. and Peiner, E. and Wasisto, H.S.} } @Article { CorderoVALPP2021, subid = {2259}, title = {Equivalence regimes for geometric quantum discord and local quantum uncertainty}, journal = {Phys. Rev. A}, year = {2021}, month = {10}, volume = {104}, number = {4}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {042401}, keywords = {Quantum Optics, non-classical correlations, quantum metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {2469-9934}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2107.14265}, author = {Cordero, O. and Villegas, A. and Alvarez, J.R. and Leon Montiel, R. de J. and Passos, M.H.M. and P. Torres, Juan} } @Article { VidakoviKochMiCKP2021, subid = {2305}, title = {Nonlinear frequency response analysis: a recent review and perspectives}, journal = {Current Opinion in Electrochemistry}, year = {2021}, month = {10}, number2 = {17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications}, pages = {100851}, keywords = {Harmonic analysis, Diagnosis, Kinetics, MModel discrimination, Battery}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {2451-9103}, DOI = {10.1016/j.coelec.2021.100851}, stag_bib_extends_levelofaccess = {NA}, author = {Vidaković-Koch, T. and Miličić, T. and Živković, L.A. and Chan, H.S. and Krewer, U. and Petkovska, M.} } @Proceedings { vandenBromMLLLCD2021, subid = {2565}, title = {Instrument Transformers for Power Quality Measurements: a Review of Literature and Standards}, journal = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2021}, month = {9}, day = {29}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, keywords = {Instrument Transformer, Power Quality, Power System Measurements, Calibration, Uncertainty, Standard}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Virtual Conference}, event_name = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {29-09-2021 to 01-10-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6093507}, author = {van den Brom, H. and Munoz, F. and Luiso, M. and Letizia, P.S. and Landi, C. and Crotti, G. and D'Avanzo, G.} } @Proceedings { ManzinVFV2021, subid = {2197}, title = {In silico experiments as a tool to reduce preclinical tests of magnetic hyperthermia}, journal = {Biomedical Science and Engineering}, year = {2021}, month = {9}, day = {29}, volume = {4}, number = {s1}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {117-118}, keywords = {magnetic hyperthermia, magnetic nanoparticles, computational animal models, bio-heat model}, web_url = {https://www.pagepress.org/technology/index.php/bse/article/view/199}, misc2 = {EMPIR 2018: Health}, publisher = {PAGEPress}, event_place = {virtual meeting}, event_name = {Third Centro 3R Annual Meeting}, event_date = {30-09-2021 to 01-10-2021}, language = {30}, ISSN = {eISSN 2531-9892}, DOI = {10.4081/bse.2021.199}, stag_bib_extends_levelofaccess = {NA}, author = {Manzin, A. and Vassallo, M. and Ferrero, R. and Vicentini, M.} } @Article { RottgerRGVCOHCCBIRKCAYFMM2021, subid = {2224}, title = {New metrology for radon at the environmental level}, journal = {Measurement Science and Technology}, year = {2021}, month = {9}, day = {23}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {radon, metrology, tracer, environmental measurements}, misc2 = {EMPIR 2019: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac298d}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and R{\"o}ttger, S. and Grossi, C. and Vargas, A. and Curcoll, R. and Ot{\'a}hal, P. and Hern{\'a}ndez-Ceballos, M.{\'A}. and Cinelli, G. and Chambers, S. and Barbosa, S.A. and Ioan, M-R. and Radulescu, I. and Kikaj, D. and Chung, E. and Arnold, T. and Yver Kwok, C. and Fuente, M. and Mertes, F. and Morosh, V.} } @Article { VasilatouWKHISSSWA2021, subid = {2082}, title = {Calibration of optical particle size spectrometers against a primary standard: Counting efficiency profile of the TSI Model 3330 OPS and Grimm 11-D monitor in the particle size range from 300 nm to 10 \(\mu\)m}, journal = {Journal of Aerosol Science}, year = {2021}, month = {9}, volume = {157}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {105818}, keywords = {calibration, aerosol spectrometers, PSL particles, primary standard, particle number concentration}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2021.105818}, stag_bib_extends_levelofaccess = {NA}, author = {Vasilatou, K. and W{\"a}lchli, C. and Koust, S. and Horender, S. and Iida, K. and Sakurai, H. and Schneider, F. and Spielvogel, J. and Wu, T.Y. and Auderset, K.} } @Article { EssBKGV2021, subid = {2081}, title = {Coated soot particles with tunable, well-controlled properties generated in the laboratory with a miniCAST BC and a micro smog chamber}, journal = {Journal of Aerosol Science}, year = {2021}, month = {9}, volume = {157}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, pages = {105820}, keywords = {soot, aerosol, secondary organic matter, calibration, black carbon, absorption photometers}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2021.105820}, stag_bib_extends_levelofaccess = {NA}, author = {Ess, M.N. and Bert{\`o}, M. and Keller, A. and Gysel-Beer, M. and Vasilatou, K.} } @Article { MierEscurraRV2021, subid = {2366}, title = {Design and Characterization of a Magnetic Loop Antenna for Partial Discharge Measurements in Gas Insulated Substations}, journal = {IEEE Sensors Journal}, year = {2021}, month = {9}, volume = {21}, number = {17}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {18618-18625}, keywords = {Magnetic loop antenna, partial discharges, transfer function, electric circuit, GIS, broadband antenna, VHF, high voltage}, tags = {SEG}, misc2 = {EMPIR 2019: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1530-437X, 1558-1748, 2379-915}, DOI = {10.1109/JSEN.2021.3089084}, stag_bib_extends_levelofaccess = {NA}, author = {Mier Escurra, C. and Rodrigo Mor, A. and Vaessen, P.} } @Article { DollemanCLvSS2021, subid = {2244}, title = {Squeeze-Film Effect on Atomically Thin Resonators in the High-Pressure Limit}, journal = {Nano Letters}, year = {2021}, month = {8}, day = {30}, volume = {21}, number = {18}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {7617-7624}, keywords = {graphene, nanoelectromechanical systems (NEMS), pressure sensor, gas damping}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1530-6984, 1530-6992}, DOI = {10.1021/acs.nanolett.1c02237}, stag_bib_extends_levelofaccess = {NA}, author = {Dolleman, R.J. and Chakraborty, D. and Ladiges, D.R. and van der Zant, H.S.J. and Sader, J.E. and Steeneken, P.G.} } @Article { FerreroBCVHYACMT2021, subid = {2146}, title = {Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes}, journal = {Nanomaterials}, year = {2021}, month = {8}, day = {25}, volume = {11}, number = {9}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {2179}, keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11092179}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Barrera, G. and Celegato, F. and Vicentini, M. and H{\"u}seyin, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.} } @Article { SteenekenDDAv2021, subid = {2239}, title = {Dynamics of 2D material membranes}, journal = {2D Materials}, year = {2021}, month = {8}, day = {12}, volume = {8}, number = {4}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {042001}, keywords = {2D material, dynamics, mechanics, graphene, NEMS}, web_url = {https://arxiv.org/ct?url=https\%3A\%2F\%2Fdx.doi.org\%2F10.1088\%2F2053-1583\%2Fac152c\&v=8246bcbf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/ac152c}, stag_bib_extends_levelofaccess = {NA}, author = {Steeneken, P.G. and Dolleman, R.J. and Davidovikj, D. and Alijani, F. and van der Zant, H.S.J.} } @Article { ViereckKNP2021, subid = {2418}, title = {MEMS-Based Cantilever Sensor for Simultaneous Measurement of Mass and Magnetic Moment of Magnetic Particles}, journal = {Chemosensors 2021}, year = {2021}, month = {8}, volume = {9}, number = {207}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {cantilever, resonant frequency, mass, magnetic moment, magnetic force gradient, magneticparticles}, web_url = {https://www.mdpi.com/2227-9040/9/8/207}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI}, language = {30}, DOI = {10.3390/chemosensors9080207}, stag_bib_extends_levelofaccess = {NA}, author = {Viereck, T. and Kahmann, T. and Nyang’au, W.O. and Peiner, E.} } @Article { RadtkeCKLSDAHNVRQLDBUL2021, subid = {2285}, title = {A unified pH scale for all solvents: part I – intention and reasoning (IUPAC Technical Report)}, journal = {Pure and Applied Chemistry}, year = {2021}, month = {7}, day = {30}, volume = {93}, number = {9}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1049-1060}, keywords = {Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {0033-4545, 1365-3075}, DOI = {10.1515/pac-2019-0504}, stag_bib_extends_levelofaccess = {NA}, author = {Radtke, V. and Cam{\~o}es, F. and Krossing, I. and Leito, I. and Stoica, D. and Deleebeeck, L. and Anes, B. and Heering, A. and N{\"a}ykki, T. and Veltz{\'e}, S. and Rozikov{\'a}, M. and Quendera, R. and Liv, L. and D{\'a}niel, N. and Bastkowski, F. and Uysal, E. and Lawrence, N.} } @Article { MilanoLLBRV2021, subid = {2236}, title = {Structure‐Dependent Influence of Moisture on Resistive Switching Behavior of ZnO Thin Films}, journal = {Advanced Materials Interfaces}, year = {2021}, month = {7}, day = {28}, volume = {8}, number = {16}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {2100915}, keywords = {effect of moisture on electroforming, electrical conductivity, memristors, nanostructures, resistive switching}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/admi.202100915}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2196-7350, 2196-7350}, DOI = {10.1002/admi.202100915}, stag_bib_extends_levelofaccess = {NA}, author = {Milano, G. and Luebben, M. and Laurenti, M. and Boarino, L. and Ricciardi, C. and Valov, I.} } @Article { TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021, subid = {2260}, title = {A multicentre and multi-national evaluation of the accuracy of quantitative Lu-177 SPECT/CT imaging performed within the MRTDosimetry project}, journal = {EJNMMI Physics}, year = {2021}, month = {7}, day = {23}, volume = {8}, number = {1}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, keywords = {Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2197-7364}, DOI = {10.1186/s40658-021-00397-0}, stag_bib_extends_levelofaccess = {NA}, author = {Tran-Gia, J. and Denis-Bacelar, A.M. and Ferreira, K.M. and Robinson, A.P. and Calvert, N. and Fenwick, A.J. and Finocchiaro, D. and Fioroni, F. and Grassi, E. and Heetun, W. and Jewitt, S.J. and Kotzassarlidou, M. and Ljungberg, M. and McGowan, D.R. and Scott, N. and Scuffham, J. and Gleisner, K.S. and Tipping, J. and Wevrett, J. and Bardi{\`e}s, M. and Berenato, S. and Bilas, I. and Bobin, C. and Capogni, M. and Chauvin, M. and COLLINS, S. and Cox, M. and Dabin, J. and D’Arienzo, M. and Gustafsson, J. and Hallam, A. and Kalathas, T. and Kayal, G. and Lorusso, G. and Maringer, F-J. and Morgan, D. and Smyth, V. and Solc, J. and Štemberkov{\'a}, L. and Struelens, L. and Vergara-Gil, A. and Wiedner, H. and Lassmann, M.} } @Article { VargasCMRPLNSL2021, subid = {2114}, title = {Comparison of airborne radiation detectors carried by rotary-wing unmanned aerial systems}, journal = {Radiation Measurements}, year = {2021}, month = {7}, volume = {145}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106595}, keywords = {Airborne radiological detectorUnmanned aerial systemEnvironmental radioactivity mappingSource localization}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106595}, stag_bib_extends_levelofaccess = {NA}, author = {Vargas, A. and Costa, D. and Macias, M. and Royo, P. and Pastor, E. and Luchkov, M. and Neumaier, S. and St{\"o}hlker, U. and Luff, R.} } @Article { DeleebeeckSNSRVHBLQCS2021, subid = {2183}, title = {Unified pH Measurements of Ethanol, Methanol, and Acetonitrile, and Their Mixtures with Water}, journal = {Sensors}, year = {2021}, month = {6}, volume = {21}, number = {11}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {3935}, keywords = {pHabs; ionic liquid salt bridge; commercial glass electrodes; water–alcohol mixture;non-aqueous pH}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21113935}, stag_bib_extends_levelofaccess = {NA}, author = {Deleebeeck, L. and Snedden, A. and Nagy, D. and Szil{\'a}gyi Nagyn{\'e}, Z. and Rozikov{\'a}, M. and Vičarov{\'a}, M. and Heering, A. and Bastkowski, F. and Leito, I. and Quendera, R. and Cabral, V. and Stoica, D.} } @Article { VeenC2021, subid = {2070}, title = {Getting started with uncertainty evaluation using the Monte Carlo method in R}, journal = {Accreditation and Quality Assurance}, year = {2021}, month = {6}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {measurement uncertainty, Monte Carlo method, GUM, propagation of distributions, law of propagation of uncertainty, sensitivity coefficient}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0949-1775, 1432-0517}, DOI = {10.1007/s00769-021-01469-5}, stag_bib_extends_levelofaccess = {NA}, author = {Veen, A.M.H. van der and Cox, M.G.} } @Article { RebufelloPASGDCVDG2021, subid = {2446}, title = {Anomalous weak values via a single photon detection}, journal = {Light: Science \& Applications}, year = {2021}, month = {5}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Quantum Measurement, Weak Values, Single Photons, Quantum Metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/s41377-021-00539-0}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and Avella, A. and Souza, M.A. de and Gramegna, M. and Dziewior, J. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { RebufelloPALVTGBCVDG2021, subid = {2447}, title = {Protective Measurement—A New Quantum Measurement Paradigm: Detailed Description of the First Realization}, journal = {Applied Sciences}, year = {2021}, month = {5}, volume = {11}, number = {9}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4260}, keywords = {Quantum Measurement, Weak Measurement, Quantum Metrology, Single Photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11094260}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and Avella, A. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { KlapetekGNVSN2021, subid = {2318}, title = {GSvit — An open source FDTD solver for realistic nanoscale optics simulations}, journal = {Computer Physics Communications}, year = {2021}, month = {5}, volume = {265}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {108025}, keywords = {FDTD, Plasmonics, Optics, Roughness}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0010-4655}, DOI = {10.1016/j.cpc.2021.108025}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P. and Grolich, P. and Nezval, D. and Valtr, M. and Šlesinger, R. and Nečas, D.} } @Article { ManzinFV2021, subid = {1996}, title = {From Micromagnetic to In Silico Modeling of Magnetic Nanodisks for Hyperthermia Applications}, journal = {Advanced Theory and Simulations}, year = {2021}, month = {3}, day = {26}, volume = {4}, number = {3}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {2100013}, keywords = {Magnetic hyperthermia, Magnetic nanoparticles, Micromagnetic modeling, In silico modeling, Bioheat transfer equation}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/adts.202100013}, misc2 = {EMPIR 2018: Health}, publisher = {Wiley-VCH}, language = {30}, DOI = {10.1002/adts.202100013}, stag_bib_extends_levelofaccess = {NA}, author = {Manzin, A. and Ferrero, R. and Vicentini, M.} } @Article { SchmidtGNBvZMBSHWR2021, subid = {2616}, title = {Bimodal behavior of microlasers investigated with a two-channel photon-number-resolving transition-edge sensor system}, journal = {Physical Review Research}, year = {2021}, month = {3}, day = {19}, volume = {3}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {013263}, keywords = {microlaser, transition-edge sensor, photon statistics, photon counting, nanophotonics}, web_url = {https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.3.013263}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.3.013263}, stag_bib_extends_levelofaccess = {NA}, author = {Schmidt, M. and Grothe, I.H. and Neumeier, S. and Bremer, L. and von Helversen, M. and Zent, W. and Melcher, B. and Beyer, J. and Schneider, C. and H{\"o}fling, S. and Wiersig, J. and Reitzenstein, S.} } @Article { EssBIMGV2021, subid = {2011}, title = {Optical and morphological properties of soot particles generated by the miniCAST 5201 BC generator}, journal = {Aerosol Science and Technology}, year = {2021}, month = {3}, day = {15}, number2 = {16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols}, pages = {1-25}, keywords = {soot, miniCAST, morphology, optical properties, calibration aerosol, combustion generator}, web_url = {https://www.tandfonline.com/doi/full/10.1080/02786826.2021.1901847}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, address = {London, United Kingdom}, language = {30}, ISSN = {0278-6826, 1521-7388}, DOI = {10.1080/02786826.2021.1901847}, stag_bib_extends_levelofaccess = {NA}, author = {Ess, M.N. and Bert{\`o}, M. and Irwin, M. and Modini, R.L. and Gysel-Beer, M. and Vasilatou, K.} } @Article { EichstadtGVSBK2021, subid = {2301}, title = {Toward Smart Traceability for Digital Sensors and the Industrial Internet of Things}, journal = {Sensors}, year = {2021}, month = {3}, day = {12}, volume = {21}, number = {6}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, pages = {2019}, keywords = {Internet of Things, calibration, measurement uncertainty, traceability, semantics, ontology, sensor network, digital sensors, redundancy}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21062019}, stag_bib_extends_levelofaccess = {NA}, author = {Eichst{\"a}dt, S. and Gruber, M. and Vedurmudi, A.P. and Seeger, B. and Bruns, T. and Kok, G.} } @Article { IurlaroBCBFKMMMNNSVWi2021, subid = {2018}, title = {Study on the uncertainty of passive area dosimetry systems for environmental radiation monitoring in the framework of the EMPIR “Preparedness” project}, journal = {Radiation Measurements}, year = {2021}, month = {3}, volume = {142}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106543}, keywords = {Passive dosimetry systems, Uncertainty budget, Decision threshold, Detection limitEnvironmental radiation monitoring, Emergency preparedness}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106543}, stag_bib_extends_levelofaccess = {NA}, author = {Iurlaro, G. and Baranowska, Z. and Campani, L. and Bjelac, O.C. and Ferrari, P. and Knežević, Ž. and Majer, M. and Mariotti, F. and Morelli, B. and Neumaier, S. and Nodilo, M. and Sperandio, L. and Vittoria, F.A. and Wołoszczuk, K. and Živanović, M.} } @Article { vandenBergDOPD2021, subid = {2217}, title = {Calibration of a CubeSat spectroradiometer with a narrow-band widely tunable radiance source}, journal = {Applied Optics}, year = {2021}, month = {2}, day = {26}, volume = {60}, number = {7}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {1995}, keywords = {CubeSat, Calibration, Spectroradiometer}, misc2 = {EMPIR 2016: Environment}, publisher = {The Optical Society}, language = {30}, ISSN = {1559-128X, 2155-3165}, DOI = {10.1364/AO.417467}, stag_bib_extends_levelofaccess = {NA}, author = {van den Berg, S. and Dekker, P. and Otter, G. and P{\'a}scoa, M.P. and Dijkhuizen, N.} } @Article { DiCapuaMSDVCFFV2021, subid = {1927}, title = {Analysis of Dynamic Wireless Power Transfer Systems Based on Behavioral Modeling of Mutual Inductance}, journal = {Sustainability}, year = {2021}, month = {2}, day = {26}, volume = {13}, number = {5}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {2556}, keywords = {behavioral modeling; inductive coupling; mutual inductance; wireless power transfer}, web_url = {https://www.mdpi.com/2071-1050/13/5/2556}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2071-1050}, DOI = {10.3390/su13052556}, stag_bib_extends_levelofaccess = {NA}, author = {Di Capua, G. and Maffucci, A. and Stoyka, K. and Di Mambro, G. and Ventre, S. and Cirimele, V. and Freschi, F. and Femia, N. and Villone, F.} } @Article { HorenderAQSNDSWAKGV2021, subid = {1901}, title = {Facility for production of ambient-like model aerosols (PALMA) in the laboratory: application in the intercomparison of automated PM monitors with the reference gravimetric method}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {2}, day = {16}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, keywords = {ambient-like aerosols, particulate matter, calibration , PM monitors}, web_url = {https://amt.copernicus.org/articles/14/1225/2021/amt-14-1225-2021.html}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.5194/amt-14-1225-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Horender, S. and Auderset, K. and Quincey, P. and Seeger, S. and Nielsen Skov, S. and Dirscherl, K. and Smith, T.O.M. and Williams, K. and Aegerter, C.C. and Kalbermatter, D.M. and Gaie-Levrel, F. and Vasilatou, K.} } @Article { LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021, subid = {2093}, title = {Roadmap on quantum nanotechnologies}, journal = {Nanotechnology}, year = {2021}, month = {2}, volume = {32}, number = {16}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {162003}, keywords = {Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/abb333}, stag_bib_extends_levelofaccess = {NA}, author = {Laucht, A. and Hohls, F. and Ubbelohde, N. and Fernando Gonzalez-Zalba, M. and Reilly, D.J. and Stobbe, S. and Schr{\"o}der, T. and Scarlino, P. and Koski, J.V. and Dzurak, A. and Yang, C-H. and Yoneda, J. and Kuemmeth, F. and Bluhm, H. and Pla, J. and Hill, C. and Salfi, J. and Oiwa, A. and Muhonen, J.T. and Verhagen, E. and LaHaye, M.D. and Kim, H.H. and Tsen, A.W. and Culcer, D. and Geresdi, A. and Mol, J.A. and Mohan, V. and Jain, P.K. and Baugh, J.} } @Article { PreetzmannEVLR2021, subid = {2667}, title = {Laboratory‐scale liquefiers for natural gas: A design and assessment study}, journal = {AIChE Journal}, year = {2021}, month = {1}, day = {11}, volume = {67}, number = {4}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {1-12}, keywords = {composition analysis, liquefaction, liquefied natural gas, optical spectroscopy, vapor–liquid-equilibrium}, web_url = {https://aiche.onlinelibrary.wiley.com/doi/epdf/10.1002/aic.17128}, misc2 = {EMPIR 2016: Energy}, publisher = {Wiley}, language = {30}, ISSN = {0001-1541, 1547-5905}, DOI = {10.1002/aic.17128}, stag_bib_extends_levelofaccess = {NA}, author = {Preetzmann, N. and Eckmann, P. and Veen, A.M.H. and Li, J. and Richter, M.} } @Inbook { BELLGAABSIDPSVRIWPNKSD2021, subid = {2552}, title = {A NEW EUROPEAN RADIATION PROTECTION NETWORK DEVELOPED BY THE SUPPORT BSS JOINT NETWORK PROJECT}, year = {2021}, month = {1}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {radiation protection, metrology, national regulation, European regulation, supportBSS, ENM for Radiation Protection}, web_url = {https://vinar.vin.bg.ac.rs/bitstream/handle/123456789/10125/309-314.pdf}, misc2 = {EMPIR 2019: Support for Networks}, booktitle = {RADIATION PROTECTION SOCIETY OF SERBIA AND MONTENEGRO, PROCEEDINGS, XXXI SYMPOSIUM RPSSM, 2021}, language = {30}, ISBN = {78-86-7306-161-0}, stag_bib_extends_levelofaccess = {NA}, author = {Bell, S. and Glavič-Cindro, D. and ALVES, J. and Adam-Guillermin, C. and Bernat, R. and Sabeta, A. and Ioan, M-R. and DERLACINSKI, M. and Pinto, M. and Sochor, V. and Veres, A. and R{\"O}TTGER, .A. and Živanović, M. and Wens, B. and Persson, L. and Nylund, R. and Kržanović, N. and STANKOVIĆ, S. and DIMOVIĆ, S.} } @Article { MinutoliCCDPV2021, subid = {2344}, title = {How to make FAIR a project: open access to research data and the RaCHy - Radiotherapy Coupled with Hyperthermia (in Italian)}, journal = {Notiziario dell'Istituto Superiore di Sanit{\`a}}, year = {2021}, month = {1}, volume = {34}, number = {1}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {13-16}, keywords = {biomedical research, open science, hyperthermia, radiotherapy, Zenodo}, web_url = {https://www.iss.it/documents/20126/0/Open+Science+Progetto+europeo+RaCHy.pdf/bebb34b6-0b8e-d0e0-c23b-5a3227bd9b7e?t=1613031471672}, misc2 = {EMPIR 2018: Health}, publisher = {Istituto Superiore di Sanit{\`a}}, language = {59}, ISSN = {1827-6296}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.5728941}, author = {Minutoli, D. and CACCIA, B. and Campa, A. and Durando, G. and Pozzi, S. and Valentini, S.} } @Proceedings { CrottiMVMCTL2021, subid = {2572}, title = {ASSESSMENT OF INSTRUMENT TRANSFORMER ACCURACY FOR POWER QUALITY MEASUREMENTS IN DISTRIBUTION GRIDS: RECENT ACTIVITIES AND FIRST RESULTS FROM 19NRM05 IT4PQ PROJECT}, journal = {CIRED 2021 - The 26th International Conference and Exhibition on Electricity Distribution}, year = {2021}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, keywords = {Instrument Transformers, Power Quality Measurements, Calibration, Measurement Technique, Measurement Uncertainty}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Institution of Engineering and Technology}, event_place = {Virtual Conference}, event_name = {CIRED 2021}, event_date = {20-09-2021 to 23-09-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6136940}, author = {Crotti, G. and Meyer, J. and van den Brom, H. and Mohns, E. and Chen, Y. and Tinarelli, R. and Luiso, M.} } @Article { VicarJJIBJBBST2021, subid = {2647}, title = {Electrons on a straight path: A novel ionisation vacuum gauge suitable as reference standard}, journal = {VACUUM}, year = {2021}, volume = {189}, number = {2021}, number2 = {20SIP01: ISO Gauge: Developing an ISO Technical Specification ''Characteristics for a stable ionisation vacuum gauge''}, pages = {110239}, keywords = {Ionisation vacuum gaugeHot cathodeSensitivitySecondary electronsIon induced secondary electron yield}, web_url = {https://arxiv.org/abs/2103.03566}, misc2 = {EMPIR 2020: Support for Impact}, publisher = {Elsevier Ltd}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2021.110239}, stag_bib_extends_levelofaccess = {NA}, author = {Vicar, M. and J{\"o}nnson, G. and Jenninger, B. and Illgen, C. and Bundaleski, N. and Jousten, K. and Boineau, F. and Bernien, M. and Šetina, J. and Teodoro, O.} } @Article { TiainenVHH2021, subid = {2075}, title = {Analysis of total rotor runout components with multi-probe roundness measurement method}, journal = {Measurement}, year = {2021}, volume = {179}, number = {109422}, number2 = {19ENG07: Met4Wind: Metrology for enhanced reliability and efficiency of wind energy systems}, pages = {109422}, keywords = {Relative shaft displacement,Runout, Roundness, Shaft geometry, Electrical runout,Mechanical runout, Multi-probe roundness}, web_url = {https://www.sciencedirect.com/science/article/pii/S0263224121004115}, misc2 = {EMPIR 2019: Energy}, publisher = {Elsevier}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2021.109422}, stag_bib_extends_levelofaccess = {NA}, author = {Tiainen, T. and Viitala, R. and Holopainen, T.P. and Hemming, B.} } @Article { VentonHSSA2021, subid = {2249}, title = {Robustness of convolutional neural networks to physiological electrocardiogram noise}, journal = {Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences}, year = {2021}, volume = {379}, number = {2212}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {-}, keywords = {electrocardiogram, physiological noise, robustness, deep learning, convolutional neural network, symmetric projection attractor reconstruction}, web_url = {https://royalsocietypublishing.org/doi/10.1098/rsta.2020.0262}, misc2 = {EMPIR 2018: Health}, publisher = {Royal Society Publishing}, language = {30}, ISSN = {-}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1098/rsta.2020.0262}, author = {Venton, J. and Harris, P.M. and Sundar, A. and Smith, N.A.S. and Aston, P.J. } } @Article { VisserRSDMW2020, subid = {2009}, title = {A single-beam photothermal interferometer for in situ measurements of aerosol light absorption}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {12}, day = {23}, volume = {13}, number = {12}, number2 = {16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols}, pages = {7097-7111}, keywords = {single-beam photothermal interferometer; measurement; aerosol light absorption; standard dual-beam photothermal interferometers; light-absorbing gases; NO2; black carbon; concentration; detection limits}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-13-7097-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Visser, B. and R{\"o}hrbein, J. and Steigmeier, P. and Drinovec, L. and Močnik, G. and Weingartner, E.} } @Article { DrAmatoVMBMBM2020, subid = {1874}, title = {Spectroscopic Techniques versus Pitot Tube for the Measurement of Flow Velocity in Narrow Ducts}, journal = {Sensors}, year = {2020}, month = {12}, day = {21}, volume = {20}, number = {24}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, pages = {7349}, keywords = {laser flow meter; Pitot tube; flow speed; time of flight; dilution method; flow simulation; flow turbulence; gas sensing applications}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20247349}, stag_bib_extends_levelofaccess = {NA}, author = {D’Amato, F. and Viciani, S. and Montori, A. and Barucci, M. and Morreale, C. and Bertagna, S. and Migliavacca , G.} } @Article { BowdenVHSH2020, subid = {2729}, title = {Improving the Q Factor of an Optical Atomic Clock Using Quantum Nondemolition Measurement}, journal = {Physical Review X}, year = {2020}, month = {12}, day = {15}, volume = {10}, number = {4}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Atomic and Molecular Physics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2160-3308}, DOI = {10.1103/PhysRevX.10.041052}, stag_bib_extends_levelofaccess = {NA}, author = {Bowden, W. and Vianello, A. and Hill, I.R. and Schioppo, M. and Hobson, R.} } @Article { GiordanoSGvS2020, subid = {1931}, title = {Methodology for the Accurate Measurement of the Power Dissipated by Braking Rheostats}, journal = {Sensors}, year = {2020}, month = {12}, volume = {20}, number = {23}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {6935}, keywords = {power measurement; braking rheostat; regenerative braking; current transducer; frequency characterization; chopped current; railway system; DC locomotive}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20236935}, stag_bib_extends_levelofaccess = {NA}, author = {Giordano, D. and Signorino, D. and Gallo, D. and van den Brom, H.E. and Š{\'i}ra, M.} } @Article { SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020, subid = {1841}, title = {The European Joint Research Project UHDpulse – Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, journal = {Physica Medica}, year = {2020}, month = {12}, volume = {80}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {134-150}, keywords = {Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2020.09.020}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}ller, A. and Heinrich, S. and Fouillade, C. and Subiel, A. and De Marzi, L. and Romano, F. and Peier, P. and Trachsel, M. and Fleta, C. and Kranzer, R. and Caresana, M. and Salvador, S. and Busold, S. and Sch{\"o}nfeld, A. and McEwen, M. and Gomez, F. and Solc, J. and Bailat, C. and Linhart, V. and Jakubek, J. and Pawelke, J. and Borghesi, M. and Kapsch, R-P. and Knyziak, A. and Boso, A. and Olsovcova, V. and Kottler, C. and Poppinga, D. and Ambrozova, I. and Schmitzer, C-S. and Rossomme, S. and Vozenin, M-C.} } @Proceedings { ElgGAMMHHLMPMSV2020, subid = {2062}, title = {Research Project EMPIR 19ENG02 Future Energy}, journal = {VDE High Voltage Technology 2020; ETG-Symposium}, year = {2020}, month = {12}, volume = {N/A}, number = {N/A}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {N/A}, keywords = {UHVDC, traceability, Lightning Impulse, linearity, voltage dependence, HVAC, DC partial discharge, GIS Partial discharge}, tags = {SEG}, web_url = {https://ieeexplore.ieee.org/servlet/opac?punumber=9275417}, misc2 = {EMPIR 2019: Energy}, publisher = {VDE}, event_place = {Berlin, Germany}, event_name = {VDE High Voltage Technology 2020; ETG-Symposium}, event_date = {09-11-2020 to 11-11-2020}, language = {30}, ISBN = {978-3-8007-5353-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4769653}, author = {Elg, A-P. and Garnacho, F. and Agazar, M. and Meisner, J. and Merev, A. and Houtzager, E. and H{\"a}llstr{\"o}m, J. and Lahti, K. and Mier Escurra, C. and Platinero, C. and Micand, T. and Steiner, T. and Voss, A.} } @Article { MaraisvKv2020, subid = {2080}, title = {Reduction of Static Electricity Meter Errors by Broadband Compensation of Voltage and Current Channel Differences}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2020}, month = {11}, day = {20}, volume = {70}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {1-11}, keywords = {Energy measurement; electromagnetic compatibility; electromagnetic interference; immunity testing; measurement errors; standards; watthour meters;}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2020.3039631}, stag_bib_extends_levelofaccess = {NA}, author = {Marais, Z. and van den Brom, H.E. and Kok, G. and van Veghel, M.G.A.} } @Article { SachsePVSRBBHKSKH2020, subid = {1704}, title = {Assessing Optical and Electrical Properties of Highly Active IrOx Catalysts for the Electrochemical Oxygen Evolution Reaction via Spectroscopic Ellipsometry}, journal = {ACS Catalysis}, year = {2020}, month = {11}, day = {20}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {14210-14223}, keywords = {spectroscopic ellipsometry, electrocatalysis, oxygen evolution reaction, mesoporous iridium oxidefilms, non-destructive ambient analysis, intrinsic OER activity, complementary methodology and metrology}, misc2 = {EMPIR 2016: Energy}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2155-5435, 2155-5435}, DOI = {10.1021/acscatal.0c03800}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Pfl{\"u}ger, M. and Velasco-V{\'e}lez, J-J. and Sahre, M. and Radnik, J. and Bernicke, M. and Bernsmeier, D. and Hodoroaba, V-D. and Krumrey, M. and Strasser, P. and Kraehnert, R. and Hertwig, A.} } @Article { FerreroBCPPPSSVM2020, subid = {1740}, title = {An insight into the present capabilities of national metrology institutes for measuring sparkle}, journal = {Metrologia}, year = {2020}, month = {11}, day = {11}, volume = {57}, number = {6}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {065029}, keywords = {sparkle, texture, reflectance, contrast threshold, gonio-spectrophotometry}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abb0a3}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Basic, N. and Campos, J. and Pastuschek, M. and Perales, E. and Porrovecchio, G. and Smid, M. and Schirmacher, A. and Vel{\'a}zquez, J.L. and Mart{\'i}nez-Verd{\'u}, F.} } @Article { HuggettBBGHKKMMNPSSVVWZ2020, subid = {1862}, title = {Cautionary Note on Contamination of Reagents Used for Molecular Detection of SARS-CoV-2}, journal = {Clinical Chemistry}, year = {2020}, month = {10}, day = {30}, volume = {66}, number = {11}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {1369-1372}, keywords = {SARS-CoV-2, RT-qPCR, contamination, false positive, molecular diagnosis}, web_url = {https://academic.oup.com/clinchem/article/66/11/1369/5902447}, misc2 = {EMPIR 2018: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0009-9147, 1530-8561}, DOI = {10.1093/clinchem/hvaa214}, stag_bib_extends_levelofaccess = {NA}, author = {Huggett, J.F. and Benes, V. and Bustin, S.A. and Garson, J.A. and Harris, K. and Kammel, M. and Kubista, M. and McHugh, T.D. and Moran-Gilad, J. and Nolan, T. and Pfaffl, M.W. and Salit, M. and Shipley, G. and Vallone, P.M. and Vandesompele, J. and Wittwer, C. and Zeichhardt, H.} } @Miscellaneous { auseviCv, subid = {1645}, title = {EMUE-RMG-1-Gas Flow Calibration}, year = {2020}, month = {10}, day = {21}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {gas flow measurement, measurement uncertainty, master meter, meter under test, calibration}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.4114438}, stag_bib_extends_levelofaccess = {NA}, author = {Čaušević, M. and Cox, M.G. and van der Veen, A.M.H.} } @Miscellaneous { auseviMvC, subid = {1638}, title = {EMUE-RMG-3-Calibration Gas Mixtures}, year = {2020}, month = {10}, day = {13}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {permeation, calibration gas mixtures, uncertainty evaluation}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.4084956}, stag_bib_extends_levelofaccess = {NA}, author = {Čaušević, M. and Meuzelaar, H. and van der Veen, A.M.H. and Cox, M.G.} } @Article { MeuzelaarLPvv2020, subid = {2156}, title = {Trace level analysis of reactive ISO 14687 impurities in hydrogen fuel using laser-based spectroscopic detection methods}, journal = {International Journal of Hydrogen Energy}, year = {2020}, month = {10}, volume = {45}, number = {58}, number2 = {17IND09: MetAMCII: Metrology for Airborne Molecular Contaminants II}, pages = {34024-34036}, keywords = {Hydrogen, fuel cell vehicles, Hydrogen purity, ISO 14687, ISO 21087, Permeation, Spectroscopy}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.ijhydene.2020.09.046}, stag_bib_extends_levelofaccess = {NA}, author = {Meuzelaar, H. and Liu, J. and Persijn, S. and van Wijk, J. and van der Veen, A.} } @Article { WelshvBCHLLLvNTWWJ2020, subid = {1707}, title = {Towards defining reference materials for measuring extracellular vesicle refractive index, epitope abundance, size and concentration}, journal = {Journal of Extracellular Vesicles}, year = {2020}, month = {9}, day = {24}, volume = {9}, number = {1}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {1816641}, keywords = {Calibration; exosomes; extracellular vesicles; microvesicles; optical analysis; reference materials; standardization; quality control; validation}, misc2 = {EMPIR 2018: Health}, language = {30}, ISSN = {2001-3078}, DOI = {10.1080/20013078.2020.1816641}, stag_bib_extends_levelofaccess = {NA}, author = {Welsh, J.A. and van der Pol, E. and Bettin, B.A. and Carter, D.R.F. and Hendrix, A. and Lenassi, M. and Langlois, M-A. and Llorente, A. and van de Nes, A.S. and Nieuwland, R. and Tang, V. and Wang, L. and Witwer, K.W. and Jones, J.C. } } @Article { EckmannvCLvKR2020, subid = {1605}, title = {Density Measurements of (0.99 Methane + 0.01 Butane) and (0.98 Methane + 0.02 Isopentane) over the Temperature Range from (100 to 160) K at Pressures up to 10.8 MPa}, journal = {International Journal of Thermophysics}, year = {2020}, month = {9}, day = {23}, volume = {41}, number = {11}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {1-19/156}, keywords = {Cryogenic state · Density measurement · Liquefied binary mixtures ·Magnetic-suspension coupling · Single-sinker densimeter}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-020-02728-2}, stag_bib_extends_levelofaccess = {NA}, author = {Eckmann, P. and von Preetzmann, N. and Cavuoto, G. and Li, J. and van der Veen, A. and Kleinrahm, R. and Richter, M.} } @Article { KuipervNVv2020, subid = {1706}, title = {Reliable measurements of extracellular vesicles by clinical flow cytometry}, journal = {American Journal of Reproductive Immunology}, year = {2020}, month = {9}, day = {23}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, keywords = {calibration,data interpretation,extracellular vesicles,flow cytometry,standardization}, misc2 = {EMPIR 2018: Health}, publisher = {John Wiley \& Sons Ltd}, language = {30}, ISSN = {1046-7408}, DOI = {10.1111/aji.13350}, stag_bib_extends_levelofaccess = {NA}, author = {Kuiper, M. and van de Nes, A. and Nieuwland, R. and Varga, Z. and van de Pol, E.} } @Miscellaneous { CarulloCV, subid = {1597}, title = {EMUE-D6-6-DAQ Board Electrical Quantities}, year = {2020}, month = {9}, day = {14}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Data acquisition systems; Electrical quantities: Measurement uncertainty; Cross Talk}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4028283}, author = {Carullo, A and Corbellini, S. and Vallan, A.} } @Article { WinterSVMRPKHLHDBBBBBBKSR2020, subid = {1950}, title = {Results of the Bifacial PV Cells and PV Modules Power Measurement Round Robin Activity of the PV-Enerate Project}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {9}, day = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {877 - 882}, keywords = {Testing, PV Module, Bifacial PV}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4055707}, author = {Winter, S. and Str{\"a}ter, H. and Vegas, A. and Molinero, R.R. and Riechelmann, S. and Pavanello, D. and Kenny, R. and Herrmann, W. and Lopez-Garcia, J. and Hinken, D. and Dittmann, S. and Bonilla, J. and Bliss, M. and Bothe, K. and Blakesley, J.C. and Betts, T.R. and Bellenda, G. and Koutsourakis, G. and Schmid, A. and Rauer, M.} } @Article { CrottivMTLSACMMA2020, subid = {2130}, title = {Measurement Methods and Procedures for Assessing Accuracy of Instrument Transformers for Power Quality Measurements}, journal = {Conference on Precision Electromagnetic Measurements CPEM 2020 Proceedings}, year = {2020}, month = {8}, day = {24}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, keywords = {Instrument transformers, calibration, measurement standards, measurement techniques, measurementuncertainty, precision measurements}, tags = {SEG}, misc2 = {EMPIR 2019: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.5136547}, stag_bib_extends_levelofaccess = {NA}, author = {Crotti, G. and van den Brom, H.E. and Mohns, E. and Tinarelli, R. and Luiso, M. and Styblikova, R. and Agazar, M. and \c{C}aycı, H. and Mazza, P. and Meyer, J. and Almutairi, M. } } @Article { MustapaaNHV2020, subid = {1670}, title = {Metrological Challenges in Collaborative Sensing: Applicability of Digital Calibration Certificates}, journal = {Sensors}, year = {2020}, month = {8}, day = {21}, volume = {20}, number = {17}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, pages = {4730}, keywords = {IoT-communication, sensor networks, smart agents, metrology, digital calibration certificate, traceability}, web_url = {https://www.mdpi.com/1424-8220/20/17/4730}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, address = {Basel CH-4005 Switzerland}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20174730}, stag_bib_extends_levelofaccess = {NA}, author = {Mustap{\"a}{\"a}, T. and Nikander, P. and Hutzschenreuter, D. and Viitala, R.} } @Article { deKromBZEvvvvHvDCE2020, subid = {1994}, title = {Primary mercury gas standard for the calibration of mercury measurements}, journal = {Measurement}, year = {2020}, month = {8}, day = {16}, volume = {169}, number = {2021}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {108351}, keywords = {Mercury, Metrology, Primary gas standard, Calibration, SI-traceability, Environmental}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2020.108351}, stag_bib_extends_levelofaccess = {NA}, author = {de Krom, I. and Bavius, W. and Ziel, R. and Efremov, E. and van Meer, D. and van Otterloo, P. and van Andel, I. and van Osselen, D. and Heemskerk, M. and van der Veen, A.M.H. and Dexter, M.A. and Corns, W.T. and Ent, H.} } @Proceedings { vandenBromv2020, subid = {1942}, title = {Calibrating Sensors to Measure Braking Chopper Currents in DC Traction Units}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Current measurement, measurement standards, measurement techniques, precision measurements, transducers}, web_url = {https://www.techrxiv.org/articles/preprint/Calibrating_Sensors_to_Measure_Braking_Chopper_Currents_in_DC_Traction_Units/13469679}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Denver, CO, USA}, event_name = {Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5898-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM49742.2020.9191822}, stag_bib_extends_levelofaccess = {NA}, author = {van den Brom, H. and van Leeuwen, R.} } @Proceedings { vanLeeuwenvRHH2020, subid = {1943}, title = {Measuring the Voltage Dependence of Current Transformers}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Current measurement, current transformers, measurement standards, precision measurements}, tags = {SEG}, web_url = {https://www.techrxiv.org/articles/preprint/Measuring_the_Voltage_Dependence_of_Current_Transformers/13469673/1}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Denver, CO, USA}, event_name = {Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5898-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM49742.2020.9191845}, stag_bib_extends_levelofaccess = {NA}, author = {van Leeuwen, R. and van den Brom, H. and Rietveld, G. and Houtzager, E. and Hoogenboom, D.} } @Proceedings { vanVeghelSvHRvMK2020, subid = {2103}, title = {Towards improved standardization of electricity meter testing}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Energy measurement,electromagnetic compatibility,measurement errors,electricity meters}, tags = {SEG}, web_url = {https://www.techrxiv.org/articles/preprint/Towards_improved_standardization_of_electricity_meter_testing/13469622/1}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Bolder}, event_name = {Conference of Precession Electromagnetic MeasurementsPEM}, event_date = {01-08-2020 to 07-08-2020}, language = {30}, DOI = {10.1109/CPEM49742.2020.9191719}, stag_bib_extends_levelofaccess = {NA}, author = {van Veghel, M.G.A. and Sharma, S. and van den Brom, H.E. and Hoogenboom, D. and Rietveld, G. and van Leeuwen, R. and Marais, Z. and Kok, G.J.P.} } @Proceedings { vandenBromGGWG2020, subid = {1941}, title = {Accurate Measurement of Energy Dissipated in Braking Rheostats in DC Railway Systems}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Current measurement, energy measurement, rail transportation, transducers, measurement uncertainty}, web_url = {https://www.techrxiv.org/articles/preprint/Accurate_Measurement_of_Energy_Dissipated_in_Braking_Rheostats_in_DC_Railway_Systems/13469739/1}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Denver, CO, USA}, event_name = {Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5899-0}, ISSN = {2160-0171}, DOI = {10.1109/CPEM49742.2020.9191917}, stag_bib_extends_levelofaccess = {NA}, author = {van den Brom, Helko and Giordano, Domenico and Gallo, Danielle and Wank, Andreas and Giordano, Domenico} } @Miscellaneous { PennecchiRSEv, subid = {1553}, title = {EMUE-D3-2-Low Mass BaP Evaluation}, year = {2020}, month = {7}, day = {31}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Uncertainty evaluation; Monte Carlo method; GUM uncertainty framework;Benzo[a]pyrene; Polycyclic Aromatic Hydrocarbons}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3968940}, stag_bib_extends_levelofaccess = {NA}, author = {Pennecchi, F. and Rolle, F. and Sega, M. and Ellison, S.L.R. and van der Veen, A.M.H.} } @Article { ShuVZAF2020, subid = {1544}, title = {Experimental and Modeling Studies on the Correlation Between Auto-Ignition Delays and the Methane Number of Liquefied Natural Gas (LNG) and Liquefied Biogas (LBG)}, journal = {Frontiers in Mechanical Engineering}, year = {2020}, month = {7}, day = {24}, volume = {6}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, keywords = {liquefied natural gas, liquefied biogas, rapid compression machine, auto-ignition delays, chemical kinetics, modeling, shock tube}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2297-3079}, DOI = {10.3389/fmech.2020.00047}, stag_bib_extends_levelofaccess = {NA}, author = {Shu, B. and Vallabhuni, S.K. and Zheng, J. and Agarwal, S. and Fernandes, R.X.} } @Thesis { Vadlejch2020, subid = {1720}, title = {Characterization of micro-motion and its influence on systematic frequency shifts of quadrupole transition of Calcium ion trapped in Paul trap}, year = {2020}, month = {7}, day = {14}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {motional systematic frequency shifts, quadrupole transition of calcium ion, micromotion, minimization of micromotion, detection of micromotion, photon-correlation method, linear Paul ion trap}, web_url = {https://dspace.vutbr.cz/xmlui/handle/11012/192380}, misc2 = {EMPIR 2017: Fundamental}, school = {Brno University of Technology}, language = {27}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/11012/192380}, author = {Vadlejch, D.} } @Article { AlKhafajiGWBV2020, subid = {1714}, title = {Particle Size Distribution of Bimodal Silica Nanoparticles: A Comparison of Different Measurement Techniques}, journal = {Materials}, year = {2020}, month = {7}, day = {11}, volume = {13}, number = {14}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {3101}, keywords = {silica nanoparticle; size distribution; light scattering; small-angle X-ray scattering; microfluidic resistive pulse sensing}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {1996-1944}, DOI = {10.3390/ma13143101}, stag_bib_extends_levelofaccess = {NA}, author = {Al-Khafaji, M.A. and Ga{\'a}l, A. and Wacha, A. and B{\'o}ta, A. and Varga, Z.} } @Article { HeeringSCANNQRBBNSLLURVSDRKL2020, subid = {1554}, title = {Symmetric Potentiometric Cells for the Measurement of Unified pH Values}, journal = {Symmetry}, year = {2020}, month = {7}, volume = {12}, number = {7}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1150}, keywords = {unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-8994}, DOI = {10.3390/sym12071150}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, Agnes and Stoica, Daniela and Cam{\~o}es, Filomena and Anes, B{\'a}rbara and Nagy, D{\'a}niel and Nagyn{\'e} Szil{\'a}gyi, Zs{\'o}fia and Quendera, Raquel and Ribeiro, Luis and Bastkowski, Frank and Born, Rasmus and Nerut, Jaak and Saame, Jaan and Lainela, Silvie and Liv, Lokman and Uysal, Emrah and Rozikov{\'a}, Matilda and Vičarov{\'a}, Martina and Snedden, Alan and Deleebeeck, Lisa and Radtke, Valentin and Krossing, Ingo and Leito, Ivo} } @Article { DrAmatoVMLFP2020, subid = {2116}, title = {Optical detection of ammonia inside a stack: Comparison of different techniques}, journal = {Measurement}, year = {2020}, month = {7}, volume = {159}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, pages = {107746}, keywords = {Ammonia was measured as a target gas in an artificial stack; Optical detection techniques exhibit different resilience to absorption lineshapes; Target gas absorption widths are sensitive to the concentrations of water and CO2; Direct absorption and derivative detection were compared with respect to calibration; An optical multipass cell was used, completely inside an artificial stack at 140 \(^{\circ}\)C.}, web_url = {https://www.sciencedirect.com/science/article/pii/S0263224120302840?via\%3Dihub}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2020.107746}, stag_bib_extends_levelofaccess = {NA}, author = {D’Amato, F. and Viciani, S. and Montori, A. and Lapini, A. and Fraboulet, I. and Poulleau, J.} } @Article { SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020, subid = {1522}, title = {Determination of consensus kQ values for megavoltage photon beams for the update of IAEA TRS-398}, journal = {Physics in Medicine and Biology}, year = {2020}, month = {6}, day = {22}, volume = {65}, number = {9}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {095011}, keywords = {TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Institute of Physics}, address = {London}, language = {30}, DOI = {10.5281/zenodo.3903294}, stag_bib_extends_levelofaccess = {NA}, author = {Seuntjens, J. and de Prez, L.A. and Pinto, M. and Pimpinella, M. and Oliver, C.P. and Ojala, J. and Muir, B. and Mirzakhanian, L. and Hanlon, M.D. and Francescon, P. and Delaunay, F. and Borbinha, J. and Ballester, F. and Andersen, C.E. and Vatnitsky, S. and McEwen, M. and Kapsch, R.P. and Burns, D.T. and Andreo, P. and Sommier, L. and Teles, P. and Tikkanen, J. and Vijande, J. and Zink, K.} } @Article { dePooterBdDKKvW2020, subid = {1629}, title = {Reference dosimetry in MRI-linacs: evaluation of available protocols and data to establish a code of practice}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {6}, day = {22}, volume = {1}, number = {1}, number2 = {19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy}, pages = {1}, keywords = {Reference dosimetry, MRI linac, Monte Carlo simulation, MR guided radiotherapy}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ab9efe}, stag_bib_extends_levelofaccess = {NA}, author = {de Pooter, J.A. and Billas, I. and de Prez, L.A. and Duane, S. and Kapsch, R-P. and Karger, C.P. and van Asselen, B. and Wolthaus, J.W.H.} } @Article { SetinaTIBBJVW2020, subid = {1519}, title = {A review on hot cathode ionisation gauges with focus on a suitable design for measurement accuracy and stability}, journal = {Vacuum}, year = {2020}, month = {6}, day = {10}, volume = {179}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, keywords = {Ionisation gauge, Hot cathode, Sensitivity, Secondary electrons, Electron stimulated desorption}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier}, address = {Munich}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109545}, stag_bib_extends_levelofaccess = {NA}, author = {Jousten, K. and Boineau, F. and Bundaleski, N. and Illgen, C. and Šetina, J. and Teodoro, O.M.N.D. and Vicar, M. and W{\"u}est, M.} } @Miscellaneous { SegaRPSdv, subid = {1509}, title = {EMUE-D3-3-Calibration Gas Mixtures}, year = {2020}, month = {6}, day = {3}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Gas mixtures; Nitrogen oxides; Dynamic dilution; Mass flow controllers; Chemiluminescence analyser; Calibration; Uncertainty and covariance evaluation; Weighted Total Least-Squares}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3875469}, stag_bib_extends_levelofaccess = {NA}, author = {Sega, M. and Rolle, F. and Pennecchi, F. and Spazzini, P. and de Krom, I. and van der Veen, A.M.H.} } @Proceedings { LuchkovNV2020, subid = {2020}, title = {Unmanned Aircraft Based Gamma Spectrometry System for Radiological Surveillance}, journal = {SMSI 2020 Conference Proceedings - Sensor and Measurement Science International}, year = {2020}, month = {6}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, keywords = {Radiation monitoring, spectro-dosemeter, cerium bromide, UAV, ''Preparedness''}, web_url = {https://www.ama-science.org/proceedings/details/3775}, misc2 = {EMPIR 2016: Environment}, event_place = {Nuremberg}, event_name = {Sensor and Measurement Science International}, event_date = {22-06-2020 to 25-06-2020}, language = {30}, ISBN = {978-3-9819376-2-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {978-3-9819376-2-6}, author = {Luchkov, M. and Neumaier, S. and Vargas, A.} } @Miscellaneous { vanderVeen, subid = {1499}, title = {Bayesian evaluation of the mass calibration example from EA 4/02}, year = {2020}, month = {5}, day = {20}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Mass, calibration}, web_url = {https://zenodo.org/record/3836190\#.XsZdEmhKg2w}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3836190}, stag_bib_extends_levelofaccess = {NA}, author = {van der Veen, A.} } @Article { BilousBBSvTPLP2020, subid = {1541}, title = {Electronic Bridge Excitation in Highly Charged Th229 Ions}, journal = {Physical Review Letters}, year = {2020}, month = {5}, day = {12}, volume = {124}, number = {19}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {highly charged Ionshigh-intensity optical laserHighly Charged 229Th Ions}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.124.192502}, stag_bib_extends_levelofaccess = {NA}, author = {Bilous, P.V. and Bekker, H. and Berengut, J.C. and Seiferle, B. and von der Wense, L. and Thirolf, P.G. and Pfeifer, T. and L{\'o}pez-Urrutia, J.R.C. and P{\'a}lffy, A.} } @Article { MartinezABNVJHKVKL2020, subid = {1488}, title = {Step height standards based on self-assembly for 3D metrology of biological samples}, journal = {Measurement Science and Technology}, year = {2020}, month = {4}, day = {23}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {nanometrology, transfer standard, calibration, CSI, SWLI, AFM, traceability}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab8c6a}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, V. and Kassamakov, I. and Viitala, T. and J{\"a}rvinen, M. and Vainikka, T. and Nolvi, A. and Bermudez, C. and Artigas, R. and Martinez, P. and Korpelainen, V. and Lassila, A.} } @Article { YacootKHDDRVN2020, subid = {1489}, title = {Multiple fibre interferometry setup for probe sample interaction measurements in atomic force microscopy}, journal = {Measurement Science and Technology}, year = {2020}, month = {4}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {atomic force microscopy, Fibre interferometry, probe sample interaction, nanometrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab85d8}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P. and Yacoot, A. and Hortv{\'i}k, V. and Duchoň, V. and Dongmo, H. and Rerucha, S. and Valtr, M. and Nečas, D.} } @Miscellaneous { SousaPvCFDBKE, subid = {1467}, title = {EMUE-D1-2-Bayesian Mass Calibration}, year = {2020}, month = {3}, day = {25}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Bayesian statistics, measurement uncertainty, prior knowledge, calibration}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3726908}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Pellegrino, O. and van der Veen, A.M.H. and Cox, M.G. and Fischer, N. and Demeyer, S. and Bošnjakovic, A. and Karahodžić, V. and Elster, C.} } @Miscellaneous { vanderVeenHCPE, subid = {1459}, title = {EMUE-D2-1-Muticomponent Materials}, year = {2020}, month = {3}, day = {22}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Conformity assessment; Multicomponent material; Measurement uncertainty; Risk of false decision; Correlated test results}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3723507}, stag_bib_extends_levelofaccess = {NA}, author = {van der Veen, A.M.H and Harris, P and Cox, M.G and Pennecchi, F and Ellison, S.L.R} } @Article { KueraKPBV2020, subid = {1607}, title = {Characterization of a precision modular sinewave generator}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, day = {17}, volume = {31}, number = {6}, number2 = {17RPT04: VersICaL: A versatile electrical impedance calibration laboratory based on digital impedance bridges}, pages = {064002}, keywords = {signal generator, synthesizer, voltage, calibration, metrology, impedance,AC Josephson effect}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab6f2e}, stag_bib_extends_levelofaccess = {NA}, author = {Kucera, J. and Kov{\'a}č, J. and Palafox, L. and Behr, R. and Voj{\'a}čkov{\'a}, L.} } @Article { FialovaOVM2020, subid = {2042}, title = {Equipment for Testing Measuring Devices at a Low-Level Radon Activity Concentration}, journal = {International Journal of Environmental Research and Public Health}, year = {2020}, month = {3}, day = {15}, volume = {17}, number = {6}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {1904}, keywords = {radon; radon chamber; radon source; low-level radon activity concentration}, web_url = {https://www.mdpi.com/1660-4601/17/6/1904}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1660-4601}, DOI = {10.3390/ijerph17061904}, stag_bib_extends_levelofaccess = {NA}, author = {Fialova, E. and Otahal, P.P.S. and Vosahlik, J. and Mazanova, E.} } @Article { ElGawharyvU2020, subid = {1450}, title = {Electromagnetic scattering beyond the weak regime: Solving the problem of divergent Born perturbation series by Pad{\'e} approximants}, journal = {Physical Review Research}, year = {2020}, month = {3}, day = {13}, volume = {2}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {013308}, keywords = {Strong scattering, Born series, perturbation methods, inverse problems, optical metrology, Pad{\'e} approximants}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.2.013308}, stag_bib_extends_levelofaccess = {NA}, author = {van der Sijs, T. A. and El Gawhary, O. and Urbach, H. P.} } @Article { SalmiCVWVYKHS2020, subid = {1354}, title = {AlOx surface passivation of black silicon by spatial ALD: Stability under light soaking and damp heat exposure}, journal = {Journal of Vacuum Science \& Technology A}, year = {2020}, month = {3}, volume = {38}, number = {2}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {022401}, keywords = {Spatial Atomic Layer Deposition, aluminum oxide, surface passivation, light soaking, damp heat}, misc2 = {EMPIR 2016: Energy}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5133896}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, I.T.S. and Koutsourakis, G. and Virtanen, S. and Yli-Koski, M. and Wood, S. and V{\"a}h{\"a}nissi, V. and Salmi, E. and Castro, F.A. and Savin, H.} } @Article { LanevskiMVHKMAKI2020, subid = {1876}, title = {Determining the shape of reflectance reference samples for curved surface reflectors}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, volume = {31}, number = {5}, number2 = {16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials}, pages = {054010}, keywords = {reflectance, Monte-Carlo, reflective insulators, foil, curved surface, reference sample,additive manufacturing}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab68bf}, stag_bib_extends_levelofaccess = {NA}, author = {Lanevski, D. and Manoocheri, F. and Vaskuri, A. and Hameury, J. and Kersting, R. and Monte, C. and Adibekyan, A. and Kononogova, E. and Ikonen, E.} } @Article { TangSLKNBMSCKMKBNMKKSSDPvM2020, subid = {1473}, title = {Clinical quantitative cardiac imaging for the assessment of myocardial ischaemia}, journal = {Nature Reviews Cardiology}, year = {2020}, month = {2}, day = {24}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, keywords = {cardiac imaging, myocardial ischaemia}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1759-5002, 1759-5010}, DOI = {10.1038/s41569-020-0341-8}, stag_bib_extends_levelofaccess = {NA}, author = {Dewey, M. and Siebes, M. and Kachelrie{\ss}, M. and Kofoed, K.F. and Maurovich-Horvat, P. and Nikolaou, K. and Bai, W. and Kofler, A. and Manka, R. and Kozerke, S. and Chiribiri, A. and Schaeffter, T. and Michallek, F. and Bengel, F. and Nekolla, S. and Knaapen, P. and Lubberink, M. and Senior, R. and Tang, M-X. and Piek, J.J. and van de Hoef, T. and Martens, J. and Schreiber, L.} } @Article { PeralesMHV2020, subid = {1725}, title = {Evaluating the Graininess Attribute by Visual Scaling for Coatings with Special-Effect Pigments}, journal = {Coatings}, year = {2020}, month = {2}, day = {20}, volume = {10}, number = {316}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {1-10}, keywords = {special-effect pigments, graininess, psychophysical experiment, visual perception}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {MDPI}, address = {Basel (Switzerland)}, language = {30}, ISSN = {2079-6412}, DOI = {10.3390/coatings10040316}, stag_bib_extends_levelofaccess = {NA}, author = {Perales, E. and Mic{\'o}-Vicent, B. and Huraibat, K. and Viqueira, V.} } @Article { BiaekVGAGFU2020, subid = {1904}, title = {Monte Carlo–Based Quantification of Uncertainties in Determining Ocean Remote Sensing Reflectance from Underwater Fixed-Depth Radiometry Measurements}, journal = {Journal of Atmospheric and Oceanic Technology}, year = {2020}, month = {2}, volume = {37}, number = {2}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {177-196}, keywords = {Monte Carlo, Ocean colour, Uncertainty evaluation, Radiometry}, misc2 = {EMPIR 2016: Environment}, publisher = {American Meteorological Society}, language = {30}, ISSN = {0739-0572, 1520-0426}, DOI = {10.1175/JTECH-D-19-0049.1}, stag_bib_extends_levelofaccess = {NA}, author = {Białek, A. and Vellucci, V. and Gentil, B. and Antoine, D. and Gorro{\~n}o, J. and Fox, N. and Underwood, C.} } @Article { BurnellLRvHBNSRMHBFZM2020, subid = {1425}, title = {Diameter-independent skyrmion Hall angle observed in chiral magnetic multilayers}, journal = {Nature Communications}, year = {2020}, month = {1}, day = {22}, volume = {11}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {skyrmion motion, spin-orbit torque}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-14232-9}, stag_bib_extends_levelofaccess = {NA}, author = {Zeissler, K. and Finizio, S. and Barton, C. and Huxtable, A.J. and Massey, J. and Raabe, J. and Sadovnikov, A.V. and Nikitov, S.A. and Brearton, R. and Hesjedal, T. and van der Laan, G. and Rosamond, M.C. and Linfield, E.H. and Burnell, G. and Marrows, C.H.} } @Article { KendigVUMZ2020, subid = {1438}, title = {Dynamic Temperature Measurements of a GaN DC/DC Boost Converter at MHz Frequencies}, journal = {IEEE Transactions on Power Electronics}, year = {2020}, volume = {Not yet pr}, number = {Not yet pr}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {1-1}, keywords = {Thermoreflectance measurement , boost converter , gallium nitride, power transistor}, web_url = {http://epubs.surrey.ac.uk/853825/}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-8993, 1941-0107}, DOI = {10.1109/TPEL.2020.2964996}, stag_bib_extends_levelofaccess = {NA}, author = {Matei, C. and Urbonas, J. and Votsi, H. and Kendig, D. and Aaen, P.H.} } @Article { TummonLKCCCAZSV2020, subid = {1472}, title = {Real-time pollen monitoring using digital holography}, journal = {Atmospheric Measurement Techniques}, year = {2020}, volume = {13}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {1539–1550}, keywords = {pollen monitoring, digital holography,}, web_url = {https://www.atmos-meas-tech.net/13/1539/2020/}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus Publications}, language = {30}, DOI = {10.5194/amt-13-1539-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Sauvageat , E. and Zeder, Y. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Konzelmann, T. and Lieberherr, G. and Tummon, F. and Vasilatou, K.} } @Article { VilloneVMDSFD2020, subid = {1418}, title = {Mutual Inductance Behavioral Modeling for Wireless Power Transfer System Coils}, journal = {IEEE Transactions on Industrial Electronics}, year = {2020}, volume = {ea}, number = {ea}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-11}, keywords = {This paper derives low-complexity behavioral analytical models of the mutual inductance between the coupling coils of Wireless Power Transfer Systems (WPTSs), as functions of their reciprocal position. These models are extremely useful in the characterization and design optimization of WPTSs. Multi-Objective Genetic Programming (MOGP) algorithm is adopted to generate models ensuring an optimal trade-off between accuracy and complexity. The training and validation data sets needed for the generation of the models are here obtained by performing numerical full-3D electromagnetic simulations. The resulting behavioral models allow accurate and fast evaluation of the WPTS coils mutual inductance, over a wide range of misalignment conditions, enabling easier system analysis and optimization.}, web_url = {https://ieeexplore.ieee.org/document/8994192}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0278-0046, 1557-9948}, DOI = {10.1109/TIE.2019.2962432}, stag_bib_extends_levelofaccess = {NA}, author = {Di Capua, G. and Femia, N. and Stoyka, K. and Di Mambro, G. and Maffucci, A. and Ventre, S. and Villone, F.} } @Article { WanslebenVWBHBK2020, subid = {1685}, title = {Speciation of iron sulfide compounds by means of X-ray emission spectroscopy using a compact full-cylinder von Hamos spectrometer}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, volume = {35}, number = {11}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {2679-2685}, keywords = {-}, web_url = {https://arxiv.org/abs/2005.09509}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/D0JA00244E}, stag_bib_extends_levelofaccess = {NA}, author = {Wansleben, M. and Vinson, J. and W{\"a}hlisch, A. and Bzheumikhova, K. and Honicke, P. and Beckhoff, B. and Kayser, Y.} } @Article { HorenzTBNAGV2020, subid = {1716}, title = {A Study on the Analysis of Particle Size Distribution for Bimodal Model Nanoparticles by Electron Microscopy}, journal = {Microscopy and Microanalysis}, year = {2020}, volume = {26}, number = {S2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {2282}, keywords = {nanoparticles, size traceability, bi-modal distribution, silica, gold, electron microscoopy}, web_url = {https://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/study-on-the-analysis-of-particle-size-distribution-for-bimodal-model-nanoparticles-by-electron-microscopy/B9157A370AC198219A734770694340F3}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, address = {Cambridge}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927620021054}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}renz, C. and Tache, O. and Bartczak, D. and Nunez, S. and Abad Alvaro, I. and Goenaga-Infante, H. and Vasile-Dan Hodoroaba, V-D.} } @Article { LeviHVBH2019, subid = {1398}, title = {Cavity-enhanced non-destructive detection of atoms for an optical lattice clock}, journal = {Optics Express}, year = {2019}, month = {12}, volume = {27}, number = {26}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {37099}, keywords = {Non destructive measurement, Optical Lattice Clocks}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.037099}, stag_bib_extends_levelofaccess = {NA}, author = {Hobson, R. and Bowden, W. and Vianello, A. and Hill, I.R. and Gill, P.} } @Article { HorenderSIDVA2019, subid = {1333}, title = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm−3}, journal = {Metrologia}, year = {2019}, month = {11}, day = {27}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, keywords = {aerosol, optical particle counter, calibration, clean room, counting efficiency}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, booktitle = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm\(^{−3}\)}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab5c84}, stag_bib_extends_levelofaccess = {NA}, author = {Vasilatou, Konstantina and Dirscherl, Kai and Iida, Kenjiro and Sakurai, Hiromu and Horender, Stefan and Auderset, Kevin} } @Article { BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019, subid = {2340}, title = {The Metrological Traceability, Performance and Precision of European Radon Calibration Facilities}, journal = {International Journal of Environmental Research and Public Health}, year = {2019}, month = {11}, day = {21}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, keywords = {radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.3390/ijerph182212150}, stag_bib_extends_levelofaccess = {NA}, author = {Beck, T.R. and Antohe, A. and Cardellini, F. and Cucoş, A. and Fialova, E. and Grossi, C. and Hening, K. and Jensen, J. and Kastratović, D. and Krivoš{\'i}k, M. and Lobner, P. and Luca, A. and Maringer, F.J. and Michielsen, N. and Otahal, P.P.S. and Quindos, L. and Rabago, D. and Sainz, C. and Sz{\"u}cs, L. and Teodorescu, T. and Tolinsson, C. and Tugulan, C.L. and Turtiainen, T. and Vargas, A. and Vosahlik, J. and Vukoslavovic, G. and Wiedner, H. and Wołoszczuk, K.} } @Article { KlauiJPDGVCC2019, subid = {1308}, title = {Individual skyrmion manipulation by local magnetic field gradients}, journal = {Communications Physics}, year = {2019}, month = {11}, day = {15}, volume = {2}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {145}, keywords = {Skyrmion, MFM}, web_url = {https://www.nature.com/articles/s42005-019-0242-5\#article-info}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-019-0242-5}, stag_bib_extends_levelofaccess = {NA}, author = {Casiraghi, A. and Corte-Le{\'o}n, H. and Vafaee, M. and Garcia-Sanchez, F. and Durin, G. and Pasquale, M. and Jakob, G. and Kl{\"a}ui, M.} } @Article { KlauiJPDGVCC20190, subid = {1308}, title = {Individual skyrmion manipulation by local magnetic field gradients}, journal = {Communications Physics}, year = {2019}, month = {11}, day = {15}, volume = {2}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {145}, keywords = {Skyrmion, MFM}, web_url = {https://www.nature.com/articles/s42005-019-0242-5\#article-info}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-019-0242-5}, stag_bib_extends_levelofaccess = {NA}, author = {Casiraghi, A. and Corte-Le{\'o}n, H. and Vafaee, M. and Garcia-Sanchez, F. and Durin, G. and Pasquale, M. and Jakob, G. and Kl{\"a}ui, M.} } @Article { KipperHLBPHLV2019, subid = {1406}, title = {Retention of acidic and basic analytes in reversed phase column using fluorinated and novel eluent additives for liquid chromatography-tandem mass spectrometry}, journal = {Journal of Chromatography A}, year = {2019}, month = {11}, volume = {in press}, number = {in press}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {460667}, keywords = {Eluent additivesHFIPHFTBPPNFTBRetention mechanisms}, web_url = {https://www.sciencedirect.com/search/advanced?qs=Retention\%20of\%20acidic\%20and\%20basic\&pub=Journal\%20of\%20Chromatography\%20A\&cid=271409\&volumes=0\&lastSelectedFacet=volumes}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-9673}, DOI = {10.1016/j.chroma.2019.460667}, stag_bib_extends_levelofaccess = {NA}, author = {Veigure, R. and Lossmann, K. and Hecht, M. and Parman, E. and Born, R. and Leito, I. and Herodes, K. and Kipper, K.} } @Proceedings { CucciaSBLvAMCVSBPCT2019, subid = {1781}, title = {Development of standardized methods for the analysis of amines, terpenes and ammonia in biomethane}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, keywords = {biomethane, terpenes, amines, ammonia}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201906001}, stag_bib_extends_levelofaccess = {NA}, author = {Cuccia, L. and Sanz, B. and Ballestas Castro, D. and Li, J. and van der Veen, A.M.H. and Amico di Meane, E. and Moreno, S. and Culleton, L.P. and Vorin, D. and Senn{\'e}, C. and Bougueroua, F. and Pyr{\'e}e, L. and Courtois, Y. and Tastard, C.} } @Proceedings { PersijndMvL2019, subid = {1782}, title = {Metrology for biomethane conformity assessment: measure trace gas impurities in biomethane}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, keywords = {biomethane, siloxanes, halogenated hydrocarbons, hydrogen chloride, hydrogen fluoride, conformity assessment}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201906002}, stag_bib_extends_levelofaccess = {NA}, author = {Persijn, S. and de Krom, I. and Meuzelaar, H. and van der Veen, A.M.H. and Li, J.} } @Article { KokHvvR2019, subid = {1380}, title = {Current waveforms of household appliances for advanced meter testing}, journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {Electromagnetic compatibility , static meters , interference , accuracy , testing , household appliances}, tags = {SEG}, web_url = {https://zenodo.org/record/3582391\#.XiG1P3u7KUl}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/AMPS.2019.8897771}, stag_bib_extends_levelofaccess = {NA}, author = {van Leeuwen, R. and van den Brom, H. and Hoogenboom, D. and Kok, G. and Rietveld, G.} } @Article { RietveldKvWB2019, subid = {1377}, title = {Detection Methods for Current Signals Causing Errors in Static Electricity Meters}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {Power Quality Electricity Meters Short Time Fourier Transform Wavelet Transform Multiresolution Signal Decomposition Wavelets Smart Meters}, web_url = {https://zenodo.org/record/3582153\#.XiGzUXu7KUm}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/EMCEurope.2019.8872120}, stag_bib_extends_levelofaccess = {NA}, author = {Barakou, F. and Wright, P.S. and van den Brom, H.E. and Kok, G.J.P and Rietveld, G.} } @Article { vanLeeuwenHMvR2019, subid = {1378}, title = {A Testbed for Static Electricity Meter Testing with Conducted EMI}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {Static meters, energy measurement, standards, Electromagnetic Compatibility, EMC immunity testing, electricity meters.}, tags = {SEG}, web_url = {https://zenodo.org/record/3580444\#.XiG0OHu7KUk}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/EMCEurope.2019.8872130}, stag_bib_extends_levelofaccess = {NA}, author = {van den Brom, H.E. and Marais, Z. and Hoogenboom, D. and van Leeuwen, R. and Rietveld, G.} } @Article { HoogenboomvRvMR2019, subid = {1379}, title = {Sensitivity of static energy meter reading errors to changes in non-sinusoidal load conditions}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {static energy meter; metering error; electromagnetic interference; accuracy; impedance; phase firing angle.}, tags = {SEG}, web_url = {https://zenodo.org/record/3580436\#.XiG00Xu7KUl}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/EMCEurope.2019.8872006}, stag_bib_extends_levelofaccess = {NA}, author = {Marais, Z. and van den Brom, H.E. and Rietveld, G. and van Leeuwen, R. and Hoogenboom, D. and Rens, J.} } @Proceedings { CastroVWKHS2019, subid = {1202}, title = {Stability of the surface passivation properties of atomic layer deposited aluminum oxide in damp heat conditions}, journal = {AIP Conference Proceedings}, year = {2019}, month = {8}, day = {27}, volume = {2147}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {050003}, keywords = {Aluminium oxide, surface passivation, damp heat exposure, atomic layer deposition, degradation}, web_url = {https://aip.scitation.org/doi/pdf/10.1063/1.5123852?class=pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, event_place = {Leuven, Belgium}, event_name = {SiliconPV 2019, THE 9TH INTERNATIONAL CONFERENCE ON CRYSTALLINE SILICON PHOTOVOLTAICS}, event_date = {08-04-2019 to 10-04-2019}, language = {30}, ISBN = {978-0-7354-1892-9}, ISSN = {1551-7616}, DOI = {10.1063/1.5123852}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, I.T.S. and Koutsourakis, G. and Wood, S. and V{\"a}h{\"a}nissi, V. and Castro, F.A. and Savin, H.} } @Proceedings { ViniciusdLYHHFL2019, subid = {1187}, title = {Comparison of Measuring Systems for Puncture Test According to IEC 61211}, journal = {21st International Symposium on High Voltage Engineering}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {puncture test, measurement}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3243452}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Yan, W. and Li, Y. and Vinicius, M. and Filho, O. and Laiho, M.} } @Proceedings { VentreMDBCFPPRSTBASSGHBZFDKL2019, subid = {1200}, title = {Metrology for Inductive Charging of Electric Vehicles (MICEV)}, journal = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, year = {2019}, month = {8}, day = {19}, volume = {Electrical}, number = {2019 AEIT}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {6 pages}, keywords = {Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety}, tags = {SEG}, web_url = {http://arxiv.org/abs/1908.11108}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Turin (Italy)}, event_name = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, event_date = {02-07-2019 to 04-07-2019}, language = {30}, ISBN = {978-8-8872-3743-6}, ISSN = {0018-9219}, DOI = {10.23919/EETA.2019.8804498}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Bottauscio, O. and Harmon, S. and Guilizzoni, R. and Schilling, F. and Schmidt, M. and Ankarson, P. and Bergsten, T. and Tammi, K. and Sainio, P. and Romero, J.B. and Puyal, E.L. and Pichon, L. and Freschi, F. and Cirimele, V. and Bauer, P. and Dong, J. and Maffucci, A. and Ventre, S. and Femia, N. and Di Capua, G. and Kuster, N. and Liorni, I.} } @Article { ChouhaniFiPBJVH2019, subid = {2041}, title = {A Unique Interactive Nanostructure Knitting based Passive Sampler Adsorbent for Monitoring of Hg2+ in Water}, journal = {Sensors}, year = {2019}, month = {8}, volume = {19}, number = {15}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {3432}, keywords = {Nanostructure Knitting based Passive Sampler , Hg2+, Water}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s19153432}, stag_bib_extends_levelofaccess = {NA}, author = {Chouhan, R.S. and Žitko, G. and Fajon, V. and Živković, I. and Pavlin, M. and Berisha, S. and Jerman, I. and Vesel, A. and Horvat, M.} } @Article { CinelliNViePG2019, subid = {1216}, title = {Qualitative overview of indoor radon surveys in Europe}, journal = {Journal of Environmental Radioactivity}, year = {2019}, month = {8}, volume = {204}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {163-174}, keywords = {metroRADON, indoor radon surveys, representativeness}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0265-931X}, DOI = {10.1016/j.jenvrad.2019.04.010}, stag_bib_extends_levelofaccess = {NA}, author = {Pantelić, G. and Čeliković, I. and Živanović, M. and Vukanac, I. and Nikolić, J.K. and Cinelli, G. and Gruber, V.} } @Article { MurugandBvAtH2019, subid = {1816}, title = {Measurement challenges for hydrogen vehicles}, journal = {International Journal of Hydrogen Energy}, year = {2019}, month = {7}, volume = {44}, number = {35}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {19326-19333}, keywords = {Hydrogen; Fuel cell; Vehicles; ISO 14687; Metrology; Measurement; Flow metering; Quality control}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2019.03.190}, stag_bib_extends_levelofaccess = {NA}, author = {Murugan, A. and de Huu, M. and Bacquart, T. and van Wijk, J. and Arrhenius, K. and te Ronde, I. and Hemfrey, D.} } @Article { VasilatouAH2019_2, subid = {1220}, title = {Facility for calibration of optical and condensation particle counters based on a turbulent aerosol mixing tube and a reference optical particle counter}, journal = {Review of Scientific Instruments}, year = {2019}, month = {7}, volume = {90}, number = {7}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {075111}, keywords = {optical particle counters, aerosol instrumentation, aerosol generation setup, turbulent flow tube, particle homogenization, isokinetic sampling ports, particle counter, Stable and reproducible aerosols, polystyrene latex particles}, web_url = {https://aip.scitation.org/doi/10.1063/1.5095853}, misc2 = {EMPIR 2016: Environment}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5095853}, stag_bib_extends_levelofaccess = {NA}, author = {Horender, S. and Auderset, K. and Vasilatou, K.} } @Proceedings { HoffmannVQZB2019, subid = {1610}, title = {Fabrication and Measurements of Inductive Devices for Scanning Microwave Microscopy}, journal = {2019 IEEE 19th International Conference on Nanotechnology (IEEE-NANO)}, year = {2019}, month = {7}, volume = {2019}, number = {-}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {1-4}, keywords = {calibration, doping profiles, inductors, scanning probe microscopy, silicon compounds}, web_url = {https://zenodo.org/record/4275929}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Macao}, event_name = {IEEE Nano}, event_date = {22-07-2019 to 26-07-2019}, language = {30}, ISBN = {Electronic ISBN: 978-1-7281-28}, ISSN = {Electronic ISSN: 1944-9380 Pri}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4275929}, author = {Hoffmann, J. and Vasyukov, D. and Quang, T. L. and Ziade, F. and Buchter, A.} } @Article { HibberdMOCORMOPVHC2019, subid = {1159}, title = {Integrating informatics tools and portable sequencing technology for rapid detection of resistance to anti-tuberculous drugs}, journal = {Genome Medicine}, year = {2019}, month = {6}, day = {24}, volume = {11}, number = {1}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, pages = {41}, keywords = {whole genome sequencing, drug resistance, tuberculosis}, web_url = {https://genomemedicine.biomedcentral.com/articles/10.1186/s13073-019-0650-x}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1756-994X}, DOI = {10.1186/s13073-019-0650-x}, stag_bib_extends_levelofaccess = {NA}, author = {Phelan, J.E. and O’Sullivan, D.M. and Machado, D. and Ramos, J. and Oppong, Y.E.A. and Campino, S. and O’Grady, J. and McNerney, R. and Hibberd, M.L. and Viveiros, M. and Huggett, J.F. and Clark, T.G.} } @Article { IacomussiVR2019, subid = {1277}, title = {Innovative Design And Metrological Approaches To Smart Lighting}, journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE}, year = {2019}, month = {6}, day = {24}, number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting}, keywords = {Smart lighting, Road lighting, ILMD detector, Pedestrian safety, Systemic Design, Design by Components, Design Network, SURFACE, EMPIR}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {International Commission on Illumination, CIE}, language = {30}, DOI = {10.25039/x46.2019.PO192}, stag_bib_extends_levelofaccess = {NA}, author = {Valpreda, Fab. and Iacomussi, P. and Rossi, G.} } @Article { VernyGM2019, subid = {1274}, title = {Optimization Of Road Surface Reflections Properties And Lighting: Learning Of A Three-Year Experiment}, journal = {Proceedings of the 29th Quadrennial Session of the CIE}, year = {2019}, month = {6}, day = {24}, number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting}, keywords = {Road photometry, Adaptative road lighting, Real-site experiment, Time evolution, Obtrusive ligh, 16NRM02}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {International Commission on Illumination, CIE}, language = {30}, DOI = {10.25039/x46.2019.OP72}, stag_bib_extends_levelofaccess = {NA}, author = {Muzet, V. and GREFFIER, F. and Verny, P.} } @Article { vandenBromHHBKWI2019, subid = {1154}, title = {An Optoelectronic Pulse Drive for Quantum Voltage Synthesizer}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {2066-2071}, keywords = {Josephson arbitrary waveform synthesizer, Josephson arrays, measurement, metrology, optoelectronics, voltage measurement}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2877562}, stag_bib_extends_levelofaccess = {NA}, author = {Ireland, J. and Williams, J. and Kieler, O. and Behr, R. and Houtzager, E. and Hornecker, R. and van den Brom, H.E.} } @Article { WolthausRLdvvW2019, subid = {1144}, title = {Technical Note: Consistency of PTW 30013 and FC 65‐G ion chamber magnetic field correction factors}, journal = {Medical Physics}, year = {2019}, month = {5}, day = {27}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, keywords = {Reference dosimetry, MRgRT, ionisation chamber}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.13623}, stag_bib_extends_levelofaccess = {NA}, author = {Woodings, S.J. and van Asselen, B. and van Soest, T.L. and de Prez, L.A. and Lagendijk, J.J.W and Raaymakers, B.W and Wolthaus, J.W.H} } @Article { GardiniVPC2019, subid = {1165}, title = {Quantitative imaging of efflux pumps in planktonic and biofilm-associated bacteria through single-molecule localization microscopy - Biomedical Imaging and Sensing Conference}, journal = {Biomedical Imaging and Sensing Conference}, year = {2019}, month = {4}, day = {21}, volume = {11140}, number = {2019}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {170-174}, keywords = {Quantitative imaging of efflux pumps in planktonic and biofilm-associated bacteria throughsingle-molecule localization microscopy}, web_url = {https://www.spiedigitallibrary.org/conference-proceedings-of-spie/11140/2535451/Biomedical-Imaging-and-Sensing-Conference/10.1117/12.2535451.full}, misc2 = {EMPIR 2015: Health}, publisher = {SPIE}, language = {30}, ISSN = {0277-786X}, DOI = {10.1117/12.2535451}, stag_bib_extends_levelofaccess = {NA}, author = {Gardini, L. and Vignolini, T. and Pavone, F.S. and Capitanio, M.} } @Article { MartinezVerduVVBP2019, subid = {1014}, title = {Graininess characterization by multidimensional scaling}, journal = {Journal of Modern Optics}, year = {2019}, month = {4}, volume = {67}, number = {1}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {1-10}, keywords = {graininess, special-effect pigments, multidimensional scaling algorithm, psychophysical experiment}, web_url = {https://www.tandfonline.com/doi/full/10.1080/09500340.2019.1589006}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Taylor \& Francis}, language = {30}, ISSN = {1362-3044}, DOI = {10.1080/09500340.2019.1589006}, stag_bib_extends_levelofaccess = {NA}, author = {Perales, E. and Burgos, F.J. and Vilaseca, M. and Viqueira, V. and Mart{\'i}nez-Verd{\'u}, F.M.} } @Article { RaaymakersJWvdWd2019, subid = {1046}, title = {Direct measurement of ion chamber correction factors, k\(_{Q}\) and k\(_{B}\), in a 7 MV MRI-linac}, journal = {Physics in Medicine and Biology}, year = {2019}, month = {4}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, keywords = {absorbed dose, MRgRT, kB, kQ, magnetic field}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/ab1511/pdf}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ab1511}, stag_bib_extends_levelofaccess = {NA}, author = {de Prez, L.A. and Woodings, S.J. and de Pooter, J.A. and van Asselen, B. and Wolthaus, J.W.H. and Jansen, B.J. and Raaymakers, B.W.} } @Article { KiselevDMFVPABBLXBHD2019, subid = {1024}, title = {Long Slender Piezo-Resistive Silicon Microprobes for Fast Measurements of Roughness and Mechanical Properties inside Micro-Holes with Diameters below 100 µm}, journal = {Sensors 2019}, year = {2019}, month = {3}, day = {22}, volume = {19(6)}, number = {1410}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {cantilever microprobe; high-speed; contact resonance; tip wear; piezo-resistive; mechanical damping; tip-testing standard}, web_url = {https://www.mdpi.com/1424-8220/19/6/1410}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, address = {Basel}, language = {30}, DOI = {10.3390/s19061410}, stag_bib_extends_levelofaccess = {NA}, author = {Brand, U. and XU, M. and Doering, L. and Langfahl-Klabes, J. and Behle, H. and B{\"u}tefisch, S. and Ahbe, T. and Peiner, E. and V{\"o}llmeke, S. and Frank, T. and Mickan, B. and Kiselev, I. and Hauptmannl, M. and Drexel, M.} } @Article { vandenBromvv2019, subid = {1458}, title = {Characterization of DC Current Sensors With AC Distortion for Railway Applications}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {3}, volume = {68}, number = {6}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {2084-2090}, keywords = {Current measurement, current sensors, current transducers, measurement standards, measurement techniques, measurement uncertainty, precision measurements.}, tags = {SEG}, web_url = {https://zenodo.org/record/3265674\#.Xnj0qYj7Q2w}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2019.2898014}, stag_bib_extends_levelofaccess = {NA}, author = {van den Brom, H. and van den Brom, H.E. and van Leeuwen, R.} } @Article { GramegnaRPARVDG2019, subid = {1006}, title = {Optimal estimation of entanglement and discord in two-qubit states}, journal = {Scientific Reports}, year = {2019}, month = {2}, day = {28}, volume = {9}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1-9}, keywords = {quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-39334-8}, stag_bib_extends_levelofaccess = {NA}, author = {Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Ruo Berchera, I. and Degiovanni, I.P. and Genovese, M.} } @Article { GramegnaRPARVDG20190, subid = {1006}, title = {Optimal estimation of entanglement and discord in two-qubit states}, journal = {Scientific Reports}, year = {2019}, month = {2}, day = {28}, volume = {9}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1-9}, keywords = {quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-39334-8}, stag_bib_extends_levelofaccess = {NA}, author = {Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Ruo Berchera, I. and Degiovanni, I.P. and Genovese, M.} } @Article { GramegnaRPARVDG20191, subid = {1006}, title = {Optimal estimation of entanglement and discord in two-qubit states}, journal = {Scientific Reports}, year = {2019}, month = {2}, day = {28}, volume = {9}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1-9}, keywords = {quantum technologies}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-39334-8}, stag_bib_extends_levelofaccess = {NA}, author = {Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Ruo Berchera, I. and Degiovanni, I.P. and Genovese, M.} } @Article { RaaymakersWHMv2019, subid = {1048}, title = {Monte Carlo simulations of out-of-field surface doses due to the electron streaming effect in orthogonal magnetic fields}, journal = {Physics in Medicine and Biology}, year = {2019}, month = {2}, day = {26}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, keywords = {out-of-field dose, MRgRT}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ab0aa0}, stag_bib_extends_levelofaccess = {NA}, author = {Malkov, V.N. and Hackett, S.L. and Wolthaus, J.W.H. and Raaymakers, B.W. and van Asselen, B.} } @Article { WolthausRvHM2019, subid = {1142}, title = {Monte Carlo simulations of out-of-field skin dose due to spiralling contaminant electrons in a perpendicular magnetic field}, journal = {Medical Physics}, year = {2019}, month = {2}, day = {14}, volume = {46}, number = {3}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {1467-1477}, keywords = {MRgRT, Monte Carlo, dosimetry, magnetic field}, web_url = {https://aapm.onlinelibrary.wiley.com/doi/full/10.1002/mp.13392}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405}, DOI = {10.1002/mp.13392}, stag_bib_extends_levelofaccess = {NA}, author = {Malkov, V.N. and Hackett, S.L. and van Asselen, B. and Raaymakers, B.W. and Wolthaus, Jochem W. H.} } @Article { LazzeriniDGVKYB2019, subid = {1074}, title = {Design and performance of a test rig for evaluation of nanopositioning stages}, journal = {Measurement Science and Technology}, year = {2019}, month = {2}, volume = {30}, number = {3}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {035002}, keywords = {multi-axis positioning stages, traceability, nanopositioning, dimensional metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aafd03}, stag_bib_extends_levelofaccess = {NA}, author = {Yacoot, Andrew and Klapetek, Petr and Valtr, Miroslav and Grolich, Petr and Dongmo, Herve and Lazzerini, Giovanni M and Bridges, Angus} } @Article { KokvvWWJddR2019, subid = {1045}, title = {Commissioning of a water calorimeter as a primary standard for absorbed dose to water in magnetic fields}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {1}, day = {29}, volume = {64}, number = {3}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {035013}, keywords = {dosimetry, MRgRT, primary standard, magnetic field, MRI-linac, calorimetry}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/aaf975}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aaf975}, stag_bib_extends_levelofaccess = {NA}, author = {de Prez, L. and de Pooter, J. and Jansen, B. and Woodings, S. and Wolthaus, J. and van Asselen, B. and van Soest, T. and Kok, J. and Raaymakers, B.} } @Proceedings { Horneckervv2019, subid = {1147}, title = {Characterization of DC current sensors under distorted conditions for railway applications}, journal = {2018 IEEE International Conference on Electrical Systems for Aircraft, Railway, Ship Propulsion and Road Vehicles \& International Transportation Electrification Conference (ESARS-ITEC)}, year = {2019}, month = {1}, day = {14}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {current sensor, current measurement function, energy measurement function, railway application}, tags = {SEG}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Nottingham, UK,}, event_name = {Conference on Electrical Systems for Aircraft, Railway, Ship Propulsion and Road Vehicles (ESARS) \& International Transportation Electrification Conference (ITEC)}, event_date = {07-11-2018 to 09-11-2018}, language = {30}, DOI = {10.5281/zenodo.3265659}, stag_bib_extends_levelofaccess = {NA}, author = {Hornecker, R. and van Leeuwen, R. and van den Brom, H.E.} } @Article { PiacentiniGRAVVMDG2019, subid = {1005}, title = {Theoretical description and experimental simulation of quantum entanglement near open time-like curves via pseudo-density operators}, journal = {Nature Communications}, year = {2019}, month = {1}, day = {14}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1-7}, keywords = {quantum entanglement, pseudo-density operators,}, web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-018-08100-1}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { PiacentiniGRAVVMDG20190, subid = {1005}, title = {Theoretical description and experimental simulation of quantum entanglement near open time-like curves via pseudo-density operators}, journal = {Nature Communications}, year = {2019}, month = {1}, day = {14}, volume = {10}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1-7}, keywords = {quantum entanglement, pseudo-density operators,}, web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-018-08100-1}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Proceedings { LalereGPV2019, subid = {2096}, title = {Certified reference materials for breath alcohol control - the ALCOREF project}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, number2 = {16RPT02: ALCOREF: Certified forensic alcohol reference materials}, keywords = {road safety, breath analyser, ethanol in water solution, metrological European infrastructure, certified reference material, traceability}, web_url = {https://cim2019.com/home.html}, misc2 = {EMPIR 2016: Research Potential}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {CIM 2019}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/METROLOGY/201915002}, stag_bib_extends_levelofaccess = {NA}, author = {Lal{\`e}re, B. and Gantois, F. and Philipp, R. and Vaslin-Reimann, S.} } @Article { VavassoriASCGPRCC2019, subid = {1307}, title = {Magnetic imaging using geometrically constrained nano-domain walls}, journal = {Nanoscale}, year = {2019}, volume = {11}, number = {10}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {4478-4488}, keywords = {MFM}, web_url = {https://pubs.rsc.org/en/content/articlelanding/2019/NR/C8NR07729K\#!divAbstract}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/C8NR07729K}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Corte-Le{\'o}n, H. and Rodr{\'i}guez, L A. and Pancaldi, M. and Gatel, C. and Cox, D. and Snoeck, E. and Antonov, V. and Vavassori, P.} } @Article { HashadVVNS2019, subid = {1020}, title = {Computation of the effective area and associated uncertainties of non-rotating piston gauges FPG and FRS}, journal = {Metrologia}, year = {2019}, volume = {56}, number = {015004}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {1-10}, keywords = {primary pressure standard, effective area, rarefied gas dynamics, FPG and FRS characterization}, web_url = {https://doi.org/10.1088/1681-7575/aaee18}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {1681-7575/19/015004+10$33.00}, DOI = {10.1088/1681-7575/aaee18}, stag_bib_extends_levelofaccess = {NA}, author = {Naris, S. and Vasileiadis, N. and Valougeorgis, D. and Hashad, A.S. and Sabuga, W.} } @Proceedings { SpasovaBNOSCTHZSAV2019, subid = {1490}, title = {A new EMPIR Project “MetForTC” for Developing Traceable Measurement Capabilities for Monitoring Thermocouple Performance}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, volume = {-}, number = {2019}, number2 = {18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance}, pages = {5/18006}, keywords = {EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple}, misc2 = {EMPIR 2018: Research Potential}, publisher = {EDP Sciences}, event_place = {Paris, France}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201918006}, stag_bib_extends_levelofaccess = {NA}, author = {Arifovic, N. and Sestan, D. and Zvizdić, D. and Hozic, N. and Turz{\'o}-Andr{\'a}s, E. and Čohodarević, S. and Strnad, R. and Opel, K. and Neagu, D. and Bordianu, C. and Spasova, S. and Vukičević, T.} } @Proceedings { SPINELLICTVDKWMDDD2019, subid = {1405}, title = {EURAMET EMPIR 18HLT06 RaCHy Project: Radiotherapy coupled with Hyperthermia (Induced by HITU)}, journal = {unavailable}, year = {2019}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {1032-1036}, keywords = {External beam radiotherapy, EBRT, HITU, Ultrasound, Hyperthermia}, web_url = {http://publications.rwth-aachen.de/record/767416}, misc2 = {EMPIR 2018: Health}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik}, event_place = {Aachen, Germany}, event_name = {23rd International Congress on Acoustics : integrating 4th EAA Euroregio}, event_date = {09-09-2019 to 13-09-2019}, language = {30}, ISBN = {978-3-939296-15-7}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.18154/RWTH-CONV-238838}, author = {SPINELLI, A. and CACCIA, B. and TER HAAR, G. and VAN RHOON, G. and de Pooter, J. and Karab{\"o}ce, B. and Wilkens, V. and MILORO, P. and Durando, G. and DENKOWA, A. and DIJKEMA, R.} } @Proceedings { PeinerXBVKF2018, subid = {1025}, title = {Optimizing a Cantilever Measurement System towards High Speed, Nonreactive Contact-Resonance-Profilometry}, journal = {Proceedings}, year = {2018}, month = {11}, day = {21}, volume = {2}, number = {13}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {889}, keywords = {contact resonance spectroscopy; layer analysis; piezoresistive; tactile cantilever;automatic gain control; phase-locked-loop}, web_url = {https://www.mdpi.com/2504-3900/2/13/889}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, event_place = {Graz, Austria}, event_name = {Eurosensors 2018}, event_date = {09-09-2018 to 12-09-2018}, language = {30}, ISSN = {2504-3900}, DOI = {10.3390/proceedings2130889}, stag_bib_extends_levelofaccess = {NA}, author = {Fahrbach, M. and Krieg, L. and Voss, T. and Bertke, M. and Xu, J. and Peiner, E.} } @Article { VasilatouE2018, subid = {895}, title = {Characterization of a new miniCAST with diffusion flame and premixed flame options: Generation of particles with high EC content in the size range 30 nm to 200 nm}, journal = {Aerosol Science and Technology}, year = {2018}, month = {11}, day = {15}, number2 = {16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols}, pages = {1-16}, keywords = {soot, black carbon, miniCAST, aerosol}, web_url = {https://www.tandfonline.com/doi/full/10.1080/02786826.2018.1536818}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, language = {30}, ISSN = {0278-6826, 1521-7388}, DOI = {10.1080/02786826.2018.1536818}, stag_bib_extends_levelofaccess = {NA}, author = {Ess, M.N. and Vasilatou, K.} } @Article { MartinezVerduCPVF2018, subid = {1008}, title = {Definition of a measurement scale of graininess from reflectance and visual measurements}, journal = {Optics Express}, year = {2018}, month = {11}, volume = {26}, number = {23}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {30116}, keywords = {Graininess, texture effects, reflectance and traceability}, web_url = {https://www.osapublishing.org/oe/fulltext.cfm?uri=oe-26-23-30116\&id=400717}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.030116}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Vel{\'a}zquez, J.L. and Perales, E. and Campos, J. and Mart{\'i}nez Verd{\'u}, F.M.} } @Proceedings { DambrineRVMMDRH2018, subid = {1002}, title = {On-Wafer Broadband Microwave Measurement of High Impedance Devices-CPW Test Structures with Integrated Metallic Nano-Resistances}, journal = {2018 48th European Microwave Conference (EuMC)}, year = {2018}, month = {11}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {25-28}, keywords = {S-parameters, microwave, uncertainty, on-wafer,}, web_url = {https://hal.archives-ouvertes.fr/hal-02056825}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Madrid}, event_name = {EuMC 2018}, event_date = {23-09-2018 to 27-09-2018}, language = {30}, DOI = {10.23919/EuMC.2018.8541607}, stag_bib_extends_levelofaccess = {NA}, author = {Daff{\'e}, K. and Mubarak, F. and Mascolo, V. and Votsi, H. and Ridler, N.M. and Dambrine, G. and Roch, I. and Haddadi, K.} } @Article { FarooqAMLPLVF2018, subid = {1028}, title = {Autoignition studies of Liquefied Natural Gas (LNG) in a shock tube and a rapid compression machine}, journal = {Fuel}, year = {2018}, month = {11}, volume = {232}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {423-430}, keywords = {Alternative fuels, combustion, kinetics, LNG, Shock tube, RCM}, tags = {EnG}, web_url = {https://www.sciencedirect.com/science/article/pii/S0016236118308238}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0016-2361}, DOI = {10.1016/j.fuel.2018.04.168}, stag_bib_extends_levelofaccess = {NA}, author = {Vallabhuni, S.K. and Lele, A.D. and Patel, V. and Lucassen, A. and Moshammer, K. and AlAbbad, M. and Farooq, A. and Fernandes, R.X.} } @Article { VargasBCMPR2018, subid = {894}, title = {An Unmanned Aircraft System to Detect a Radiological Point Source Using RIMA Software Architecture}, journal = {Remote Sensing}, year = {2018}, month = {10}, day = {30}, volume = {10}, number = {11}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {1712}, keywords = {UAS, CZT, UAS software Architecture, radiological detection}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs10111712}, stag_bib_extends_levelofaccess = {NA}, author = {Royo, P. and Pastor, E. and Macias, M. and Cuadrado, R. and Barrado, C. and Vargas, A.} } @Article { KuosmanenTHWV2018, title = {Uncertainty analysis of phase and amplitude of harmonic components of bearing inner ring four-point roundness measurement}, journal = {Precision Engineering}, year = {2018}, month = {10}, volume = {54}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {118-130}, keywords = {Monte-Carlo simulation, Phase uncertainty, Harmonic component uncertainty, Uncertainty evaluation, Bearing excitation, Odd and even harmonic components, Four-point method, Three-point method}, web_url = {https://www.sciencedirect.com/science/article/pii/S0141635918302368}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2018.05.008}, stag_bib_extends_levelofaccess = {NA}, author = {Kuosmanen, P. and Tammi, K. and Hemming, B. and Widmaier, T. and Viitala, R.} } @Article { ChebenVMOHLSWH2018, subid = {873}, title = {Tilted subwavelength gratings: controlling anisotropy in metamaterial nanophotonic waveguides}, journal = {Optics Letters}, year = {2018}, month = {9}, day = {21}, volume = {43}, number = {19}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {4691}, keywords = {Subwavelength, anisotropy, silicon, waveguides}, web_url = {https://riuma.uma.es/xmlui/handle/10630/16695}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.43.004691}, stag_bib_extends_levelofaccess = {NA}, author = {Luque-Gonz{\'a}lez, J.M. and Herrero-Bermello, A. and Ortega-Monux, A. and Molina-Fernandez, I. and Velasco, A.V. and Cheben, P. and Schmid, J.H. and Wang, S. and Halir, R.} } @Article { UrbachVG2018, subid = {953}, title = {Role of Radial Charges on the Angular Momentum of Electromagnetic Fields: Spin-3/2 Light}, journal = {Physical Review Letters}, year = {2018}, month = {9}, day = {21}, volume = {121}, number = {12}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {123202-1}, keywords = {Angular Momentum of Light, Electromagnetism, Helmholtz Natural Modes, Spin-orbit coupling, Light propagation, transmission and absorption, Metrology, Optical vortices, Classical field theory}, misc2 = {EMPIR 2016: Energy}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.121.123202}, stag_bib_extends_levelofaccess = {NA}, author = {Gawhary, O.E. and Van Mechelen, T. and Urbach, H.P.} } @Article { BurianovaVS2018, subid = {810}, title = {Tissue-equivalence of 3D-printed plastics for medical phantoms in radiology}, journal = {Journal of Instrumentation}, year = {2018}, month = {9}, day = {20}, volume = {13}, number = {09}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {P09018-P09018}, keywords = {Medical phantom; radiology; ionizing radiation; 3D print; linear attenuation coefficient; Hounsfield unit}, web_url = {http://mrtdosimetry-empir.eu/?page_id=1166}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/13/09/P09018}, stag_bib_extends_levelofaccess = {NA}, author = {Solc, J. and Vrba, T. and Burianov{\'a}, L.} } @Article { KuosmanenWV2018, title = {Subcritical vibrations of a large flexible rotor efficiently reduced by modifying the bearing inner ring roundness profile}, journal = {Mechanical Systems and Signal Processing}, year = {2018}, month = {9}, volume = {110}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {42-58}, keywords = {Rotor dynamics, Dynamic run-out, Low-order bearing waviness, Four-point method}, web_url = {https://www.sciencedirect.com/science/article/pii/S0888327018301298}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0888-3270}, DOI = {10.1016/j.ymssp.2018.03.010}, stag_bib_extends_levelofaccess = {NA}, author = {Kuosmanen, P. and Widmaier, T. and Viitala, R.} } @Article { VanhaeckeCL2018_2, subid = {971}, title = {Ultra-trace Cu isotope ratio measurements via multi-collector ICP-mass spectrometry using Ga as internal standard: an approach applicable to micro-samples}, journal = {Analytica Chimica Acta}, year = {2018}, month = {9}, volume = {1025}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {69-79}, keywords = {MC-ICP-MS; Copper; Gallium; Isotope ratio; Interferences; Micro-samples}, web_url = {https://www.sciencedirect.com/science/article/pii/S0003267018306147?via\%3Dihub}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0003-2670}, DOI = {10.1016/j.aca.2018.05.025}, stag_bib_extends_levelofaccess = {NA}, author = {Lauwens, S. and Costas-Rodr{\'i}guez, M. and Vanhaecke, F.} } @Article { LeuenbergerPHMVN2018, title = {Effect of moisture on the adsorption of ammonia}, journal = {Applied Physics B}, year = {2018}, month = {8}, day = {30}, volume = {124}, number = {9}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {189}, keywords = {Ammonia, adsorption, moisture}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-018-7054-2}, stag_bib_extends_levelofaccess = {NA}, author = {Leuenberger, D. and Persijn, S. and Halonen, L. and Mets{\"a}l{\"a}, M. and Vaittinen, O. and Niederhauser, B.} } @Article { BruchertseiferFCDPHVPLMM2018, title = {Measurement of absolute \(\gamma\)-ray emission probabilities in the decay of 227Ac in equilibrium with its progeny}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {8}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, keywords = {\(\gamma\)-ray intensities, 227Ac, 227Th, 223Ra, decay data, \(\gamma\)-ray spectrometry}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2018.08.023}, stag_bib_extends_levelofaccess = {NA}, author = {Bruchertseifer, F. and Fazio, A. and Carconi, P. and Dry{\'a}k, P. and Pierre, S. and Hult, M. and Van Ammel, R. and Pomm{\'e}, S. and Lutter, G. and Marouli, M. and Morgenstern, A.} } @Article { GafvertVMDF2018, title = {InSiCal – A tool for calculating calibration factors and activity concentrations in in situ gamma spectrometry}, journal = {Journal of Environmental Radioactivity}, year = {2018}, month = {8}, volume = {188}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {58-66}, keywords = {In-situ gamma spectrometry, Detector calibration, Software tool, Measurement uncertainty, Environmental radioactivity}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0265-931X}, DOI = {10.1016/j.jenvrad.2017.10.011}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"a}fvert, T. and Vidmar, T. and Mauring, A. and Drefvelin, J. and Fazio, A.} } @Article { LuisoLGGDV2018, subid = {990}, title = {A Set-up for Static and Dynamic Characterization of Voltage and Current Transducers used in Railway Application}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {052019}, keywords = {Railroad transportation, Railroad, Characterization procedures, Current transducer, Dynamic characterization, Measurement system, Metrological characteristics, Power quality measurements, Railway applications, Real operating conditions}, tags = {SEG}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/5/052019}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/5/052019}, stag_bib_extends_levelofaccess = {NA}, author = {Delle Femine, A. and Gallo, D. and Giordano, D. and Landi, C. and Luiso, M. and Visconte, R.} } @Article { OguzAytekinKMSISFSZSJoHBHPV2018, subid = {1086}, title = {Improving emerging European NMIs’ capabilities in humidity measurement}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {122019}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/12/122019}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Zvizdić, D. and Sestan, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Article { KuuskABVF2018, subid = {2453}, title = {Implication of Illumination Beam Geometry on Stray Light and Bandpass Characteristics of Diode Array Spectrometer}, journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing}, year = {2018}, month = {8}, volume = {11}, number = {8}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {2925-2932}, keywords = {Optical fibre devices, Optical spectroscopy, stray light, laser measurement, Illumination beam geometry}, misc2 = {EMPIR 2016: Environment}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1939-1404, 2151-1535}, DOI = {10.1109/JSTARS.2018.2841772}, stag_bib_extends_levelofaccess = {NA}, author = {Kuusk, J. and Ansko, I. and Bialek, A. and Vendt, R. and Fox, N.} } @Article { vanSchaikPBP2018, subid = {999}, title = {Climatic chamber for dew-point temperatures up to 150 \(^{\circ}\)C}, journal = {Metrologia}, year = {2018}, month = {7}, day = {13}, volume = {55}, number = {4}, number2 = {14IND11: HIT: Metrology for humidity at high temperatures and transient conditions}, pages = {597-608}, keywords = {calibration, high temperatures, relative humidity, sensors, speed of sound}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/aacecc/meta}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aacecc}, stag_bib_extends_levelofaccess = {NA}, author = {Bosma, R. and Pouw, R.J. and van Schaik, W. and Peruzzi, A.} } @Thesis { vanHove2018, subid = {1342}, title = {Towards effective emission regulations: A numerical and experimental study on flow measurement uncertainty in stacks}, year = {2018}, month = {7}, day = {12}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, keywords = {uncertainty quantification, large-eddy simulation, OpenFOAM, pipe flow, S-type pitot tube, uncertainty propagation}, misc2 = {EMPIR 2016: Environment}, publisher = {TU Delft Library}, address = {Delft}, school = {Delft University of Technology}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.4233/uuid:f56ff5c1-8a9c-4b5c-b404-ab421b7ede59}, author = {van Hove, A.} } @Article { EllingsbergBAVLRWPS2018, subid = {1376}, title = {Evaluation of EMI Effects on Static Electricity Meters}, journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters.}, tags = {SEG}, web_url = {https://zenodo.org/record/3587786\#.XiGxp3u7KUn}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/CPEM.2018.8500945}, stag_bib_extends_levelofaccess = {NA}, author = {Wright, P.S. and Rietveld, G. and Leferink, F. and van den Brom, H.E. and Alonso, F.R.I and Braun, J.P. and Ellingsberg, K. and Pous, M. and Svoboda, M.} } @Article { PonsVFC2018, subid = {901}, title = {Index for the evaluation of the general photometric performance of photometers}, journal = {Optics Express}, year = {2018}, month = {7}, volume = {26}, number = {14}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {18633}, keywords = {photometer, spectral, mismatch, error, quality index}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.018633}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Vel{\'a}zquez, J.L. and Pons, A. and Campos, J.} } @Article { CampCV2018, title = {Comparison of methods for H* (10) calculation from measured LaBr 3 (Ce) detector spectra}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {7}, volume = {137}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {241-249}, keywords = {H*(10) calculation methods, LaBr3(Ce) detector, MetroERM}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2018.03.026}, stag_bib_extends_levelofaccess = {NA}, author = {Camp, A. and Cornejo, N. and Vargas, A.} } @Article { IkonenGEVK2018, title = {Uncertainty analysis of total ozone derived from direct solar irradiance spectra in the presence of unknown spectral deviations}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {6}, day = {20}, volume = {11}, number = {6}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {3595-3610}, keywords = {solar UV, spectral irradiance, total ozone column, systematic spectral deviations, spectral correlations, uncertainty}, web_url = {https://doi.org/10.5194/amt-11-3595-2018}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-3595-2018}, stag_bib_extends_levelofaccess = {NA}, author = {Ikonen, E. and Gr{\"o}bner, J. and Egli, L. and Vaskuri, A. and K{\"a}rh{\"a}, P.} } @Article { RaaymakersKvHWvW2018, subid = {951}, title = {A formalism for reference dosimetry in photon beams in the presence of a magnetic field}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {6}, day = {11}, volume = {63}, number = {12}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {125008}, keywords = {Dosimetry, MRgRT, Radiotherapy, magnetic fields}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aac70e/meta}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aac70e}, stag_bib_extends_levelofaccess = {NA}, author = {van Asselen, B. and Woodings, S.J. and Hackett, S.L. and van Soest, T.L. and Kok, J.G.M and Raaymakers, B.W and Wolthaus, J.W.H} } @Article { CorrederaSPGdV2018, subid = {569}, title = {Experimental Demonstration of Low-Uncertainty Calibration Methods for Bragg Grating Interrogators}, journal = {Sensors}, year = {2018}, month = {6}, day = {10}, volume = {18}, number = {6}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1895}, keywords = {fiber-optic sensors; fiber Bragg gratings interrogators; absolute calibration}, misc2 = {EMPIR 2014: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s18061895}, stag_bib_extends_levelofaccess = {NA}, author = {de Miguel, J. and Galindo-Santos, J. and Pulido de Torres, C. and Salgado, P. and Velasco, A.V. and Corredera, P.} } @Article { WidmaierVRLEHKL2018, title = {Interferometric step gauge for CMM verification}, journal = {Measurement Science and Technology}, year = {2018}, month = {6}, volume = {29}, number = {7}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {074012}, keywords = {CMM, verification, metrology}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aabd2b}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, DOI = {10.1088/1361-6501/aabd2b}, stag_bib_extends_levelofaccess = {NA}, author = {Widmaier, T. and Viitala, R. and Rantanen, A. and Laukkanen, P. and Esala, V.P. and Hemming, B. and Kuosmanen, P. and Lassila, A.} } @Article { vanSlagerenKFKPFKMPKBMP2018, subid = {898}, title = {Room Temperature Uniaxial Magnetic Anisotropy Induced By Fe-Islands in the InSe Semiconductor Van Der Waals Crystal}, journal = {Advanced Science}, year = {2018}, month = {5}, day = {11}, volume = {5}, number = {7}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {1800257}, keywords = {Magnetic Anisotropy, Nanotechnology, Nano-scale traceable magnetic field measurements}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Wiley}, language = {30}, ISSN = {2198-3844}, DOI = {10.1002/advs.201800257}, stag_bib_extends_levelofaccess = {NA}, author = {Moro, F. and Bhuiyan, M.A. and Kudrynskyi, Z.R. and Puttock, R. and Kazakova, O. and Makarovsky, O. and Fay, M.W. and Parmenter, C. and Kovalyuk, Z.D. and Fielding, A.J. and Kern, M. and van Slageren, J. and Patan{\`e}, A.} } @Article { VandervorstvAZFMMC2018, subid = {482}, title = {Toward accurate composition analysis of GaN and AlGaN using atom probe tomography}, journal = {Journal of Vacuum Science \& Technology B, Nanotechnology and Microelectronics: Materials, Processing, Measurement, and Phenomena}, year = {2018}, month = {5}, volume = {36}, number = {3}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {03F130}, keywords = {accuracy, composition, Atom probe, GaN}, web_url = {https://avs.scitation.org/doi/10.1116/1.5019693}, misc2 = {EMPIR 2014: Industry}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/1.5019693}, stag_bib_extends_levelofaccess = {NA}, author = {Morris, R.J.H. and Cuduvally, R. and Melkonyan, D. and Fleischmann, C. and Zhao, M. and Arnoldi, L. and van der Heide, P. and Vandervorst, W.} } @Article { GenoveseDBTVLGAP2018, subid = {532}, title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement}, journal = {Scientific Reports}, year = {2018}, month = {5}, volume = {8}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-25156-7}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Gramegna, M. and Lussana, R. and Villa, F. and Tosi, A. and Brida, G. and Degiovanni, I.P. and Genovese, M.} } @Article { GenoveseDBTVLGAP20180, subid = {532}, title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement}, journal = {Scientific Reports}, year = {2018}, month = {5}, volume = {8}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-25156-7}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Gramegna, M. and Lussana, R. and Villa, F. and Tosi, A. and Brida, G. and Degiovanni, I.P. and Genovese, M.} } @Article { MolinaFernandezHOVWGHV2018, subid = {570}, title = {Ultra-Broadband Mode Converter and Multiplexer Based on Sub-Wavelength Structures}, journal = {IEEE Photonics Journal}, year = {2018}, month = {4}, volume = {10}, number = {2}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1-10}, keywords = {Mode-division multiplexing, mode-converter, broadband, sub-wavelength grating waveguides, silicon-on-insulator}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1943-0655}, DOI = {10.1109/JPHOT.2018.2819364}, stag_bib_extends_levelofaccess = {NA}, author = {Gonzalez-Andrade, D. and Wanguemert-Perez, J.G. and Velasco, A. and Velasco, A.V. and Ortega-Monux, A. and Herrero-Bermello, A. and Molina-Fernandez, I. and Halir, R.} } @Article { VenceljPDCBGP2018, title = {Evaluation of the radon interference on the performance of the portable monitoring air pump for radioactive aerosols (MARE)}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {4}, volume = {134}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {439-445}, keywords = {Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements, Radon and thoron background, Radon progeny, Walk-in radon chamber}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.07.039}, stag_bib_extends_levelofaccess = {NA}, author = {Vencelj, M. and Ponikvar, D. and De Felice, P. and Cardellini, F. and Brodnik, D. and Glavič-Cindro, D. and Petrovič, T.} } @Article { CalonicoPTVR2018, subid = {589}, title = {Phase noise cancellation in polarisation-maintaining fibre links}, journal = {Review of Scientific Instruments}, year = {2018}, month = {3}, volume = {89}, number = {3}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {033103}, keywords = {frequency metrology, optical fibre links}, web_url = {http://arxiv.org/abs/1807.10818}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5016514}, stag_bib_extends_levelofaccess = {NA}, author = {Rauf, B. and V{\'e}lez L{\'o}pez, M. C. and Thoumany, P. and Pizzocaro, M. and Calonico, D.} } @Article { PaleckiOMLLJIHHGDTPdTVM2018_2, title = {Towards a global land surface climate fiducial reference measurements network}, journal = {International Journal of Climatology}, year = {2018}, month = {3}, volume = {38}, number = {6}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {2760-2774}, keywords = {climate, metrology, essential climate variables, climate change}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley}, language = {30}, ISSN = {0899-8418}, DOI = {10.1002/joc.5458}, stag_bib_extends_levelofaccess = {NA}, author = {Palecki, M. and Oakley, T. and Merlone, A. and Lawrimore, J. H. and Lister, D. H. and Jones, P. D. and Ingleby, N. B. and Hausfather, Z. and Harrigan, S. and Goodison, B. and Diamond, H. J. and Thorne, P. W. and Peterson, T. C. and de Podesta, M. and Tassone, C. and Venema, V. and Mana, G.} } @Article { CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018, subid = {812}, title = {Geodesy and metrology with a transportable optical clock}, journal = {Nature Physics}, year = {2018}, month = {2}, day = {12}, volume = {14}, number = {5}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {437-441}, keywords = {optical fiber, optical frequency transfer}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-017-0042-3}, stag_bib_extends_levelofaccess = {NA}, author = {Costanzo, G.A. and Zucco, M. and Barbieri, P. and Tampellini, A. and Bregolin, F. and Rauf, B. and Pizzocaro, M. and Thoumany, P. and Margolis, H.S. and Zampaolo, M. and Rolland, A. and Baynes, F.N. and Timmen, L. and Denker, H. and Voigt, C. and Lisdat, C. and H{\"a}fner, S. and Sterr, U. and Vogt, S. and Koller, S. and Grotti, J. and Clivati, C. and Levi, F. and Calonico, D.} } @Article { PeyresERHVPLMGDMC2018, title = {Measurement of absolute \(\gamma\)-ray emission probabilities in the decay of 235 U}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {2}, volume = {132}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {72-78}, keywords = {\(\gamma\)-ray spectrometry, 235U, 231Th, Decay data, \(\gamma\)-ray emission probabilities, NORM}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.10.049}, stag_bib_extends_levelofaccess = {NA}, author = {Peyres, V. and Eykens, R. and Richter, S. and Hult, M. and Van Ammel, R. and Pomm{\'e}, S. and Lutter, G. and Marouli, M. and Garc{\'i}a-Tora{\~n}o, E. and Dry{\'a}k, P. and Maz{\'a}nov{\'a}, M. and Carconi, P.} } @Article { HollandtMGRDv2018, title = {Traceability of the Network for Detection of the Mesospheric Change (NDMC) to radiometric standards via a Near Infrared Filter Radiometer}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {2}, volume = {972}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {012006}, keywords = {Traceability, radiometric standards}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/972/1/012006}, stag_bib_extends_levelofaccess = {NA}, author = {Hollandt, J. and Monte, C. and Gutschwager, B. and Reiniger, M. and Dekker, P. and van den Berg, S.} } @Proceedings { SaverioPavoneCCGV2018, subid = {849}, title = {Optimization of Highly Inclined Optical Sheet Illumination for Super-Resolution Microscopy}, journal = {Biophysical Journal}, year = {2018}, month = {2}, volume = {114}, number = {3}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {14a}, keywords = {Highly Inclined and Laminated Optical sheet (HILO) microscopy, dSTORM}, web_url = {https://www.biophysics.org/Portals/0/EasyDNNnews/Uploads/2131/2018\%20Program-WEB.pdf}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier BV}, event_place = {Moscone Center}, event_name = {Biophysical Society 62nd Annual Meeting}, event_date = {17-02-2018 to 21-02-2018}, language = {30}, ISSN = {0006-3495}, DOI = {10.1016/j.bpj.2017.11.121}, stag_bib_extends_levelofaccess = {NA}, author = {Vignolini, T. and Gardini, L. and Curcio, V. and Capitanio, M. and Saverio Pavone, F.} } @Article { NovotnyDSKV2018, subid = {987}, title = {Characterization of the Si(Li) detector for Monte Carlo calculations of beta spectra}, journal = {Journal of Instrumentation}, year = {2018}, month = {1}, day = {24}, volume = {13}, number = {01}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {P01021-P01021}, keywords = {Si(Li) detector, beta spectrometry, beta spectra, Monte Carlo simulations}, web_url = {https://arxiv.org/abs/1904.01294}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/13/01/P01021}, stag_bib_extends_levelofaccess = {NA}, author = {Novotny, P. and Dry{\'a}k, P. and Solc, J. and Kov{\'a}ř, P. and Vykydal, Z.} } @Article { VermesseSLDBROGDDPDSGCP2018, title = {Feasibility of using a dose-area product ratio as beam quality specifier for photon beams with small field sizes}, journal = {Physica Medica}, year = {2018}, month = {1}, volume = {45}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {106-116}, keywords = {Dose-area product, Beam quality, DAP ratio, Small photon beams}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2017.12.012}, stag_bib_extends_levelofaccess = {NA}, author = {Vermesse, D. and Sommier, L. and Le Roy, M. and Daures, J. and Bordy, J.M. and Rapp, B. and Ostrowsky, A. and Gouriou, J. and Dufreneix, S. and Delaunay, F. and Petrucci, A. and De Coste, V. and Silvi, L. and Guerra, A.S. and Caporali, C. and Pimpinella, M.} } @Article { vandenBergCVL2017, title = {High-accuracy long distance measurements with a mode-filtered frequency comb}, journal = {Optics Express}, year = {2017}, month = {12}, day = {14}, volume = {25}, number = {26}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {32570}, keywords = {Fabry-Perot, Interferometry, Metrology, Mode-locked lasers, Optical resonators, Laser range finder, Ultra fast lasers}, web_url = {https://www.osapublishing.org/DirectPDFAccess/294E3804-A5DD-C864-BA58B8635F309FB1_379535/oe-25-26-32570.pdf?da=1\&id=379535\&seq=0\&mobile=no}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.25.032570}, stag_bib_extends_levelofaccess = {NA}, author = {van den Berg, S. and Č{\'i}p, O. and Voigt, D. and Lešund{\'a}k, A.} } @Article { PivacPSDVFWKBHFDDB2017, subid = {544}, title = {Development and Synchrotron-Based Characterization of Al and Cr Nanostructures as Potential Calibration Samples for 3D Analytical Techniques}, journal = {physica status solidi (a)}, year = {2017}, month = {12}, volume = {215}, number = {6}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {1700866}, keywords = {SIMS, APT, GISAXS, 3D nanostructures, di-block copolymers}, misc2 = {EMPIR 2014: Industry}, publisher = {Wiley}, language = {30}, ISSN = {1862-6300}, DOI = {10.1002/pssa.201700866}, stag_bib_extends_levelofaccess = {NA}, author = {Dialameh, M. and Ferrarese Lupi, F. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Weimann, T. and Fleischmann, C. and Vandervorst, W. and Dubček, P. and Pivac, B. and Perego, M. and Seguini, G. and De Leo, N. and Boarino, L.} } @Article { EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017, subid = {602}, title = {First patients treated with a 1.5 T MRI-Linac: clinical proof of concept of a high-precision, high-field MRI guided radiotherapy treatment}, journal = {Physics in Medicine \& Biology}, year = {2017}, month = {11}, day = {14}, volume = {62}, number = {23}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {L41-L50}, keywords = {MRgRT, Radiotherapy, MRI}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aa9517}, stag_bib_extends_levelofaccess = {NA}, author = {Raaymakers, B W and J{\"u}rgenliemk-Schulz, I M and Bol, G H and Glitzner, M and Kotte, A N T J and van Asselen, B and de Boer, J C J and Bluemink, J J and Hackett, S L and Moerland, M A and Woodings, S J and Wolthaus, J W H and van Zijp, H M and Philippens, M E P and Tijssen, R and Kok, J G M and de Groot-van Breugel, E N and Kiekebosch, I and Meijers, L T C and Nomden, C N and Sikkes, G G and Doornaert, P A H and Eppinga, W S C and Kasperts, N and Kerkmeijer, L G W and Tersteeg, J H A and Brown, K J and Pais, B and Woodhead, P and Lagendijk, J J W} } @Article { SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017, title = {The MeteoMet2 project – Highlights and results}, journal = {Measurement Science and Technology}, year = {2017}, month = {11}, day = {13}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa99fc}, stag_bib_extends_levelofaccess = {NA}, author = {Šindel{\'a}rov{\'a}, L. and Sestan, D. and Salminen, J. and Sairanen, H. and Rosso, L. and del Rio, J. and Rasmussen, M.K. and Oguz Aytekin, S. and de Podesta, M. and Pavlasek, P. and Nogueras Cervera, M. and Nielsen, J. and Musacchio, C. and Miao, P. and Lanza, L.G. and Kowal, A. and Kalemci, M. and Hudoklin, D. and H{\"o}gstr{\"o}m, R. and Hernandez de la Villa, S. and Heinonen, M. and Groselj, D. and Gonzalez Calvo, A. and Georgin, E. and Gardiner, T. and Garc{\'i}a Izquierdo, C. and Garcia-Benad{\'i}, A. and Fernicola, V and Ebert, V. and Drnovsek, J. and Dobre, M. and Cuccaro, R. and Coppa, G. and Colli, M. and Chiodo, N. and Castrillo, A. and del Campo, D. and Brunet, M. and Bojkovski, J. and Beltramino, G. and Bell, S.A. and Beges, G. and Sanna, F. and Merlone, A. and Smorgon, D. and Sparasci, F. and Strnad, R. and Vold{\'a}n, M. and Underwood, R.J. and Mana, G.} } @Article { vanderVeenGUTBG2017, title = {Validation and sensitivity evaluation of the ID-GC-TOF-MS method for determination of PAHs in biogas}, journal = {Journal of Chemical Metrology}, year = {2017}, month = {11}, volume = {11}, number = {2}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {78-85}, keywords = {PAH; biogas; biomethane; thermal desorption; isotope dilution; GC-TOF-MS}, tags = {EnG}, web_url = {http://www.acgpubs.org/JCM/2017/Volume\%2011/Issue\%201/11-JCM_2017-11-01.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {ACG Publications}, language = {30}, ISSN = {1307-6183}, DOI = {10.25135/jcm.11.17.11.01}, stag_bib_extends_levelofaccess = {NA}, author = {van der Veen, A. and Goren, A.C. and Un, I. and Tarhan, T. and Bilsel, G. and Gokcen, T.} } @Article { QuinceyVTSPMMHWBWWSN2017, subid = {956}, title = {Mobility particle size spectrometers: Calibration procedures and measurement uncertainties}, journal = {Aerosol Science and Technology}, year = {2017}, month = {10}, day = {26}, volume = {52}, number = {2}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {146-164}, keywords = {aerosol metrology , mobility particle size spectrometers , calibration, measurement uncertainties}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, language = {30}, ISSN = {0278-6826, 1521-7388}, DOI = {10.1080/02786826.2017.1387229}, stag_bib_extends_levelofaccess = {NA}, author = {Wiedensohler, A. and Wiesner, A. and Weinhold, K. and Birmili, W. and Hermann, M. and Merkel, M. and M{\"u}ller, T. and Pfeifer, S. and Schmidt, A. and Tuch, T. and Velarde, F. and Quincey, P. and Seeger, S. and Nowak, A.} } @Article { LestremauLKvBMBCBRYAB2017, title = {Suitability of vessels and adsorbents for the short-term storage of biogas/biomethane for the determination of impurities – Siloxanes, sulfur compounds, halogenated hydrocarbons, BTEX}, journal = {Biomass and Bioenergy}, year = {2017}, month = {10}, volume = {105}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {127-135}, keywords = {BiogasCompositionImpuritiesVesselsSampling}, tags = {EnG}, web_url = {http://www.sciencedirect.com/science/article/pii/S0961953417302118}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, DOI = {10.1016/j.biombioe.2017.06.025}, stag_bib_extends_levelofaccess = {NA}, author = {Lestremau, F. and Li, J. and Krom, I. and van der Veen, A.M.H. and Brewer, B. and Murugan, A. and Bartlett, S. and Culleton, L. and B{\"u}ker, O. and Rosell, L. and Yaghooby, H. and Arrhenius, K. and Beranek, J.} } @Article { WehmannLSTVASFNLZSHW2017, title = {Study of 3D-growth conditions for selective area MOVPE of high aspect ratio GaN fins with non-polar vertical sidewalls}, journal = {Journal of Crystal Growth}, year = {2017}, month = {10}, volume = {476}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {90-98}, keywords = {Crystal morphology, Metalorganic vapor phase epitaxy, Gallium compounds, Nitrides, Light emitting diodes}, web_url = {http://www.sciencedirect.com/science/article/pii/S0022024817305146}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0022-0248}, DOI = {10.1016/j.jcrysgro.2017.08.021}, stag_bib_extends_levelofaccess = {NA}, author = {Wehmann, H-H and Lugauer, H-J and Stra{\ss}burg, M. and Trampert, A. and Varghese, T. and Avramescu, A. and Schimpke, T. and F{\"u}ndling, S. and Nicolai, L. and Ledig, J. and Zhou, H. and Steib, F. and Hartmann, J. and Waag, A} } @Article { FailleauHHPSRBZARGVSSKSPLG2017, title = {Metrology for decommissioning nuclear facilities: Partial outcomes of joint research project within the European Metrology Research Program}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Decommissioning, Sample preparation, Metrology}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.032}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Hay, B. and Holm, P. and Per{\"a}j{\"a}rvi, K. and Sand, J. and Rogiers, B. and Boden, S. and Zapata-Garc{\'i}a, D. and Arnold, D. and Russell, B. and Garcia Miranda, M. and Van Ammel, R. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Plumeri, S. and Laurent Beck, Y. and Grisa, T.} } @Article { BogucarskaPdJASSSKSTv2017, title = {New high-throughput measurement systems for radioactive wastes segregation and free release}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {nuclear decommissioning, radioactive waste, free release, clearance level}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.09.043}, stag_bib_extends_levelofaccess = {NA}, author = {Bogucarska, T. and Pedersen, B. and De Felice, P. and Jerome, S. and Arnold, D. and Skala, L. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Tzika, F. and Van Ammel, R.} } @Article { RotellaCMMVIDLNRSN2017, title = {Elemental depth profiling in transparent conducting oxide thin film by X-ray reflectivity and grazing incidence X-ray fluorescence combined analysis}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2017}, month = {9}, volume = {135}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {22-28}, keywords = {Combined >XRR-GIXRF, Depth profiling, thin films, TCO}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2017.06.011}, stag_bib_extends_levelofaccess = {NA}, author = {Rotella, H. and Caby, B. and M{\'e}nesguen, Y. and Mazel, Y. and Valla, A. and Ingerle, D. and Detlefs, B. and L{\'e}py, M.-C. and Novikova, A. and Rodriguez, G. and Streli, C. and Nolot, E.} } @Article { ZhaovH2017, subid = {1189}, title = {Mitigating voltage lead errors of an AC Josephson voltage standard by impedance matching}, journal = {Measurement Science and Technology}, year = {2017}, month = {8}, day = {16}, volume = {28}, number = {9}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {095004}, keywords = {AC Josephson voltage standard, impedance matching, simulation, error sources,uncertainty}, web_url = {https://zenodo.org/record/3265687\#.XWZRsuhKgdW}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa7aba}, stag_bib_extends_levelofaccess = {NA}, author = {Zhao, D. and van den Brom, H.E. and Houtzager, E.} } @Article { DegiovanniAPRLVTGBCVG2017, subid = {334}, title = {Determining the quantum expectation value by measuring a single photon}, journal = {Nature Physics}, year = {2017}, month = {8}, day = {14}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {4}, keywords = {Protective Measurements, Weak Measurements}, web_url = {https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf;}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/nphys4223}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Rebufello, E. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { MarouliVPL2017, title = {Photon emission intensities in the decay of U-235}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, volume = {126}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {150-153}, keywords = {U-235, Th-231, Photon emission intensities, NORM}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.12.045}, stag_bib_extends_levelofaccess = {NA}, author = {Marouli, M. and Van Ammel, R. and Pierre, S. and L{\'e}py, M.C.} } @Article { VandervorstMAFDKBV2017, subid = {565}, title = {Atom probe tomography analysis of SiGe fins embedded in SiO 2 : Facts and artefacts}, journal = {Ultramicroscopy}, year = {2017}, month = {8}, volume = {179}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {100-107}, keywords = {Atom probe tomography, Tip shape, FinFET, Local magnification, Trajectory overlaps}, web_url = {https://lirias2repo.kuleuven.be/rest/bitstreams/515063/retrieve}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2017.04.006}, stag_bib_extends_levelofaccess = {NA}, author = {Melkonyan, D. and Fleischmann, C. and Arnoldi, L. and Demeulemeester, J. and Kumar, A. and Bogdanowicz, J. and Vurpillot, F. and Vandervorst, W.} } @Article { LodewyckTBEBV2017, subid = {400}, title = {A noise-immune cavity-assisted non-destructive detection for an optical lattice clock in the quantum regime}, journal = {New Journal of Physics}, year = {2017}, month = {8}, volume = {19}, number = {8}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {083002}, keywords = {optical clock, frequency stability, optical lattice clock, non-destructive detection, spin squeezing}, web_url = {http://iopscience.iop.org/1367-2630/19/8/083002}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/aa7c84}, stag_bib_extends_levelofaccess = {NA}, author = {Lodewyck, J. and Targat, R.L. and Bilicki, S. and Eismann, U. and Bookjans, E. and Vallet, G.} } @Article { KazakovaVGPW2017, subid = {253}, title = {Switchable bi-stable multilayer magnetic probes for imaging of soft magnetic structures}, journal = {Ultramicroscopy}, year = {2017}, month = {8}, volume = {179}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {41-46}, keywords = {MFM, Scanning probe microscopy, Magnetic probes}, web_url = {https://pure.royalholloway.ac.uk/portal/files/28310834/For_ResearchGate_Switchable_bi_stable_ML_probes.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2017.03.032}, stag_bib_extends_levelofaccess = {NA}, author = {Wren, T. and Puttock, R. and Gribkov, B. and Vdovichev, S. and Kazakova, O.} } @Article { NeuVSMSRGCPK2017, subid = {581}, title = {Calibration of multi-layered probes with low/high magnetic moments}, journal = {Scientific Reports}, year = {2017}, month = {8}, volume = {7}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {7224}, keywords = {Magnetic straz field, Magnetic force microscopy, multi-layered probe, Hall sensor.}, web_url = {https://www.nature.com/articles/s41598-017-07327-0}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-07327-0}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, V. and Corte-Le{\'o}n, H. and Gribkov, B. and Rodriguez, L.A. and Snoeck, E. and Manzin, A. and Simonetto, E. and Vock, S. and Neu, V. and Kazakova, O.} } @Article { KeightleyBPVPBGW2017, title = {Compact radioactive aerosol monitoring device for early warning networks}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, volume = {126}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {219-224}, keywords = {Radiological emergency, Preparedness, MetroERM, Early warning network, Aerosol sampling device, CeBr3 scintillation detector, High volume air sampler, Real time measurements}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.12.036}, stag_bib_extends_levelofaccess = {NA}, author = {Keightley, L. and Bell, S.J. and Ponikvar, D. and Vencelj, M. and Petrovič, T. and Brodnik, D. and Glavič-Cindro, D. and Woods, S.} } @Article { MantynenVKMI2017, title = {Method for estimating effects of unknown correlations in spectral irradiance data on uncertainties of spectrally integrated colorimetric quantities}, journal = {Metrologia}, year = {2017}, month = {7}, day = {18}, volume = {54}, number = {4}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {524-534}, keywords = {uncertainty, color temperature, color coordinates, Monte Carlo, spectral irradiance}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa7b39/meta}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa7b39}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"a}ntynen, H. and Vaskuri, A and K{\"a}rh{\"a}, P. and Mikkonen, N. and Ikonen, E.} } @Article { GarciaToranoVPMCP2017, title = {Direct measurement of alpha emission probabilities in the decay of 226 Ra}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {7}, volume = {125}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {196-202}, keywords = {Alpha spectrometry, 226Ra, Decay data, Alpha-particle emission probabilities}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.04.029}, stag_bib_extends_levelofaccess = {NA}, author = {Garc{\'i}a-Tora{\~n}o, E. and Van Ammel, R. and Pomm{\'e}, S. and Marouli, M. and Crespo, T. and Pierre, S.} } @Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017, subid = {477}, title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fibre, network, clock, time, dissemination, service}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/FCS.2017.8089004}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Dostal, J. and Radil, J. and Smotlacha, V. and Velc, R. and Vojtech, J. and Campanella, M. and Calonico, D. and Clivati, C. and Levi, F. and Č{\'i}p, O. and Rerucha, S. and Holzwarth, R. and Lessing, M. and Camargo, F. and Desruelle, B. and Lautier-Gaud, J. and English, E.L. and Kronj{\"a}ger, J. and Whibberley, P. and Pottie, P.E. and Tavares, R. and Tuckey, P. and John, F. and Snajder, M. and Stefl, J. and Nogaś, P. and Urbaniak, R. and Binczewski, A. and Bogacki, W. and Turza, K. and Grosche, G. and Schnatz, H. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.} } @Article { HoutzagerBKv2017, title = {AC–DC Calibrations With a Pulse-Driven AC Josephson Voltage Standard Operated in a Small Cryostat}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {6}, volume = {66}, number = {6}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1391-1396}, keywords = {AC–DC difference, Josephson voltage standard, measurement standards, measurement techniques, voltagemeasurement.}, web_url = {http://ieeexplore.ieee.org/document/7898429/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2662381}, stag_bib_extends_levelofaccess = {NA}, author = {Houtzager, E. and Bauer, S. and Kieler, O.F.O. and van den Brom, H.E.} } @Article { HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017, subid = {141}, title = {Test of Special Relativity Using a Fiber Network of Optical Clocks}, journal = {Physical Review Letters}, year = {2017}, month = {6}, volume = {118}, number = {22}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, web_url = {https://arxiv.org/abs/1703.04426}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.118.221102}, stag_bib_extends_levelofaccess = {NA}, author = {Delva, P. and Lodewyck, J. and Bilicki, S. and Bookjans, E. and Vallet, G. and Le Targat, R. and Pottie, P.-E. and Guerlin, C. and Meynadier, F. and Le Poncin-Lafitte, C. and Lopez, O. and Amy-Klein, A. and Lee, W.-K. and Quintin, N. and Lisdat, C. and Al-Masoudi, A. and D{\"o}rscher, S. and Grebing, C. and Grosche, G. and Kuhl, A. and Raupach, S. and Sterr, U. and Hill, I. R. and Hobson, R. and Bowden, W. and Kronj{\"a}ger, J. and Marra, G. and Rolland, A. and Baynes, F. N. and Margolis, H. S. and Gill, P.} } @Article { BoothGOVNNFDT2017, title = {Single-Ended Differential Protection in MTDC Networks Using Optical Sensors}, journal = {IEEE Transactions on Power Delivery}, year = {2017}, month = {6}, volume = {32}, number = {3}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {1605-1615}, keywords = {HVDC protection, multi-terminal direct current, modular multi-level converters, optical sensors.}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-8977, 1937-4208}, DOI = {10.1109/TPWRD.2016.2645231}, stag_bib_extends_levelofaccess = {NA}, author = {Booth, C.D. and Gordon, N. and Orr, P. and Vozikis, D. and Niewczas, P. and Nelson, J. and Fusiek, G. and Dysko, A. and Tzelepis, D.} } @Article { XuCJSCPVHSC2017, subid = {574}, title = {Temperature dependence mitigation in stationary Fourier-transform on-chip spectrometers}, journal = {Optics Letters}, year = {2017}, month = {6}, volume = {42}, number = {11}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {2239}, keywords = {temperature, silicon on insulator, microspectrometer}, web_url = {https://digital.csic.es/handle/10261/164048}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.42.002239}, stag_bib_extends_levelofaccess = {NA}, author = {Herrero-Bermello, A. and Velasco, A.V. and Podmore, H. and Cheben, P. and Schmid, J.H. and Janz, S. and Calvo, M.L. and Xu, D.X and Scott, A. and Corredera, P.} } @Article { JehlBKCVSHLBKC2017, subid = {369}, title = {Design and Operation of CMOS-Compatible Electron Pumps Fabricated With Optical Lithography}, journal = {IEEE Electron Device Letters}, year = {2017}, month = {4}, volume = {38}, number = {4}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {414-417}, keywords = {Quantum dots, Quantum effect semiconductor devices, Quantization, Current control}, web_url = {https://arxiv.org/abs/1612.09547}, web_url2 = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0741-3106, 1558-0563}, DOI = {10.1109/LED.2017.2670680}, stag_bib_extends_levelofaccess = {NA}, author = {Clapera, P. and Klochan, J. and Lavieville, R. and Barraud, S. and Hutin, L. and Sanquer, M. and Vinet, M. and Cinins, A. and Barinovs, G. and Kashcheyevs, V. and Jehl, X.} } @Article { CarmeleRBSSSGSSvTHKR2017, subid = {234}, title = {A bright triggered twin-photon source in the solid state}, journal = {Nature Communications}, year = {2017}, month = {4}, volume = {8}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {14870}, keywords = {Quantum dots, Quantum optics, Single photons and quantum effects .}, web_url = {https://www.nature.com/articles/ncomms14870}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms14870}, stag_bib_extends_levelofaccess = {NA}, author = {Heindel, T. and Thoma, A. and von Helversen, M. and Schmidt, M. and Schlehahn, A. and Gschrey, M. and Schnauber, P. and Schulze, J. -H. and Strittmatter, A. and Beyer, J. and Rodt, S. and Carmele, A. and Knorr, A. and Reitzenstein, S.} } @Article { VelascoVSVCSP2017, subid = {573}, title = {Demonstration of a compressive-sensing Fourier-transform on-chip spectrometer}, journal = {Optics Letters}, year = {2017}, month = {3}, day = {31}, volume = {42}, number = {7}, number2 = {waveguides and applications}, pages = {1440}, keywords = {Fourier transform, silicon on insulator, compressive sensing}, web_url = {https://digital.csic.es/handle/10261/163371}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.42.001440}, stag_bib_extends_levelofaccess = {NA}, author = {Podmore, H. and Scott, A. and Cheben, P. and Velasco, A.V. and Velasco, A.V. and Schmid, J.H. and Vachon, M.} } @Article { GotzingerVPCLSMIBS2017, title = {Experimental demonstration of a predictable single photon source with variable photon flux}, journal = {Metrologia}, year = {2017}, month = {3}, day = {21}, volume = {54}, number = {2}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {218-223}, keywords = {single photon sources, single photon metrology, silicon vacancy center, low optical flux detector, photon on demand}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa5ba2}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}tzinger, S. and Vaigu, A. and Porrovecchio, G. and Chu, X.L. and Lindner, S. and Smid, M. and Manninen, A. and Ikonen, E. and Becher, C. and Sandoghdar, V.} } @Article { MottonenVPTGKL2017, title = {Microwave Admittance of Gold-Palladium Nanowires with Proximity-Induced Superconductivity}, journal = {Advanced Electronic Materials}, year = {2017}, month = {3}, volume = {3}, number = {6}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {1600227}, keywords = {proximity Josephson junction, microwave admittance}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/aelm.201600227/abstract}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {2199-160X}, DOI = {10.1002/aelm.201600227}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"o}tt{\"o}nen, M. and Virtanen, P. and Partanen, M. and Tan, K.Y. and Govenius, J. and Kokkoniemi, R. and Lake, R.E.} } @Proceedings { GrobnerVKEI2017, title = {Monte Carlo analysis of uncertainty of total atmospheric ozone derived from measured spectra}, journal = {AIP Conference Proceedings}, year = {2017}, month = {2}, day = {22}, volume = {1810}, number = {1}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {110005}, keywords = {Monte Carlo, TOC, Ozone, Uncertainty, Spectral irradiance}, web_url = {http://aip.scitation.org/toc/apc/1810/1?size=all\&expanded=1810}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {American Institute of Physics}, event_place = {The University of Auckland}, event_name = {International Radiation Symposium}, event_date = {16-04-2016 to 22-04-2016}, language = {30}, ISBN = {978-0-7354-1478-5}, ISSN = {1551-7616}, DOI = {10.1063/1.4975567}, stag_bib_extends_levelofaccess = {NA}, author = {Gr{\"o}bner, J. and Vaskuri, A. and K{\"a}rh{\"a}, P. and Egli, L. and Ikonen, E.} } @Article { VilloingMGB2017, subid = {92}, title = {Internal dosimetry with the Monte Carlo code GATE: validation using the ICRP/ICRU female reference computational model}, journal = {Physics in Medicine and Biology}, year = {2017}, month = {2}, volume = {62}, number = {5}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {1885-1904}, keywords = {Monte Carlo modelling, internal dosimetry, GATE, MCNPX, voxelized models}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/62/5/1885}, stag_bib_extends_levelofaccess = {NA}, author = {Villoing, D and Marcatili, S and Garcia, M-P and Bardi{\`e}s, M} } @Article { PavsiDBFVJSeHRKMAAM2017, subid = {2144}, title = {Inter-laboratory assessment of different digital PCR platforms for quantification of human cytomegalovirus DNA}, journal = {Analytical and Bioanalytical Chemistry}, year = {2017}, month = {1}, day = {26}, volume = {409}, number = {10}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {2601-2614}, keywords = {Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-017-0206-0}, stag_bib_extends_levelofaccess = {NA}, author = {Pavšič, J. and Devonshire, A. and Blejec, A. and Foy, C.A. and Van Heuverswyn, F. and Jones, G.M. and Schimmel, H. and Zel, J. and Huggett, J.F. and Redshaw, N. and Karczmarczyk, M. and Mozioglu, E. and Aky{\"u}rek, S. and Akg{\"o}z, M. and Milavec, M.} } @Proceedings { PokatilovPNETLICDYNPVTC2017_2, subid = {1152}, title = {EMPIR project TracePQM: Traceability routes for electrical power quality measurements}, journal = {18th International Congress of Metrology}, year = {2017}, number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements}, pages = {8}, keywords = {power quality; metrology; power; traceability; measurement}, misc2 = {EMPIR 2015: Research Potential}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {18th International Congress of Metrology}, event_date = {19-09-2017 to 21-09-2017}, language = {30}, DOI = {10.1051/metrology/201704001}, stag_bib_extends_levelofaccess = {NA}, author = {Nov{\'a}kov{\'a} Zachovalov{\'a}, V. and Yovcheva, A. and Diaz de Aguilar, J. and Caballero Santos, R. and Ilić, D. and Lončarević, J. and Trinchera, B. and Ellingsberg, K. and Ndilimabaka, H. and Philominraj, A. and Pokatilov, A. and Power, O. and Voljc, B. and Tarasso, V. and \c{C}aycı, H.} } @Article { VavassoriAMCNCPK2017, subid = {255}, title = {V-shaped domain wall probes for calibrated magnetic force microscopy}, journal = {IEEE Transactions on Magnetics}, year = {2017}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {1-1}, keywords = {Probes, Magnetic domains, Magnetic resonance imaging, Magnetic field measurement, Perpendicular magnetic anisotropy, Saturation magnetization}, web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/vshaped-domain-wall-probes-for-calibrated-magnetic-force-microscopy(9c2d50b1-9b1a-4aae-9b39-ca8c1864daf3).html}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9464, 1941-0069}, DOI = {10.1109/TMAG.2017.2694324}, stag_bib_extends_levelofaccess = {NA}, author = {Puttock, R. and Corte-Le{\'o}n, H. and Neu, V. and Cox, D. and Manzin, A. and Antonov, V. and Vavassori, P. and Kazakova, O.} } @Proceedings { VenceljPGB2017, title = {MetroERM - Metrology for Radiological Early Warning Networks in Europe}, journal = {Proceedings of the eleventh symposium of the Croatian radiation protection association}, year = {2017}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {175-181}, keywords = {MetroERM, dose rate equivalent rate, radioactivity concentrations in air and ground}, misc2 = {EMRP A169: Call 2013 Environment II}, event_place = {Osijek, Croatia}, event_name = {11th Symposium Of The Croatian Radiation Protection Association}, event_date = {05-04-2017 to 07-04-2017}, language = {30}, ISSN = {1849 - 5060}, stag_bib_extends_levelofaccess = {NA}, author = {Vencelj, M. and Petrovič, T. and Glavič - Cindro, D. and Brodnik, D.} } @Article { BojkovskiOKMSISFZSSJoHHPV2017, subid = {1095}, title = {Expansion of European research capabilities in humidity measurement}, journal = {18th International Congress of Metrology}, year = {2017}, number = {2017 18th}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {4/06006}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html}, misc2 = {EMPIR 2015: Research Potential}, publisher = {EDP Sciences}, language = {30}, DOI = {10.1051/metrology/201706006}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Sestan, D. and Zvizdić, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Proceedings { , title = {Influencia del Tama{\~n}o de Pigmento en la Distancia de Detecci{\'o}n del Sparkle}, journal = {Resumen de la Contribuciones. XI Reuni{\'o}n Nacional de {\'O}ptica}, year = {2016}, month = {12}, day = {10}, volume = {1}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {168}, keywords = {size pigment, sparkle, visual detection}, web_url = {-}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Universidad de Salamanca}, address = {Salamanca}, event_place = {Salamanca, Spain}, event_name = {XI Reuni{\'o}n Nacional de {\'O}ptica}, event_date = {01-09-2015 to 03-09-2015}, language = {112}, ISBN = {978-84-608-4609-3}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {G{\'o}mez, O. and Perales, E. and Chorro, E. and Viqueira, V. and Mart{\'i}nez-Verd{\'u}, F.M. and Ferrero, A. and Campos, J.} } @Proceedings { , title = {Evaluaci{\'o}n de la f{\'o}rmula de diferencia de color AUDI2000: an{\'a}lisis del croma}, journal = {Res{\'u}menes de las contribuciones. XI Reuni{\'o}n Nacional de {\'O}ptica}, year = {2016}, month = {12}, day = {10}, volume = {1}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {171}, keywords = {goniochromatism, AUDI2000 color difference formula, STRESS}, web_url = {-}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Universidad de Salamanca}, address = {Salamnaca}, event_place = {Salamanca}, event_name = {XI Reuni{\'o}n Nacional de {\'O}ptica}, event_date = {01/09/2015 to 03/09/2015}, language = {112}, ISBN = {978-84-608-4609-3}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Perales, E. and Chorro, E. and G{\'o}mez, O. and Viqueira, V. and Mart{\'i}nez-Verd{\'u}, F.M. and G{\'o}mez-Robledo, L. and Melgosa, M.} } @Proceedings { , title = {Comparaci{\'o}n de las propiedades fotom{\'e}tricas y colorim{\'e}tricas de diferentes cabinas de iluminaci{\'o}n}, journal = {Res{\'u}menes de las contribuciones. XI Reuni{\'o}n Nacional de {\'O}ptica}, year = {2016}, month = {12}, day = {10}, volume = {1}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {170}, keywords = {lighting booths, goniochromatism, color rendering}, web_url = {-}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Universidad de Salamanca}, address = {Salamanca}, event_place = {Salamanca, Spain}, event_name = {XI Reuni{\'o}n Nacional de {\'O}ptica}, event_date = {01-09-2015 to 03-09-2015}, language = {112}, ISBN = {978-84-608-4609-3}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Perales, E. and Chorro, E. and Viqueira, V. and Mart{\'i}nez-Verd{\'u}, F.M.} } @Techreport { HultMSMLAVP2016, title = {Metrodecom: JRC-Geel Radionuclide Metrology Sector contribution to WP5 Task 2: Reference materials and standard sources for radiochemical analysis}, journal = {JRC Technical report}, year = {2016}, month = {12}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Reference materials, Radiochemical analysis, standard sources}, web_url = {http://publications.jrc.ec.europa.eu/repository/handle/JRC103355}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {European commission Publication office}, address = {Luxemburg}, language = {30}, ISBN = {978-92-79-63506-9}, ISSN = {1831-9424}, DOI = {10.2789/949534}, stag_bib_extends_levelofaccess = {NA}, author = {Hult, M. and Marissens, G. and Stroh, H. and Marouli, M. and Lutter, G. and Altzitzoglou, T. and Van Ammel, R. and Pomm{\'e}, S.} } @Article { VandervorstDPFLTHVBTFCS2016, subid = {158}, title = {Understanding Physico-Chemical Aspects in the Depth Profiling of Polymer:Fullerene Layers}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {12}, volume = {120}, number = {49}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {28074-28082}, keywords = {ToF-SIMS, GCIB, Ar cluster, quantification, depth profiling, organics, solar cells, polymer, fullerenes}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b09911}, stag_bib_extends_levelofaccess = {NA}, author = {Surana, S. and Conard, T. and Fleischmann, C. and Tait, J.G. and Bastos, J.P. and Voroshazi, E. and Havelund, R. and Turbiez, M. and Louette, P. and Felten, A. and Poleunis, C. and Delcorte, A. and Vandervorst, W.} } @Techreport { LutterSV2016, title = {Preparation of 1100 60Co calibration sources}, journal = {JRC Technical reports}, year = {2016}, month = {11}, day = {18}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Calibration, Decommissioning, reference standards}, web_url = {http://publications.jrc.ec.europa.eu/repository/handle/JRC103167}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {European commission Publication office}, language = {30}, ISBN = {978-92-79-62200-7}, ISSN = {1831-9424}, DOI = {10.2789/787831}, stag_bib_extends_levelofaccess = {NA}, author = {Lutter, G. and Sobiech-Matura, K. and Van Ammel, R.} } @Article { , title = {Near-unity quantum efficiency of broadband black silicon photodiodes with an induced junction}, journal = {Nature Photonics}, year = {2016}, month = {11}, day = {14}, volume = {-}, number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry}, keywords = {Imaging and sensing, Nanowires, Optical metrology, Optical sensors, X-rays}, web_url = {http://www.nature.com/nphoton/journal/vaop/ncurrent/full/nphoton.2016.226.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Nature}, address = {-}, language = {30}, DOI = {10.1038/nphoton.2016.226}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Juntunen, M.A. and Heinonen, J. and V{\"a}h{\"a}nissi, V. and Repo, P. and Valluru, D. and Savin, H.} } @Article { , title = {Creation and characterization of He-related color centers in diamond}, journal = {Journal of Luminescence}, year = {2016}, month = {11}, day = {1}, volume = {179}, number = {November 2016}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {59-63}, keywords = {Diamond; Color center; Defect; Ion implantation; Photoluminescence}, web_url = {http://www.journals.elsevier.com/journal-of-luminescence}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0022-2313}, DOI = {10.1016/j.jlumin.2016.06.039}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-1}, author = {J. Forneris, J. and A. Tengattini, A. and S. Ditalia Tchernij, S. and F. Picollo, F. and A. Battiato, A. and P. Traina, P. and I.P. Degiovanni, I.P. and E. Moreva, E. and G. Brida, G. and V. Grilj, V. and N. Skukan, N. and M. Jakšić, M. and M. Genovese, M. and P. Olivero, P.} } @Article { YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016, subid = {321}, title = {Versailles Project on Advanced Materials and Standards Interlaboratory Study on Measuring the Thickness and Chemistry of Nanoparticle Coatings Using XPS and LEIS}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {10}, day = {27}, volume = {120}, number = {42}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {24070-24079}, keywords = {VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory}, web_url = {https://spiral.imperial.ac.uk/handle/10044/1/40824}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b06713}, stag_bib_extends_levelofaccess = {NA}, author = {Belsey, N.A. and Cant, D. and Cant, D.J.H. and Minelli, C. and Araujo, J.R. and Bock, B. and Br{\"u}ner, P. and Castner, D.G. and Ceccone, G. and Counsell, J.D.P. and Dietrich, P.M. and Engelhard, M.H. and Fearn, S. and Galhardo, C.E. and Kalbe, H. and Kim, J.W. and Lartundo-Rojas, L. and Luftman, H.S. and Nunney, T.S. and Pseiner, J. and Smith, E.F. and Spampinato, V. and Sturm, J.M. and Thomas, A.G. and Treacy, J.P.W. and Veith, L. and Wagstaffe, M. and Wang, H. and Wang, M. and Wang, Y.C. and Werner, W. and Yang, L.} } @Article { VilllaLCDBGLAPTZG2016, subid = {231}, title = {Measuring Incompatible Observables by Exploiting Sequential Weak Values}, journal = {Physical Review Letters}, year = {2016}, month = {10}, day = {20}, volume = {117}, number = {17}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {170402}, keywords = {Weak Measurements, Optical tests of quantum theory, Weak Values}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.170402}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.117.170402}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Levi, M. P. and Gramegna, M. and Brida, G. and Degiovanni, I. P. and Cohen, E. and Lussana, R. and Villa, F. and Tosi, A. and Zappa, F. and Genovese, M.} } @Article { KhoramshahiRVKHHNN2016, title = {Close-range environmental remote sensing with 3D hyperspectral technologies}, journal = {Earth Resources and Environmental Remote Sensing/GIS Applications VII}, year = {2016}, month = {10}, day = {18}, volume = {10005}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, keywords = {Remote sensing, Unmanned aerial vehicles, Clouds, Radiative energy transfer, Modeling, RGB color model, Radiation, Hyperspectral imaging, LIDAR, Anisotropy}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2571414\&resultClick=1}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {SPIE}, language = {30}, DOI = {10.1117/12.2240936}, stag_bib_extends_levelofaccess = {NA}, author = {Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Kaasalainen, S. and Hakala, T. and Honkavaara, E. and Nevalainen, O. and N{\"a}si, R.} } @Article { RietveldvJJNCAC2016, title = {Measurement of the harmonic impedance of the aggregated distribution network}, journal = {2016 17th International Conference on Harmonics and Quality of Power (ICHQP)}, year = {2016}, month = {10}, number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics}, keywords = {Phasor measurement units, Power Quality, Power system harmonics, Impedance measurement, Harmonic impedance, Load modeling}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, DOI = {10.1109/ICHQP.2016.7783374}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, G. and van den Brom, H.E. and Jongepier, A. and Jin, W. and Ni, F. and Cuk, V. and Acanski, M. and Cobben, J.F.G.} } @Article { BrabanCEFBLPHTPMPVWvTNP2016, title = {A metrological approach to improve accuracy and reliability of ammonia measurements in ambient air}, journal = {Measurement Science and Technology}, year = {2016}, month = {10}, volume = {27}, number = {11}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {115012}, keywords = {ammonia in ambient air, traceability, reference gas standards, optical transfer standard, validation and testing infrastructure}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, address = {Bristol, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/27/11/115012}, stag_bib_extends_levelofaccess = {NA}, author = {Braban, Christine F and Cassidy, Nathan and Ebert, Volker and Ferracci, Valerio and Balslev-Harder, David and Leuenberger, Daiana and Pascale, C{\'e}line and Hieta, Tuomas and Tiebe, Carlo and Peltola, Jari and Martin, Nicholas A and Persijn, Stefan and Vaittinen, Olavi and Wirtz, Klaus and van Wijk, Janneke and Twigg, Marsailidh M and Niederhauser, Bernhard and Pog{\'a}ny, Andrea} } @Article { DeLeoCVSMTFB2016, subid = {161}, title = {4-Nitrobenzene Grafted in Porous Silicon: Application to Optical Lithography}, journal = {Nanoscale Research Letters}, year = {2016}, month = {9}, day = {29}, volume = {11}, number = {436}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {1-10}, keywords = {Porous silicon, Optical lithography, 4-Nitrobenzenediazonium, grafting, Improved chemical resistance}, web_url = {https://nanoscalereslett.springeropen.com/articles/10.1186/s11671-016-1654-8}, misc2 = {EMPIR 2014: Industry}, publisher = {SpringerOpen}, address = {London}, language = {30}, ISSN = {1556-276X}, DOI = {10.1186/s11671-016-1654-8}, stag_bib_extends_levelofaccess = {NA}, author = {Tiddia, M.V. and Mula, G. and Sechi, E. and Vacca, A. and Cara, E. and De Leo, N. and Fretto, M. and Boarino, L.} } @Proceedings { , title = {Uncertainty Analysis of Aggregated Smart Meter Data for State Estimation}, journal = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2016}, month = {9}, day = {28}, number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics}, pages = {13-18}, keywords = {Smart meter; state estimation; distribution system; measurement uncertainty; data aggregation}, tags = {SEG}, web_url = {http://ieeexplore.ieee.org/document/7602805/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, address = {Piscataway, NJ 08855-1331 USA}, event_place = {Aachen, Germany}, event_name = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {28-30 September 2016}, language = {30}, ISBN = {978-1-5090-2373-8}, DOI = {10.1109/AMPS.2016.7602805}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ni, F. and Nguyen, P.H. and Cobben, J.F.G. and van den Brom, H.E. and Zhao, D.} } @Article { , title = {Color characterization of coatings with diffraction pigments}, journal = {Journal of the Optical Society of America A}, year = {2016}, month = {9}, day = {14}, volume = {33}, number = {10}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1978-1988}, keywords = {BSDF, BRDF, BTDF, Diffraction, Radiometry, Scattering measurements.}, web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-33-10-1978}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {OSA}, address = {Washington, DC, USA}, language = {30}, ISSN = {1084-7529 (print), 1520-8532 (online)}, DOI = {10.1364/JOSAA.33.001978}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, A and Bernad, B and Campos, J and Perales, E and Vel{\'a}zquez, J L and Mart{\'i}nez-Verd{\'u}, F M} } @Article { , title = {Numerical modeling of the primary source in a hemi-anechoic room}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, Free Field, Directivity}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {German Acoustical Society (Deutsche Gesellschaft f{\"u}r Akustik, DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arina, R. and V{\"o}lkel, K.} } @Article { , title = {Influence of Directivity and spetral shape on the measured sound power level}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, directivity, spectral shape}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {V{\"o}lkel, K. and Wittstock, V.} } @Proceedings { , title = {Design of delta-sigma feedback loop for quantum voltage digitizer}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, month = {8}, day = {11}, volume = {1}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Delta-sigma modulation, Josephson junctions, measurement, metrology, voltage measurement.}, web_url = {http://ieeexplore.ieee.org/document/7540457/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements 2016, (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540457}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540457/}, author = {Ireland, J and Cryer, A and Williams, JM and Houtzager, E and Hornecker, R and van den Brom, HE} } @Article { , title = {Visual and instrumental correlation of sparkle by the magnitude estimation method}, journal = {Applied Optics}, year = {2016}, month = {8}, day = {9}, volume = {55}, number = {23}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {6458-6463}, keywords = {sparkle, detection, perception psychology, psycophysics, industrial inspection,}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-23-6458}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Optical Society of America (OSA)}, address = {Washington, DC}, language = {30}, ISSN = {2155-3165}, DOI = {10.1364/AO.55.006458}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {G{\'o}mez, O and Perales, E and Chorro, E and Viqueira, V and Mart{\'i}nez-Verd{\'u}, FM} } @Article { SvecSSRPNMLKJGFFDMAHBTTVW2016_2, title = {60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {8}, volume = {114}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {167-172}, keywords = {Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.05.014}, stag_bib_extends_levelofaccess = {NA}, author = {Svec, A. and Solc, J. and Silva, L. and Reis, M. and Peyres, V. and Nečemer, M. and Moser, H. and Luca, A. and Klemola, S. and Javornik, A. and Garc{\'i}a-Tora{\~n}o, E. and Ferreux, L.. and Fazio, A. and Dry{\'a}k, P. and Marroyo, B.C. and Arnold, D. and Hult, M. and Burda, O. and Tzika, F. and Tyminski, Z. and Vodenik, B. and W{\"a}tjen, U.} } @Article { , title = {On-Site Radiated Emissions Measurements in Semi-Reverberant Environments}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2016}, month = {8}, volume = {Not known yet}, number = {Not known yet}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-8}, keywords = {radiated emissions; in-situ testing; reverberation chambers;}, web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=15}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {not known yet}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogt-Ardatjew, R.A. and Lundgren, U. and Romero, S.F.} } @Article { , title = {Protection Against Common Mode Currents on Cables Exposed to HIRF or NEMP}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2016}, month = {8}, volume = {Submitted and accepted for publication in a future issue of this journal}, number = {Not known yet}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-9}, keywords = {Electromagnetic compatibility, electromagnetic coupling, electromagnetic fields, marine electrical equipment}, web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=16}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {not known yet}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {van Leersum, B.J.A.M. and van der Ven, C.C.J. and Bergsma, J.G. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Long-term Stability of Al2O3 Passivated Black Silicon}, journal = {Energy Procedia}, year = {2016}, month = {8}, volume = {92}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {341-346}, keywords = {Black silicon, Nano-texturing, Surface passivation, Lifetime, Atomic layer deposition, Al2O3, Solar cells}, web_url = {http://www.sciencedirect.com/science/article/pii/S1876610216305203}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.egypro.2016.07.093}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Calle, E. and Ortega, P. and von Gastrow, G. . and Martin, I and Savin, H. and Alcubilla, R.} } @Article { WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016, title = {Five-year records of Total Mercury Deposition flux at GMOS sites in the Northern and Southern Hemispheres}, journal = {Atmospheric Chemistry and Physics Discussions}, year = {2016}, month = {7}, day = {20}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {1-33}, keywords = {mercury, wet deposition flux,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7375}, DOI = {10.5194/acp-2016-517}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}ngberg, I. and Walters, C. and Vard{\`e}, M. and Spandow, P. and Somerset, V. and Sena, F. and Islas, M.R. and Obolkin, V. and Munthe, J. and Mkololo, T. and Mashyanov, N. and Martin, L. and Magand, O. and Labuschagne, C. and Kotnik, J. and Horvat, M. and Hansson, K. and Hagestr{\"o}m, U. and Gawlik, B. and Garcia, P.E. and Fu, X. and Feng, X.B. and Ebinghaus, R. and Dommergue, A. and Di{\'e}guez, M.D.C. and Comero, S. and Cairns, W. and Arcega-Cabrera, F. and Brunke, E.G. and Barbante, C. and Angot, H. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Weigelt, A. and Yang, X. and Fisicaro, P.} } @Proceedings { , title = {Measurement and estimation of arbitrary signal power using a window technique}, journal = {Proceedings CPEM 2016}, year = {2016}, month = {7}, day = {18}, volume = {54}, number = {12}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Power, signal windowing, sampling, noise, spectral components.}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540739}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Unknown}, event_place = {Ottawa}, event_name = {Conference on Precision Elexctromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {0018-9456}, ISSN = {0018-9456}, DOI = {10.1109/CPEM.2016.7540739}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lapuh, Rado and Voljč, Boštjan and Lindič, Matjaž} } @Proceedings { , title = {Quasi coherent overlapping procedure to improve harmonics suppression using single tone estimation algorithms}, journal = {Proceedings CPEM 2016}, year = {2016}, month = {7}, day = {18}, volume = {54}, number = {12}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Measurement, sampling, estimation algorithms, harmonic distortion, estimation error, uncertainty}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540596}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Unknown}, event_place = {Ottawa}, event_name = {Conference on Precision Elexctromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {0018-9456}, ISSN = {0018-9456}, DOI = {10.1109/CPEM.2016.7540596}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lapuh, Rado and Voljč, Boštjan and Kokalj, Miha and Lindič, Matjaž and Svetik, Zoran} } @Proceedings { , title = {Uncertainty of the Signal Parameter Estimation from Sampled Data}, journal = {Proceedings CPEM 2016}, year = {2016}, month = {7}, day = {18}, volume = {54}, number = {12}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Measurement, sampling, estimation algorithms, harmonic distortion, estimation error, uncertainty}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540770}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Unknown}, event_place = {Ottawa}, event_name = {Conference on Precision Elexctromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {0018-9456}, ISSN = {0018-9456}, DOI = {10.1109/CPEM.2016.7540770}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lapuh, Rado and Šira, Martin and Lindič, Matjaž and Voljč, Boštjan} } @Proceedings { , title = {Keysight 3458A Noise Performance}, journal = {Proceedings CPEM 2016}, year = {2016}, month = {7}, day = {18}, volume = {54}, number = {12}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Measurement, sampling, quantization noise, 1/f noise, interferences, measurement uncertainty}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540597}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Unknown}, event_place = {Ottawa}, event_name = {Conference on Precision Elexctromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {0018-9456}, ISSN = {0018-9456}, DOI = {10.1109/CPEM.2016.7540597}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lapuh, Rado and Voljč, Boštjan and Lindič, Matjaž} } @Article { , title = {Optical to microwave clock frequency ratios with a nearly continuous strontium optical lattice clock}, journal = {Metrologia}, year = {2016}, month = {7}, day = {8}, volume = {53}, number = {4}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {1123}, keywords = {atomic clocks, high precision spectrocopy, frequency ratios, optical lattice clocks}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1123/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1123}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lodewyck, J and Bilicki, S and Bookjans, E and Robyr, J-L and Shi, C and Vallet, G and Le Targat, R and Nicolodi, D and Le Coq, Y and Gu{\'e}na, J and Abgrall, M and Rosenbusch, P and Bize, S} } @Article { vandenBromRWCB2016, title = {Smart grid power quality and stability measurements in Europe}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, keywords = {instrument transformers, smart grids, metrology, phasor measurement units, synchrophasors, power quality,impedance measurement}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, DOI = {10.1109/CPEM.2016.7540462}, stag_bib_extends_levelofaccess = {NA}, author = {van den Brom, H. E. and Rietveld, G. and Wright, P. S. and Crotti, G. and Braun, J. P.} } @Proceedings { , title = {RF wafer probing with improved contact repeatability using nanometer positioning}, journal = {Microwave Measurement Conference (ARFTG), 2016 87th ARFTG}, year = {2016}, month = {6}, day = {30}, number = {N/A}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {N/A}, keywords = {Probes, Standards, Frequency measurement, Radio frequency, Calibration, Microwave measurement,}, web_url = {https://hal.archives-ouvertes.fr/hal-02083251/document}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {San Francisco CA USA}, event_name = {Microwave Measurement Conference (ARFTG), 2016 87th ARFTG}, event_date = {27-05-2016 to 27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, DOI = {10.1109/ARFTG.2016.7501967}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Daff{\'e}, K. and Dambrine, G. and von Kleist-Retzow, F. and Haddadi, K.} } @Article { , title = {Novel multi-feature bar design for machine tools geometric errors identification}, journal = {Precision Engineering}, year = {2016}, month = {6}, day = {18}, volume = {46}, number = {--}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {323–338}, keywords = {New material standard, Reversal technique, Calibration, Geometric errors, Machine tools}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier Inc.}, address = {Elsevier Inc.}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2016.06.002}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Viprey, FB and Nouira, HN and Lavernhe, SL and Tournier, CT} } @Proceedings { OliveiraNKRVNHHT2016, title = {Geometric and Reflectance Signature Characterization of Complex Canopies using Hyperspectral Stereoscopic Images from UAV and Terrestrial Platforms}, journal = {ISPRS - International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences}, year = {2016}, month = {6}, day = {17}, volume = {XLI-B7}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {77-82}, keywords = {Hyperspectral, Radiometry, Photogrammetry, Geometry, Matching, Uncertainty}, web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B7/77/2016/isprs-archives-XLI-B7-77-2016.pdf}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, address = {Gottingen}, event_place = {Prague, Czech Republic}, event_name = {XXIII ISPRS Congress}, event_date = {12-07-2016 to 19-07-2016}, language = {30}, ISSN = {2194-9034}, DOI = {10.5194/isprsarchives-XLI-B7-77-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Oliveira, R. and N{\"a}si, R. and Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Nevalainen, O. and Hakala, T. and Honkavaara, E. and Tommaselli, A.} } @Article { SterrAKGHVL2016, title = {A transportable optical lattice clock}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {6}, volume = {723}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {012020}, keywords = {time and frequency metrology, transportable optical lattice clock, chronometric geodesy}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012020/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/723/1/012020}, stag_bib_extends_levelofaccess = {NA}, author = {Sterr, U. and Al-Masoudi, A. and Koller, S. and Grotti, J. and H{\"a}fner, S. and Vogt, S. and Lisdat, C.} } @Proceedings { , title = {Maximizing the Benefit of Existing Equipment for Nonlinear and Communication Measurements}, journal = {N/A}, year = {2016}, month = {5}, day = {27}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Nonlinear measurements, oscilloscope, sampling, analogue to digital conversion}, web_url = {http://www.arftg.org/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {San Francisco, CA, USA}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30}, stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART}, author = {Humphreys, D. A. and Raffo, A. and Bosi, G. and Vannini, G. and Schreurs, D. and Gebremicael, K. N. and Morris, K.} } @Article { MaturilliVVMM2016, title = {Towards a calibration laboratory in Ny-{\AA}lesund}, journal = {Rendiconti Lincei}, year = {2016}, month = {5}, day = {17}, volume = {27}, number = {S1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {243-249}, keywords = {Metrology, Ny-{\AA}lesund, Arctic Climate, Calibration}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature}, language = {30}, ISSN = {2037-4631, 1720-0776}, DOI = {10.1007/s12210-016-0531-9}, stag_bib_extends_levelofaccess = {NA}, author = {Maturilli, Marion and Vitale, Vito and Viola, Angelo and Merlone, Andrea and Musacchio, Chiara} } @Article { , title = {Toward flexible Spintronics: perpendicularly magnetized synthetic antiferromagnetic thin films and nanowires on polyimide substrates}, journal = {Advanced Functional Materials}, year = {2016}, month = {5}, day = {11}, volume = {Volume 26}, number = {Issue 26}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {Pages 4704–4711}, keywords = {Spintronics, Perpendicular magnetic anisotropy, CoFeB thin films}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/adfm.201505138/abstract}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {30}, DOI = {10.1002/adfm.201505138}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vemulkar, T. and Mansell, R. and Fern{\'a}ndez-Pacheco, A. and Cowburn, R.P.} } @Article { ZappaTVLLAPGBDG2016, subid = {232}, title = {Experiment Investigating the Connection between Weak Values and Contextuality}, journal = {Physical Review Letters}, year = {2016}, month = {5}, volume = {116}, number = {18}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {180401}, keywords = {Quantum Foundations, Quantum Nonlocality, Weak Values, Weak Measurements}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.116.180401}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Levi, M. P. and Lussana, R. and Villa, F. and Tosi, A. and Zappa, F. and Gramegna, M. and Brida, G. and Degiovanni, I. P. and Genovese, M.} } @Proceedings { , title = {High-accuracy absolute distance measurement with a mode-resolved optical frequency comb}, journal = {Proceedings of SPIE}, year = {2016}, month = {4}, day = {29}, volume = {9899}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {989906}, keywords = {Distance measurement, frequency combs, homodyne detection, intererometry}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {SPIE}, address = {Bellingham}, event_place = {Brussels, Belgium}, event_name = {SPIE Photonics Europe 2016, Optical Sensing and Detection IV}, event_date = {04-04-2016 to 07-04-2016}, language = {30}, ISSN = {1996-756X}, DOI = {10.1117/12.2227360}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Voigt, D. and van den Berg, S.A. and Lešund{\'a}k, A. and van Eldik, S. and Bhattacharya, N.} } @Proceedings { , title = {JRP SIB60 “Metrology for Long Distance Surveying”-a concise survey on major project results}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {March 30-April 1, 2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pollinger, F. and Bauch, A. and Leute, J. and Meiners-Hagen, K. and Mildner, J. and Guillory, J. and Wallerand, J.-P. and Jokela, J. and Kallio, U. and Koivula, H. and Lahtinen, S. and Poutanen, M. and Astrua, M. and Francese, C. and Zucco, M. and Eusebio, L. and Marques, F. and Pires, C. and Saraiva, F. and Pelligrino, O. and Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M. and Kupko, V. and Neyezhmakov, P. and Bergstrand, S. and van den Berg, S.A. and Kersten, T. and Krawinkel, T.} } @Article { , title = {Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150044}, keywords = {high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150044}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0044}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wooliams, E.R and Anhalt, K and Ballico, M and Bloembergen, P and Bourson, F and Briaudeau, S and Campos, J and Cox, M.G and del Campo, D and Dong, W and Dury, M.R and Gavrilov, V and Grigoryeva, I and Hernanz, M.L and Jahan, F and Khlevnoy, B and Khromchenko, V and Lowe, D.H and Lu, X and Machin, G and Mantilla, J.M and Martin, M.J and McEvoy, H.C and Rougie, B and Saldi, M and Salim, S.G.R and Sasajima, N and Taubert, D.R and Todd, A.D.W and Van den Bossche, R} } @Article { , title = {A virtual lateral standard for AFM calibraion}, journal = {Microelectronic Engineering}, year = {2016}, month = {3}, day = {5}, volume = {153}, number = {5 March 2016}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {pp 29-36}, keywords = {Nanoscale production; Lateral AFM calibration; Virtual standard; Traceability; Measurement uncertainty; Non-linearity}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.mee.2016.01.010}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Koops, R. and van Veghel, M. and van de Nes, A.} } @Article { , title = {Evaluation of comparison and proficiency test results of gamma ray spectrometry at Jožef Stefan Institute from 1986 to 2014}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {54-60}, keywords = {comparisons, proficiency tests, \(\zeta\)–score, high resolution gamma-ray spectrometry, environmental samples, radioactivity, natural and artificial radionuclides, Co-60, Cs-137, K-40, Ra-226}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804315303687}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier Ltd.}, language = {30}, DOI = {10.1016/j.apradiso.2015.12.025}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Glavič-Cindro, D. and Korun, M. and Nečemer, M. and Vodenik, B. and Zorko, B.} } @Article { , title = {Primary current-sensing noise thermometry in the millikelvin regime}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {2}, day = {22}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150054}, keywords = {noise, thermometry, PLTS-2000, SQUID, primary, uncertainty}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150054}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society Publishing}, address = {London}, language = {30}, ISSN = {1471-2962}, DOI = {10.1098/rsta.2015.0054}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-22}, author = {Shibahara, A and Hahtela, O and Engert, J and van der Vliet, H and Levitin, L V and Casey, A and Lusher, C P and Saunders, J and Drung, D and Schurig, Th} } @Article { , title = {A Novel Coordinate Measurement System Based on Frequency Scanning Interferometry}, journal = {Journal of the CMSC [reproduced in Quality Digest]}, year = {2016}, month = {2}, day = {18}, volume = {9}, number = {1 (Spring 2016)}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {6pp}, keywords = {FSI, coordinate metrology, SI, traceable}, web_url = {http://www.qualitydigest.com/inside/cmsc-article/021816-novel-coordinate-measurement-system-based-frequency-scanning\#}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Coordinate Metrology Society}, address = {Weatherford}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.qualitydigest.com/inside/cmsc-article/021816-novel-coordinate-measurement-system-based-frequency-scanning\#}, author = {Hughes, B and Campbell, M and Veal, D} } @Article { ChebenDKVNV2016, subid = {578}, title = {Mid-Infrared Silicon-on-Insulator Fourier-Transform Spectrometer Chip}, journal = {IEEE Photonics Technology Letters}, year = {2016}, month = {2}, day = {15}, volume = {28}, number = {4}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {528-531}, keywords = {mid-IR, spectrometry, silicon photonics}, web_url = {http://hdl.handle.net/10261/167745}, web_url2 = {https://dx.doi.org/10.5258/SOTON/383407}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, language = {30}, ISSN = {1041-1135, 1941-0174}, DOI = {10.1109/LPT.2015.2496729}, stag_bib_extends_levelofaccess = {NA}, author = {Nedeljkovic, Milos and Velasco, Aitor V. and Velasco, Aitor V. and Khokhar, Ali Z. and Delage, Andre and Cheben, Pavel} } @Article { MonteyneVPRFEBE2016, title = {Preparation and evaluation of sufficiently homogeneous and stable reference materials for priority hazardous substances in whole water}, journal = {Accreditation and Quality Assurance}, year = {2016}, month = {2}, volume = {21}, number = {2}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {113-120}, keywords = {Homogeneity, Stability, Uncertainty, Whole water, Reference materials, PAHs, PBDEs, TBT, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-1775, 1432-0517}, DOI = {10.1007/s00769-015-1189-1}, stag_bib_extends_levelofaccess = {NA}, author = {Monteyne, E. and Vanermen, G. and Philipp, R. and Richter, J. and Fettig, I. and Elordui-Zapatarietxe, S. and Boom, G. and Emteborg, H.} } @Article { VelazquezFCPH2016, title = {Zernike polynomials for photometric characterization of LEDs}, journal = {Journal of Optics}, year = {2016}, month = {1}, volume = {18}, number = {2}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {1-9}, keywords = {goniophotometry, light-emitting diodes, Zernike polynomials, photometry}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom}, language = {30}, ISSN = {2040-8978, 2040-8986}, DOI = {10.1088/2040-8978/18/2/025605}, stag_bib_extends_levelofaccess = {NA}, author = {Velazquez, J L and Ferrero, A and Campos, J and Pons, A and Hernanz, M L} } @Article { vanderVeenBA2016, title = {Suitability of different containers for the sampling and storage of biogas and biomethane for the determination of the trace-level impurities – A review}, journal = {Analytica Chimica Acta}, year = {2016}, month = {1}, volume = {902}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {22-32}, keywords = {Sampling; Containers; Suitability; Biogas; Biomethane; Impurities; VOCs; Siloxanes}, tags = {EnG}, web_url = {https://www.ncbi.nlm.nih.gov/pubmed/26703250}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York}, language = {30}, ISSN = {0003-2670}, DOI = {10.1016/j.aca.2015.10.039}, stag_bib_extends_levelofaccess = {NA}, author = {van der Veen, A.M.H. and Brown, A.S. and Arrhenius, K.} } @Article { , title = {The minimum number of measurements for colour, sparkle, and graininess characterisation in gonio-apparent panels}, journal = {Coloration Technology}, year = {2016}, volume = {131}, number = {4}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {303-309}, keywords = {gonio-apparent colours, sparkle, graininess, measurements}, web_url = {http://onlinelibrary.wiley.com/doi/10.1111/cote.12157/citedby}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Society of Dyers and Colourists. John Wiley \& Sons}, address = {New York}, language = {30}, ISSN = {1478-4408}, DOI = {10.1111/cote.12157}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Chorro, E. and Perales, E. and Burgos, F.J. and G{\'o}mez, O. and Vilaseca, M. and Pujol, J. and Mart{\'i}nez-Verd{\'u}, F.M.} } @Proceedings { , title = {Measurement of goniofluorescence in photoluminiscent materials}, journal = {CIE Proceeding}, year = {2016}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, keywords = {Goniofluorescence, fluorescence, photoluminescence, spectrophotometry}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {International Comission on Illumination}, address = {Serrano 144}, event_place = {Manchester/UK}, event_name = {28th Session CIE}, event_date = {June 28 - July 4, 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, A and Bernad, B and Velazquez, J L and Pons, A and Hernanz, M L and Jaanson, P and Martinez-Verdu, F M and Chorro, E and Perales, E and Campos, J} } @Article { , title = {Fundamental aspects of Arn+ SIMS profiling of common organic semiconductors}, journal = {Surface and Interface Analysis}, year = {2016}, volume = {1}, number = {46}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {54-57}, keywords = {depth profiling, sputter yield, ion yield, matrix effect, OPV, P3HT, PCDTBT, PCBM}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5621/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Wiley Online Library}, address = {New Jersey NYC}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.5621}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Fleischmann, C. and Conard, T. and Havelund, R. and Franquet, A. and Poleunis, C. and Voroshazi, E. and Delcorte, A. and Vandervorst, W.} } @Article { , title = {METROLOGICALLY TRACEABLE DETERMINATION OF THE WATER CONTENT IN BIOPOLYMERS: INRIM ACTIVITY}, journal = {International Journal of Thermophysics}, year = {2016}, volume = {-}, number = {Special Issue Tempmeko 2016}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {-}, keywords = {Water content, metrological traceability, coulometric Karl Fischer titration, Evolved Water Vapour analysis, biopolymers}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer}, address = {Berlin}, language = {30}, ISSN = {ISSN: 0195-928X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rolle, F. and Beltramino, G. and Fernicola, V. and Sega, M. and Verdoja, A.} } @Article { , title = {Characterization of a series of absolute isotope reference materials for magnesium: ab initio calibration of the mass spectrometers, and determination of isotopic compositions and relative atomic weights}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, DOI = {10.1039/c6ja00013d}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogl, Jochen and Brandt, Bj¨orn and Noordmann, Janine and Rienitz, Olaf and Malinovskiy, Dmitriy} } @Article { , title = {Annihilation of structural defects in chalcogenide absorber films for high-efficiency solar cells}, journal = {Energy \& Environmental Science}, year = {2016}, volume = {9}, number = {5}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1818-1827}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, XRD, XRF, in-situ, planar defects, TEM}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {1754-5692}, DOI = {10.1039/c6ee00402d}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-18}, author = {Mainz, R. and Simsek Sanli, E. and Stange, H. and Azulay, D. and Brunken, S. and Greiner, D. and Hajaj, S. and Heinemann, M. D. and Kaufmann, C. A. and Klaus, M. and Ramasse, Q. M. and Rodriguez-Alvarez, H. and Weber, A. and Balberg, I. and Millo, O. and van Aken, P. A. and Abou-Ras, D.} } @Article { , title = {Generation of Whole-Body Scintigraphic Images with New GATE Output Capacities}, journal = {IEEE Nuclear Science Symposium and Medical Imaging Conference}, year = {2016}, volume = {(2013 NSS/MIC), Seoul, 2013}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {pp. 1-3.}, keywords = {Index Terms—Nuclear Medicine, Monte Carlo Modelling, Gamma-Camera, Whole-Body Planar Imaging, Anthropomorphic Model.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6829150\&isnumber=6829008}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IEEE}, address = {Seoul}, language = {30}, ISSN = {1082-3654}, DOI = {10.1109/NSSMIC.2013.6829150}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Garcia, MP and Villoing, D and McKay, E and Ferrer, L and Der Sarkissian, H and Poirot, M and Bardi{\`e}s, M} } @Article { , title = {Statistical Analysis of Three Different Stirrer Designs in a Reverberation Chamber}, journal = {Proceedings of the 2015 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Taipei, Taiwan}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {604-607}, keywords = {Reverberation Chamber, Stirrer Design, Stirrer Comparison}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {2162-7673}, DOI = {10.1109/APEMC.2015.7175394}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ubin, A. and Vogt-Ardatjew, R. and Leferink, F. and Jenu, M.Z.M. and van de Beek, S.} } @Article { , title = {Influence of Reverberation Chamber Loading on Extreme Field Strength}, journal = {Proceedings of the Asia Pacific Symposium on EMC (APEMC), Tokio, 2014}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {685-688}, keywords = {reverberation chamber, enclosed environment, extreme field strength, Q-factor, chamber loading}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6997237\&tag=1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {N.A.}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {INSPEC 14837809}, author = {Vogt-Ardatjew, R.A. and van de Beek, S. and Leferink, F.B.J.} } @Article { , title = {Experimental Extreme Field Strength Investigation in Reverberant Enclosures}, journal = {Proceedings of the 2014 International Symposium on EMC (EMC Europe) Gothenburg, Sweden}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {332 - 336}, keywords = {reverberation chambers, reverberant environments, in-situ measurements, electric field strength, Q-factor}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6930927}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {2325-0356}, DOI = {10.1109/EMCEurope.2014.6930927}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogt-Ardatjew, R.A. and van de Beek, S. and Leferink, F.B.J. and Buesink, Frits} } @Article { , title = {Reliable Systems Design using Current Boundaries}, journal = {IEEE Electromagnetic Compatibility Magazine}, year = {2016}, volume = {2016-3 or 4}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-12}, keywords = {Regions, Zoning, Current Boundary, Current Barrier, Electromagnetic Separation,}, web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=5962381}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Not known yet}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Buesink, F.J.K. and van Leersum, B.J.A.M. and Leferink, F.B.J.} } @Article { , title = {Validation of a Fully Anechoic Chamber}, journal = {Proceedings of the 2016 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Shenzhen, China}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {865-868}, keywords = {anechoic chamber, antenna, S-parameter, s-VSWR, reflection coefficient, time domain reflectometry}, web_url = {http://ieeexplore.ieee.org/document/7522892/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, DOI = {10.1109/APEMC.2016.7522892}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mandaris, D. and Moonen, D.J.G. and van de Beek, G.S. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Accurate experimental (p, \(\rho\), T) data and virial coefficients for the (methane and helium) binary system}, journal = {Journal of Chemical Thermodynamics}, year = {2016}, volume = {101}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {168-179}, keywords = {methane; helium; natural gas thermodynamic characterization; density; single-sinker densimeter; GERG-2008 equation of state}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0021-9614}, DOI = {10.1016/j.jct.2016.05.024}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hern{\'a}ndez-G{\'o}mez, R. and Tuma, D. and Villama{\~n}{\'a}n, R. and Chamorro, C.R.} } @Proceedings { , title = {Numerical method for calculation of transfer matrix for non typical adapters used for calibration of EMC devices}, journal = {ERK 2015}, year = {2016}, volume = {Volume A}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {273-276}, keywords = {EMC, adapter, LISN}, web_url = {http://www.ieee.si/erk/erk15.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {24th International Electrotechnical and Computer Science Conference ERK 2015}, address = {Portorož}, event_place = {Portorož}, event_name = {24th International Electrotechnical and Computer Science Conference ERK 2015}, event_date = {21-9-2015 to 23-9-2015}, language = {110}, ISSN = {1581-4572}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kokalj, M. and Voljč, B. and Pinter, B. and Lindič, M. and Svetik, Z. and Kokalj, Miha} } @Article { , title = {Reassessing changes in diurnal temperature range: A new data set and characterization of data biases}, journal = {Journal of Geophysical Research: Atmospheres}, year = {2016}, volume = {121}, number = {10}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {5115–5137}, keywords = {diurnal temperature range, data set, reassessment}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/2015JD024583/abstract}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley}, address = {Hoboken}, language = {30}, ISSN = {2169-897X}, DOI = {10.1002/2015JD024583}, extern = {1}, stag_bib_extends_fe_group = {79,59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Thorne, P W and Menne, M J and Williams, C N and Rennie, J J and Lawrimore, J H and Vose, R S and Petersono, T C and Durre, I and Davy, R and Esau, I and Klein-Tank, A M G and Merlone, A} } @Proceedings { LiDHRVAR2016, subid = {80}, title = {Development of a Reference Wafer for On-wafer Testing of Extreme Impedance Devices}, journal = {IEEE XPlore}, year = {2016}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Standards, Calibration, Impedance, Nanoscale devices, Impedance measurement, Probes, Transmission line measurements, extreme impedance measurement, Calibration, on-wafer measurement, nano-scale, co-planar waveguide, RF nanotechnology}, web_url = {http://epubs.surrey.ac.uk/813783/1/Votsi_88th_ARFTG_Paper_Summary\%20\%28002\%29.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, address = {USA \& Canada}, event_place = {Austin, TX, USA}, event_name = {Microwave Measurement Conference (ARFTG)}, event_date = {08-12-2016 to 09-12-2016}, language = {30}, DOI = {10.1109/ARFTG.2016.7839719}, stag_bib_extends_levelofaccess = {NA}, author = {Votsi, H. and Roch-Jeune, I. and Haddadi, K. and Li, C. and Dambrine, G. and Aaen, P.H. and Ridler, N.} } @Article { KarhaIVB2016, title = {Temperature invariant energy value in LED spectra}, journal = {Applied Physics Letters}, year = {2016}, volume = {109}, number = {23}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {231103}, keywords = {band gap, III-V optosemiconductors}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Institute of Physics}, language = {30}, DOI = {10.1063/1.4971831}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}rh{\"a}, P. and Ikonen, E. and Vaskuri, A. and Baumgartner, H.} } @Article { , title = {Indirect method to monitor the site size of sealed spherical TEPCs}, journal = {Radiation Measurements}, year = {2015}, month = {12}, day = {12}, volume = {85}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {26-31}, keywords = {TEPC, Sealed TEPCs, Microdosimetry, Gas pressure Monitoring, Simulated site size}, web_url = {http://www.sciencedirect.com/science/article/pii/S1350448715300834?np=y\&npKey=bb8af66d5c5364335cd11492697ddcf8a85220bc4d891169d188109555d65c33}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier Ltd.}, language = {30}, DOI = {10.1016/j.radmeas.2015.12.004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Chiriotti, S. and Moro, D. and Conte, V. and Grosswendt, B. and Vanhavere, F. and Vynckier, S.} } @Article { , title = {An IQ-Steering Technique for Amplitude and Phase Control of mm-Wave Signals}, journal = {Microwave Measurement Conference (ARFTG), 2014 86th ARFTG}, year = {2015}, month = {12}, day = {3}, volume = {IEEE Catalog Number: CFP15ARG-USB}, number = {December}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {69-72}, keywords = {calibration;millimetre wave measurement;phase control;IQ-steering technique;amplitude predistortion technique;amplitude-phase control;calibration;direct IQ up-conversion;frequency 30 GHz to 40 GHz;frequency multiplication;multipath mm-wave signals;signal amplification;wafer probe-tip level;Calibration;Hardware;Minimization;Mixers;Phase measurement;Phase modulation;IQ modulation;calibration;mm-wave;phase coherent}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7381471\&queryText=spirito\%20m\&refinements=4291944822\&ranges=2015_2015_Year}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, language = {30}, ISSN = {978-1-4673-9246-4}, DOI = {10.1109/ARFTG.2015.7381471}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Visweswaran, A. and de Martino, C. and Sirignano, E. and Spirito, M.} } @Article { , title = {Temperature drift compensation in Fourier-transform integrated micro-spectrometers}, journal = {Optica Pura y Aplicada}, year = {2015}, month = {12}, day = {1}, volume = {48}, number = {4}, number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {283-289}, keywords = {integrated optics, spectroscopy, Fourier transform, Silicon on insulator, temperature drift, spectral retrieval.}, web_url = {-}, misc2 = {EMPIR 2014: Industry}, publisher = {SEDOPTICA}, address = {MADRID}, language = {112}, ISSN = {-}, DOI = {10.7149/OPA.48.4.283}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Velasco, A. V. and Galindo-Santos, J. and Cheben, P. and Calvo, M. L and Schmid, J. and Delage, A. and Xu, D.-X. and Janz, S. and Corredera, P.} } @Article { , title = {Accurate Experimental Field Mapping in the Close Vicinity of a Pyramidal Absorber Using the Monostatic Optically Modulated Scatterer Technique}, journal = {IEEE Transactions on electromagnetic compatibility}, year = {2015}, month = {12}, volume = {57}, number = {6}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1391 - 1397}, keywords = {Electromagnetic field mapping, modulated scatterer technique (MST), numerical validation, pyramidal absorber, optically modulated scatterer (OMS), optically modulated scatterer technique.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7155550}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {0018-9375}, DOI = {10.1109/TEMC.2015.2449354}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogt-Ardatjew, R.A. and Sowa, A.E.} } @Article { DeStefanoCPFVTMDFM2015, title = {Characterization of a microDiamond detector in high-dose-per-pulse electron beams for intra operative radiation therapy}, journal = {Physica Medica}, year = {2015}, month = {12}, volume = {31}, number = {8}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {897-902}, keywords = {Intra operative radiation therapy, Electron beam dosimetry, High dose-per-pulse radiation therapy, Synthetic diamond dosimeters}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2015.06.008}, stag_bib_extends_levelofaccess = {NA}, author = {De Stefano, S. and Ciccotelli, A. and Pimpinella, M. and Falco, M.D. and Verona-Rinati, G. and Tonnetti, A. and Marinelli, M. and Di Venanzio, C. and Felici, G. and Marangoni, F.} } @Article { KralikBAVSS2015, title = {Measurement of secondary neutrons generated during proton therapy}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {12}, volume = {172}, number = {4}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {341-345}, keywords = {Secondary neutrons, proton therapy, Bonner Sphere Spectrometer}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv504}, stag_bib_extends_levelofaccess = {NA}, author = {Kr{\'a}l{\'i}k, M. and B{\'a}rtov{\'a}, H. and Andrl{\'i}k, M. and Vykydal, Z. and Solc, J. and Solc, J.} } @Proceedings { FerreroVHCP2015, title = {Photometric Characterization Of Extended Sources By Subsource Goniospectroradiometry}, journal = {Proceedings of the CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, year = {2015}, month = {11}, day = {26}, volume = {1}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {24-33}, keywords = {GONIOSPECTRORADIOMETRY, OLED, photometry, near-field, sub-source}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Commission Internationale de L'Eclairage}, address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A, 1010 Vienna, Austria}, event_place = {Braunschweig, Germany}, event_name = {CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, event_date = {26-11-2015 to 26-11-2015}, language = {30}, ISBN = {978-3-902842-28-2}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Vel{\'a}zquez, J.L. and Hernanz, M.L. and Campos, J. and Pons, A.} } @Article { , title = {Local weighting of nanometric track structure properties in macroscopic voxel geometries for particle beam treatment planning}, journal = {Physics in Medicine and Biology}, year = {2015}, month = {11}, day = {12}, volume = {60}, number = {23}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {9145 –9156}, keywords = {Geant4-DNA, nanodosimetry, proton therapy}, web_url = {http://iopscience.iop.org/article/10.1088/0031-9155/60/23/9145}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0031-9155}, DOI = {10.1088/0031-9155/60/23/9145}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Alexander, F and Villagrasa, C and Rabus, H and Wilkens, J J} } @Article { , title = {An in-depth evaluation of accuracy and precision in Hg isotopic analysis via pneumatic nebulization and cold vapor generation multi-collector ICP-mass spectrometry}, journal = {Anal Bioanal Chem}, year = {2015}, month = {11}, day = {9}, volume = {408}, number = {2}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {417–429}, keywords = {Mass spectrometry . ICP-MS . Biological samples . Metals . Heavy metals . Reference materials . Geochemistry . Geology}, web_url = {http://link.springer.com/article/10.1007\%2Fs00216-015-9131-2}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Berlin}, language = {30}, DOI = {10.1007/s00216-015-9131-2}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rua-Ibarz, Ana and Bolea-Fernandez, Eduardo and Vanhaecke, Frank} } @Article { , title = {Inter-comparison of halocarbons in an atmospheric dry whole air sample}, journal = {Elementa}, year = {2015}, month = {11}, day = {3}, volume = {3}, number = {N/A}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {N/A}, keywords = {None supplied}, web_url = {https://www.elementascience.org/articles/75}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {BioOne}, address = {Washington DC}, language = {30}, ISSN = {2325-1026}, DOI = {10.12952/journal.elementa.000075}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rhoderick, G C and Hall, B D and Harth, C M and Kim, J S and Lee, J and Montzka, S A and Muhle, J and Reimann, S and Vollmer, M K and Weiss, R F} } @Article { , title = {Visual and Instrumental Assessments of Color Differences in Automotive Coatings}, journal = {Color Research and Application}, year = {2015}, month = {11}, day = {3}, volume = {41}, number = {4}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {384-391}, keywords = {vision; color; color measurement; perception psychology; psychophysics; industrial inspection}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/col.21964/abstract}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wiley Periodicals, Inc.}, address = {Arlington VA}, language = {30}, ISSN = {1520-6378}, DOI = {10.1002/col.21964}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {G{\'o}mez, O and Perales, E and Chorro, E and Burgos, FJ and Vilaseca, M and Mart{\'i}nez-Verd{\'u}, FM and Pujol, J} } @Article { , title = {The European project on high temperature measurement solutions in industry (HiTeMS) – A summary of achievements}, journal = {Measurement}, year = {2015}, month = {10}, day = {9}, volume = {78}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {168-179}, keywords = {High temperature measurement High temperature fixed points (HTFPs) Industrial process control Radiation thermometry Thermocouples Reference functions}, web_url = {http://www.sciencedirect.com/science/article/pii/S026322411500500X}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2015.09.033}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Machiin, G and Anhalt, K and Battuello, M and Bourson, F and Dekker, P and Diril, A and Edler, F and Elliott, C.J. and Girard, F and Greenen, A and Knazovick{\'a}, L and Lowe, D and Pavlasek, P and Pearce, J.V. and Sadli, M and Strnad, R and Seifert, M and Vuelban, E.M.} } @Article { , title = {Simultaneous dynamic electrical and structural measurements of functional materials}, journal = {Review of Scientific Instruments}, year = {2015}, month = {10}, day = {5}, volume = {83}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {103901}, keywords = {Piezoelectric fields, Interferometers, Ferroelectric materials, Polarization, Diffractometers}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/86/10/10.1063/1.4931992}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {0034-6748}, DOI = {10.1063/1.4931992}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vecchini, CV and Thompson, PT and Stewart, MS and Muniz-Piniella, AMP and McMitchell, SRCM and Wooldridge, JW and Lepadatu, SL and Bouchenoire, LB and Brown, SB and Wermeille, DW and Bikondoa, OB and Lucas, CAL and Hase, TH and Lesourd, ML and Dontsov, DD and Cain, MGC} } @Proceedings { , title = {Metrology to underpin future regulation of industrial emissions}, journal = {International Congress of Metrology (CIM) 2015, Proceedings}, year = {2015}, month = {9}, day = {23}, volume = {2015}, number = {n.a.}, number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions}, pages = {07008}, keywords = {EMRP, industrial emissions}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07008/metrology_metr2015_07008.html}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {EDP Sciences - Web of Conferences}, address = {Les Ulis Cedex}, event_place = {Paris}, event_name = {17th International Comgress of Metrology 2015}, event_date = {2015-09-21 to 2015-09-24}, language = {30}, ISBN = {n.a.}, ISSN = {n.a.}, DOI = {10.1051/metrology/20150007008}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rausch, Anne and Werhahn, Olav and Witzel, Oliver and Ebert, Volker and Vuelban, Edgar Moreno and Gersl, Jan and Kvernmo, Gjermund and Korsman, John and Coleman, Marc and Gardiner, Tom and Robinson, Rod} } @Article { , title = {METefnet: developments in metrology for moisture in materials}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15003}, keywords = {Development - Moisture in materials}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bell, S and Aro, A and Arpino, F and Aytekin, S and Cortellessa, G and Dell’Isola, M and Ferenč{\'i}kov{\'a}, Z and Fernicola, V and Gavioso, R and Georgin, E and Heinonen, M and Hudoklin, D and Jalukse, L and Karab{\"o}ce, N and Leito, I and M{\"a}kynen, A and Miao, P and Nielsen, J and Nicolescu, I and Rudolfov{\'a}, M and Ojanen-Saloranta, M and {\"O}sterberg, P and {\O}stergaard, P and Rujan, M and Sega, M and Strnad, R and Vachova, T} } @Proceedings { , title = {Metrology for ammonia in ambient air–concept and first results of the EMRP project MetNH3}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {2015}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {07003}, keywords = {ammonia, reference gas mixture, reference gas generator, dilution, absolute spectroscopic measurements, sampling, gas cylinders}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07003/metrology_metr2015_07003.html}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {EDP Sciences - Web of Conferences}, address = {Les Ulis Cedex}, event_place = {Paris, France}, event_name = {17th International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/201507003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pog{\'a}ny, A. and Balslev-Harder, D. and Braban, C. F. and Cassidy, N. and Ebert, V. and Ferracci, V. and Hieta, T. and Leuenberger, D. and L{\"u}ttschwager, N. and Martin, N. and Pascale, C. and Tiebe, C. and Twigg, M. M. and Vaittinen, O. and van Wijk, J. and Wirtz, K. and Niederhauser, B.} } @Article { , title = {Dynamic properties during wood humidification}, journal = {17 th International Congress of Metrology, 14009 (2015 )}, year = {2015}, month = {9}, day = {21}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {humiditiy, wood samples, humidification wood}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_14009.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, address = {Paris}, language = {30}, DOI = {10.1051/metrology/20150014009}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rudolfov{\'a}, M.R. and Pitrov{\'a} Netolick{\'a}, L.P. N. and Ferenč{\'i}kov{\'a}, Z. F. and V{\'a}chov{\'a}, T. V. and Strnad, R. S.} } @Proceedings { , title = {Moisture determination for food quality assessment}, journal = {Proceedings of CIM 2015 - 17th International Congress of Metrology}, year = {2015}, month = {9}, volume = {-}, number = {-}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {-}, keywords = {Moisture, Food, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis}, web_url = {www.metrologie2015.com}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {Paris}, event_place = {Paris}, event_name = {CIM 2015 - 17th International Congress of Metrology}, event_date = {21-24 September 2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/20150015006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rolle, F. and Beltramino, G. and Fernicola, V. and Sega, M. and Verdoja, A.} } @Proceedings { , title = {Metrological traceability for moisture content analysis in wood pellets}, journal = {Proceedings of CIM 2015 - 17th International Congress of Metrology}, year = {2015}, month = {9}, volume = {-}, number = {-}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {-}, keywords = {Moisture, Metrological Traceability, Wood Pellets, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis}, web_url = {www.metrologie2015.com}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {Paris}, event_place = {Paris}, event_name = {CIM 2015 - 17th International Congress of Metrology}, event_date = {21-24 September 2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/20150008002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sega, M. and Beltramino, G. and Fernicola, V. and Rolle, F. and Verdoja, A.} } @Proceedings { , title = {Propagation automatique des incertitudes: application aux techniques auto-talonnage des analyseurs de seau vectoriel}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, volume = {2015}, number = {2015}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {12006}, keywords = {-}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/contents/contents.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, event_place = {Paris}, event_name = {International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {37}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/20150012006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Allal, D and Hall, B and Vincent, P and Litwin, A and Ziad{\'e}, F and Allal, Djamel} } @Article { ViefhausNSRHAHPYY2015, title = {A new compact soft x-ray spectrometer for resonant inelastic x-ray scattering studies at PETRA III}, journal = {Review of Scientific Instruments}, year = {2015}, month = {9}, volume = {86}, number = {9}, number2 = {SIB58: Angles: Angle metrology}, pages = {093109}, keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4930968}, stag_bib_extends_levelofaccess = {NA}, author = {Viefhaus, J. and Nordgren, J. and Siewert, F. and Reininger, R. and Hage, A. and Ag{\aa}ker, M. and Hahn, U. and Peters, H. B. and Yin, Z. and Yandayan, Tanfer} } @Article { , title = {Preparation and characterization of primary magnesium mixtures for the ab initio calibration of absolute magnesium isotope ratio measurements}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2015}, month = {8}, day = {17}, volume = {31}, number = {1}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {179–196}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, DOI = {10.1039/C5JA00284B}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brandt, Bj¨orn and Vogl, Jochen and Noordmann, Janine and Kaltenbach, Angela and Rienitz, Olaf} } @Article { , title = {Progress towards an acoustic determination of the Boltzmann constant at CEM-UVa}, journal = {Metrologia}, year = {2015}, month = {8}, day = {15}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S257-S262}, keywords = {Boltzmann constant, acoustic gas thermometry, speed of sound, new kelvin, uncertainty budget}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S257}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/0026-1394/52/5/S257}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {P{\'e}rez-Sanz, F J and Segovia, J J and Martin, M C and Villamanan, M A and del Campo, D and Garcia, C} } @Proceedings { , subid = {135}, title = {Metrology for long distance surveying - a joint attempt to improve traceability of long distance measurements}, journal = {IAG 150 Years - Proceedings of the 2013 IAG Scientific Assembly}, year = {2015}, month = {8}, day = {1}, volume = {143}, number = {2015}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {calibration · EDM · GNSS · local ties · reference baseline · long distance}, web_url = {http://link.springer.com/chapter/10.1007\%2F1345_2015_154}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer International Publishing}, address = {Berlin Heidelberg}, event_place = {Potsdam, Germany}, event_name = {International Association of Geodesy (IAG) Scientific Assembly 2013}, event_date = {September 1-6, 2013}, language = {30}, ISSN = {0939-9585}, DOI = {10.1007/1345_2015_154}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Pollinger, F. and Astru, M. and Bauch, A. and Bergstrand, S. and G{\"o}rres, B. and Jokela, J. and Kallio, U. and Koivula, H. and Kuhlmann, H. and Kupko, V. and Meiners-Hagen, K. and Merimaa, M. and Niemeier, W. and Neyezhmakov, P. and Poutanen, M. and Saraiva, F. and Sch{\"o}n, S. and van den Berg, S.A. and Wallerand, J.-P. and Zucco, M.} } @Techreport { , title = {A Guide to Bayesian Inference for Regression Problems}, journal = {-}, year = {2015}, month = {7}, day = {30}, volume = {-}, number = {-}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {-}, tags = {MAT}, web_url = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {PTB}, address = {Brunswick \& Berlin}, institution = {-}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, author = {Elster, C. and Klauenberg, K. and Walzel, M. and Wuebbeler, G. and Harris, P. and Cox, M. and Matthews, C. and Smith, I. and Wright, L. and Allard, A. and Fischer, N. and Cowen, S. and Ellison, S. and Wilson, P. and Pennecchi, F. and Kok, G. and Van der Veen, A. and Pendrill, L.R.} } @Article { PimpinellaBFVVTPMGD2015, title = {A novel synthetic single crystal diamond device for in vivo dosimetry}, journal = {Medical Physics}, year = {2015}, month = {7}, day = {13}, volume = {42}, number = {8}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {4636-4644}, keywords = {synthetic diamond dosimeter, in vivo dosimetry, radiation therapy, semiconductor detector}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4926556}, stag_bib_extends_levelofaccess = {NA}, author = {Pimpinella, M. and Bagal{\`a}, P. and Falco, M. D. and Verona-Rinati, G. and Verona, C. and Tonnetti, A. and Prestopino, G. and Marinelli, M. and Guerra, A. S. and De Coste, V.} } @Article { , title = {Evaluation of HPGe spectrometric devices in monitoring the level of radioactive contamination in metallurgical industry}, journal = {Nuclear Instruments and Methods in Physics Research, Section A}, year = {2015}, month = {7}, day = {1}, volume = {797}, number = {not available}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {271-277}, keywords = {High Purity Germanium; Minimum detectable activity; Monte Carlo; Spectrometer; Standardisation; Steel factories}, web_url = {http://www.sciencedirect.com/science/article/pii/S0168900215008220}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2015.07.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Petrucci, Andrea and Arnold, Dirk and Burda, Oleksiy and De Felice, Pierino and Garc{\'i}a-Tora{\~n}o, Eduardo and Mejuto, Marco and Peyr{\'e}s, Virginia and Šolc, Jaroslav and Vodenik, Branko} } @Article { , title = {Effects of thermal drifts on the calibration of capacitive displacement probes at the nanometer level of accuracy}, journal = {Instrumentation and Measurement, IEEE Transactions}, year = {2015}, month = {6}, day = {26}, volume = {PP}, number = {99}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {1}, keywords = {thermal behavior and drift, capacitive displacement probe, dimensional metrology, evaluation}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2440563}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bouderbala, K and Nouira, H and Girault, M and Videcoq, E and Salgado, J} } @Article { , title = {Parts-per-trillion level detection of nitrogen dioxide by cantilever-enhanced photoacoustic spectroscopy}, journal = {Optics Letters}, year = {2015}, month = {6}, day = {16}, volume = {40}, number = {13}, number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments}, pages = {2933-2936}, keywords = {Spectrometers, Spectroscopy; photothermal and visible, Laser sensors.}, web_url = {-}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {OSA}, address = {Washington, DC}, language = {30}, ISSN = {-}, DOI = {10.1364/OL.40.002933}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Peltola, J. and Hieta, T. and Vainio, M.} } @Proceedings { , title = {Analysis of the propagation of Power Quality phenomena using wide-area measurements}, journal = {Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution}, year = {2015}, month = {6}, day = {15}, volume = {n/a}, number = {n/a}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1-4}, keywords = {power quality, power networks}, tags = {SEG}, web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_0663_final.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {n/a}, address = {n/a}, event_place = {Lyon, France}, event_name = {23rd International Conference and Exhibition on Electricity Distribution}, event_date = {14-06-2015 to 15-06-2015}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://cired.net/publications/cired2015/papers/CIRED2015_0663_final.pdf}, author = {Cuk, V and van den Brom, H and Cobben, S and Rietveld, G} } @Proceedings { , title = {Application of PMUs for monitoring a 50 kV distribution grid}, journal = {Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 2015}, year = {2015}, month = {6}, day = {15}, volume = {n/a}, number = {n/a}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1-5}, keywords = {phasor measurement units, smart grids, renewable energy sources}, web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {n/a}, address = {n/a}, event_place = {Lyon, France}, event_name = {23rd International Conference and Exhibition on Electricity Distribution (CIRED)}, event_date = {14-06-15 to 15-06-15}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf}, author = {Rietveld, G and Jongepier, A and van Seters, J and Visser, M and Liu, P and Acanski, M and Hoogenboom, D and van den Brom, H. E.} } @Article { , title = {8 \(\times\) 10−17 fractional laser frequency instability with a long room-temperature cavity}, journal = {Optics Letters}, year = {2015}, month = {5}, volume = {40}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {2112 - 2115}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-9-2112}, web_url2 = {https://arxiv.org/abs/1502.02608}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1364/OL.40.002112}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-5-31}, author = {Hafner, Sebastian and Falke, Stephan and Grebing, Christian and Vogt, Stefan and Legero, Thomas and Merimaa, Mikko and Lisdat, Christian and Sterr, Uwe} } @Article { , title = {Visibility of sparkle in metallic paints}, journal = {Journal of the Optical Society of America A, Optics, Image Science and Vision.}, year = {2015}, month = {4}, day = {27}, volume = {32}, number = {5}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {921-927}, keywords = {sparkle, Color, measurement, Vision - acuity, Color visi{\'o}n, Vision - contrast sensitivity, Spectral discrimination, Astronomical optics}, web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-5-921}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society (OSA)}, address = {Washington, DC}, language = {30}, ISSN = {1084-7529}, DOI = {10.1364/JOSAA.32.000921}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kirchner, E and van der Lans, I and Perales, E and Mart{\'i}nez-Verd{\'u}, FM and Campos, J and Ferrero, A} } @Article { , title = {Evaluation of Agilent 3458A Time Jitter Performance}, journal = {IEEE Transaction on Instrumentation and Measurement}, year = {2015}, month = {4}, day = {16}, volume = {64}, number = {6}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1331-1335}, keywords = {Estimation, measurement, noise, quantization, sampling, signal-to-noise ratio (SNR), synchronization, time jitter, uncertainty}, web_url = {http://ieeexplore.ieee.org/document/7087386/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2408793}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lapuh, Rado and Voljč, Boštjan and Lindič, Matjaž} } @Article { , title = {INFLUENCE OF THE PHYSICAL DATA TO CALIBRATE}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {4}, day = {15}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, web_url = {http://rpd.oxfordjournals.org/content/early/2015/04/15/rpd.ncv140.abstract}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1093/rpd/ncv140}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Chiriotti, S. and Moro, D. and Conte, V. and Colautti, P. and Grosswendt, B. and Sterpin, E. and Vynckier, S.} } @Article { , title = {Electroluminescence from a diamond device with ion-beam-micromachined buried graphitic electrodes}, journal = {Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms}, year = {2015}, month = {4}, day = {1}, volume = {348}, number = {8}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {187-190}, keywords = {Diamond; Electroluminescence; Graphite; Ion beam micro-machining}, web_url = {http://www.sciencedirect.com/science/journal/0168583X}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Elsevier}, address = {London}, language = {30}, ISSN = {0168-583X}, DOI = {10.1016/j.nimb.2014.12.036}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Forneris, J. and Battiato, A. and Gatto Monticone, D. and Picollo, F. and Amato, G. and Boarino, L. and Brida, G. and Degiovanni, I.P. and Enrico, E. and Genovese, M. and Moreva, E. and Traina, P. and Verona, C. and Verona Rinati, G. and Olivero, P.} } @Article { , title = {Bayesian analysis of a flow meter calibration problem}, journal = {Metrologia}, year = {2015}, month = {4}, day = {1}, volume = {52}, number = {2}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {392-399}, keywords = {Bayesian analysis, prior knowledge, posterior distribution, calibration, flow meter, least squares, regression}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/2/392/meta}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {BIPM}, address = {S{\`e}vres}, language = {30}, ISSN = {-}, DOI = {10.1088/0026-1394/52/2/392}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kok, G. J. P. and Van der Veen, A. M. H. and Harris, P. M. and Smith, I. M. and Elster, C.} } @Article { AlexanderRVW2015, title = {Exploring the potential of nanometric track structure based quantities for particle beam treatment planning}, journal = {Radiotherapy and Oncology}, year = {2015}, month = {4}, volume = {115}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {S796}, keywords = {BioQuaRT, track structure, ion beam therapy, nanodosimetry, treatment planning}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier BV}, address = {Suite 800, 230 Park Avenue, New York, NY 10169 United States}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/S0167-8140(15)41460-4}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Alexander, F. and Rabus, H. and Villagrasa, C. and Wilkens, J.J.} } @Article { MeylanGGVBOABBG2015, title = {Characterisation of interaction of radiation with cells - Track structure modelling and biodescriptors of the topology of energy deposition}, journal = {Radiotherapy and Oncology}, year = {2015}, month = {4}, volume = {115}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {S106-S107}, keywords = {BioQuaRT, track structure, ion beam therapy, microdosimetry, nanodosimetry, multi-scale model, reactive species}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier BV}, address = {Suite 800, 230 Park Avenue, New York, NY 10169, United States}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/S0167-8140(15)40209-9}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Meylan, S. and Gruel, G. and Gonon, G. and Villagrasa, C. and Bug, M.U. and Otto, Sandra and Arndt, A. and Baek, W.Y. and Bueno, M. and Giesen, U.} } @Article { MairaniMCVVPMRM2015, title = {Dosimetric characterization of a microDiamond detector in clinical scanned carbon ion beams}, journal = {Medical Physics}, year = {2015}, month = {3}, day = {31}, volume = {42}, number = {4}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {2085-2093}, keywords = {synthetic diamond detector, carbon ions, relative dosimetry}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4915544}, stag_bib_extends_levelofaccess = {NA}, author = {Mairani, A. and Mirandola, A. and Ciocca, M. and Verona-Rinati, G. and Verona, C. and Prestopino, G. and Marinelli, M. and Raffaele, L. and Magro, G.} } @Article { AzumaBBBBBCDFFHKKKMMMMNNPRRSSVWWZ, title = {Improved measurement results for the Avogadro constant using a 28Si-enriched crystal}, journal = {Metrologia}, year = {2015}, month = {3}, day = {25}, volume = {52}, number = {2}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, keywords = {fundamental constants, Avogadro constant, kilogram}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0026-1394/52/2/360}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Azuma, Y and Barat, P and Bartl, G and Bettin, H and Borys, M and Busch, I and Cibik, L and D’Agostino, G and Fujii, K and Fujimoto, H and Hioki, A and Krumrey, M and Kuetgens, U and Kuramoto, N and Mana, G and Massa, E and Mee{\ss}, R and Mizushima, S and Narukawa, T and Nicolaus, A and Pramann, A and Rabb, S A and Rienitz, O and Sasso, C and Stock, M and Vocke Jr, R D and Waseda, A and Wundrack, S and Zakel, S} } @Article { GenoudVPDM, title = {Radiocarbon dioxide detection based on cavity ring-down spectroscopy and a quantum cascade laser}, journal = {Optics Letters}, year = {2015}, month = {3}, day = {23}, volume = {40}, number = {7}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, keywords = {radiocarbon, molecular spectroscopy, quantum cascade laser}, web_url = {http://www.opticsinfobase.org/ol/abstract.cfm?uri=ol-40-7-1342}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {30}, DOI = {10.1364/OL.40.001342}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Genoud, G. and Vainio, M. and Phillips, H. and Dean, J. and Merimaa, M.} } @Article { ReimannSHHRRV2015, title = {Modern inhalation anesthetics: Potent greenhouse gases in the global atmosphere}, journal = {Geophysical Research Letters}, year = {2015}, month = {3}, day = {13}, volume = {42}, number = {5}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {1606-1611}, keywords = {inhalation, anaesthetics}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0094-8276}, DOI = {10.1002/2014GL062785}, stag_bib_extends_levelofaccess = {NA}, author = {Reimann, S. and Schoenenberger, F. and Hofstetter, D. and Hill, M. and Rhee, T.S. and Rigby, M. and Vollmer, M.K.} } @Article { , title = {Parametric investigation of Linear Quadratic Gaussian and Model Predictive Control approaches for thermal regulation of a high precision geometric measurement machine}, journal = {Applied Thermal Engineeing}, year = {2015}, month = {3}, day = {5}, volume = {78}, number = {5 March 2015}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {720-730}, keywords = {Temperature control;Closed-loop; State feedback; K{\'a}lm{\'a}n filter; Reduced model}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1016/j.applthermaleng.2014.10.080}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Videcoq, E and Girault, M and Bouderbala, K and Nouira, H and Salgado, J and Petit, D} } @Article { , title = {Effect of Tissue Parameters on Skin Heating Due to Millimeter EM Waves}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2015}, month = {3}, volume = {51}, number = {3}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, keywords = {Dosimetry, millimeter wave propagation}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, L. and Voyer, D. and Bottauscio, O. and Chiampi, M. and Scorretti, R.} } @Article { BrunnerHRV2015, title = {First Observations of the Fourth Generation Synthetic Halocarbons HFC-1234yf, HFC-1234ze(E), and HCFC-1233zd(E) in the Atmosphere}, journal = {Environmental Science \& Technology}, year = {2015}, month = {3}, volume = {49}, number = {5}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2703-2708}, keywords = {synthetic halocarbons}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0013-936X, 1520-5851}, DOI = {10.1021/es505123x}, stag_bib_extends_levelofaccess = {NA}, author = {Brunner, D. and Hill, M. and Reimann, S. and Vollmer, M.K.} } @Article { , title = {Variable aperture extraction lens for ion beam investigation in inductively coupled plasma-mass spectrometry}, journal = {JOURNAL OF ANALYTICAL ATOMIC SPECTROMETRY}, year = {2015}, month = {2}, day = {25}, volume = {30}, number = {6}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {1329 - 1335}, keywords = {ICP-MS, HALF-LIFE, 2ND VACUUM STAGE, TIME-RESOLVED MEASUREMENTS, SKIMMER, DENSITY, INTERFACE, FRACTIONATION}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {0267-9477}, DOI = {10.1039/c4ja00150h}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kivel, Niko and Potthast, Heiko-Dirk and Guenther-Leopold, Ines and Vanhaecke, Frank and Guenther, Detlef} } @Article { , title = {¹³C- and ¹H-detection under fast MAS for the study of poorly available proteins: application to sub-milligram quantities of a 7 trans-membrane protein.}, journal = {Journal of Biomolecular NMR}, year = {2015}, month = {2}, day = {21}, volume = {62}, number = {1}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {17-23}, keywords = {7 trans-membrane proteins Poorly available proteins Fast magic angle spinning Heteronuclear detection 13C-detection Low sample volumes}, web_url = {http://link.springer.com/article/10.1007\%2Fs10858-015-9911-1}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer}, address = {Berlin}, language = {30}, DOI = {10.1007/s10858-015-9911-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Watts, Anthony and Judge, Peter J. and Asilmovska, Lubica and Pfeil, Marc Philipp and Higman, Victoria A. and Varga, Krisztina and Taylor, Garrick F. and Dannatt, Hugh R W} } @Article { KuepferlingZSVDPRRB2015, title = {Vortex dynamics in Co-Fe-B magnetic tunnel junctions in presence of defects}, journal = {Journal of Applied Physics}, year = {2015}, month = {2}, day = {13}, volume = {117}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, web_url = {http://scitation.aip.org/content/aip/journal/jap/117/17/10.1063/1.4908142}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {0021-8979}, DOI = {10.1063/1.4908142}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kuepferling, M. and Zullino, S. and Sola, A. and Van de Wiele, B. and Durin, G. and Pasquale, M. and Rott, K. and Reiss, G. and Bertotti, G.} } @Article { BeckerBBBJJMPV2015, title = {Realization, characterization and measurements of standard leak artefacts}, journal = {Measurement}, year = {2015}, month = {2}, volume = {61}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {Gas flow metrology, Standard leak artefacts, Experimental data set}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1016/j.measurement.2014.10.045}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Becker, Ute and Bentouati, Djlali and Bergoglio, Merdede and Boineau, Fr{\'e}d{\'e}ric and Jitschin, Wolfang and Jousten, Karl and Mari, Domenico and Praž{\'a}k, Dominik and Vičar, Martin} } @Article { VerbeystABF2015, title = {Asynchronous electro-optic sampling of all-electronically generated ultrashort voltage pulses}, journal = {Measurement Science and Technology}, year = {2015}, month = {1}, day = {20}, volume = {26}, number = {2}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {025203}, keywords = {electro-optic sampling, pulse generator, waveform metrology}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/26/2/025203}, stag_bib_extends_levelofaccess = {NA}, author = {Verbeyst, F. and Ahmed, S. and Bieler, M. and F{\"u}ser, H.} } @Proceedings { , title = {Repetition rate multiplication of a femtosecond frequency comb}, journal = {Proceddings SPIE 9450, Photonics, Devices and Systems VI}, year = {2015}, month = {1}, day = {6}, volume = {94501L}, number = {6 January 2015}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {Fabry-Perot cavity, laser frequency comb, repetition rate multiplication}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2089426}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {SPIE}, event_place = {Prague}, event_name = {7th Internataional Conference on Photonics, Devices and Systems}, event_date = {August 27-29, 2014}, language = {30}, DOI = {10.1117/12.2074415}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lešund{\'a}k, A. and Smid, R. and Voigt, D. and Č{\'i}žek, M. and van den Berg, S. and Č{\'i}p, O.} } @Article { , title = {Calibration of bridge-, charge- and voltage amplifiers for dynamic measurement applications}, journal = {Metrologia}, year = {2015}, month = {1}, volume = {52}, number = {1}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {72-81}, keywords = {dynamic calibration bridge amplifier charge amplifier voltage amplifier}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing on behalf of Bureau International des Poids et Mesures}, address = {Bristol}, language = {30}, ISSN = {ISSN 0026-1394 (print) ; ISSN 1681-7575 (online)}, DOI = {10.1088/0026-1394/52/1/72}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Klaus, L. and Bruns, Th. and Volkers, H.} } @Proceedings { WinterOOJvWISN2015, title = {From Real-Time SAR Assessment to Temperature Distributions in Coronary Stents at 7T}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2015}, volume = {23}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/15/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Toronto, Ontario, Canada}, event_name = {ISMRM 23rd Annual Meeting \& Exhibition}, event_date = {30 May-05 June 2015}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, Lukas and Oberacker, Eva and {\"O}zerdem, Celal and Ji, Yiyi and von Knobelsdorff-Brenkenhoff, Florian and Weidemann, Gerd and Ittermann, Bernd and Seifert, Frank and Niendorf, Thoralf} } @Proceedings { WinterOOJvWISN2015_2, title = {Rapid SAR assessment of electrically thin implantable devices using an analytical approach: Proof-of-Principle for RF heating of coronary stents at 7.0 T}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2015}, volume = {23}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/15/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Toronto, Ontario, Canada}, event_name = {ISMRM 23rd Annual Meeting \& Exhibition}, event_date = {30 May-05 June 2015}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, Lukas and Oberacker, Eva and {\"O}zerdem, Celal and Ji, Yiyi and von Knobelsdorff-Brenkenhoff, Florian and Weidemann, Gerd and Ittermann, Bernd and Seifert, Frank and Niendorf, Thoralf} } @Article { KlapetekVPPMYM2015, title = {Large area high-speed metrology SPM system}, journal = {Nanotechnology}, year = {2015}, volume = {26}, number = {065501}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, keywords = {scanning probe microscopy, high-speed SPM, metrology}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, DOI = {10.1088/0957-4484/26/6/065501}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P and Valtr, M and Picco, L and Payton, O D and Martinek, J and Yacoot, A and Miles, M} } @Article { , title = {Fibre optics wavemeters calibration using a self-referenced optical frequency comb}, journal = {Review of Scientific Instruments}, year = {2015}, volume = {86}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0034-6748}, DOI = {10.1063/1.4904973}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Galindo-Santos, J. and Velasco, A. V. and Corredera, P.} } @Article { , title = {Development of on-line FTIR spectroscopy for siloxane detection in biogas to enhance carbon contactor management}, journal = {Tantala}, year = {2015}, volume = {141}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {128-36}, keywords = {Adsorption; Biogas; CHP; Interference; Landfill; VOCs}, tags = {EnG}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/25966392}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.talanta.2015.03.063}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hepburn, C. A. and Vale, P and Brown, A. S. and Simms, N. J. and McAdam, E. J.} } @Proceedings { , title = {Measurement requirements for biogas specifications}, journal = {17 International Congress of Metrology}, year = {2015}, number2 = {ENG54: Biogas: Metrology for biogas}, keywords = {Biogas}, tags = {EnG}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08006.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {17 International Congress of Metrology}, event_date = {21 September 2015}, language = {30}, DOI = {10.1051/metrology/201508006}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {van der Veen, Adriaan M. H. and Brown, Andrew S. and Heinonen, Martti and Murugan, Arul and Haloua, Frederique and Arrhenius, Karine and Li, Jianrong} } @Proceedings { , title = {Towards a measurement infrastructure for the conformity assessment of biomethane and upgraded biogas}, journal = {2nd International Conference on Renewable Energy Gas Technology}, year = {2015}, volume = {-}, number = {-}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {-}, keywords = {Biogas}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {-}, address = {-}, event_place = {Barcelona, Spain}, event_name = {REGATEC 2015 2nd International Conference on Renewable Energy Gas Technology}, event_date = {7-8 May 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {van der Veen, Adriaan M. H. and Li, Jianrong} } @Proceedings { , title = {Designing a b-learning MSc in Colour Engineering for the Automotive Sector}, journal = {EDULEARN14 Proceedings}, year = {2015}, volume = {1}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {5593-5602}, keywords = {Color technology, special-effect pigments, automotive coatings, training internships in company, Moodle platform, adaptive learning, b-learning}, web_url = {http://library.iated.org/publications/EDULEARN14}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IATED}, address = {Valencia, Spain}, event_place = {Barcelona, Spain}, event_name = {6th International Conference on Education and New Learning Technologies}, event_date = {6-7/07/2014}, language = {30}, ISBN = {978-84-617-0557-3}, ISSN = {2340-1117}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mart{\'i}nez-Verd{\'u}, FM and Viqueira, V and Perales, E and Chorro, E} } @Proceedings { , title = {Color gamut of a typical display for the color reproduction of effect coatings}, journal = {Proceedings of 23rd Congress of the International Commission for Optics}, year = {2015}, volume = {1}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1-4}, keywords = {effect coatings, goniochromatic , color measurement, BRDF}, web_url = {http://hdl.handle.net/10261/111835}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Proceedings of 23rd Congress of the International Commission for Optics}, address = {Orlando}, event_place = {Santiago de Compostela, Spain}, event_name = {Proceedings of 23rd Congress of the International Commission for Optics}, event_date = {26-29/08/2014}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Perales, E. and Ferrero, A. and Chorro, E. and Viqueira, V. and Rabal, A. and Mart{\'i}nez-Verd{\'u}, F. and Pons, A. and Campos, J.} } @Proceedings { , title = {Application of the metrological SPM for long distance measurements}, journal = {Shaping the future by engineering : 58th IWK, Ilmenau Scientific Colloquium, Technische Universit{\"a}t Ilmenau, 8 - 12 September 2014 ; proceedings}, year = {2015}, volume = {2014}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {158}, keywords = {nanopositioning and nanomeasuring machine, metrological scanning probe microscope, SPM, AFM, long distance measurements}, web_url = {http://www.db-thueringen.de/servlets/DocumentServlet?id=24940}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {TU-Ilmenau}, event_place = {Ilmenau, Germany}, event_name = {58th Ilmenau Scientific Colloquium}, event_date = {September 8-12, 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://nbn-resolving.de/urn:nbn:de:gbv:ilm1-2014iwk-158:6}, author = {Vorbringer-Dorozhovets, N. and Fuessl, R. and Manske, E.} } @Article { , title = {Ongoing trends in precision metrology,particularly in nanopositioning and nanomeasuring technology}, journal = {tm – Technisches Messen 2015; 82(7–8): 359–366}, year = {2015}, volume = {82}, number = {7-8}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {359-366}, keywords = {Nanopositioning and nanomeasuring machine, multiscale measurement, optical and tactile sensors}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {De Gruyter}, address = {Oldenbourg}, language = {30}, DOI = {10.1515/teme-2015-0011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Manske, E. and Fuessl, R. and Mastylo, R. and Vorbringer-Dorozhovets, N. and Birli, O. and Jaeger, G.} } @Article { , title = {A dedicated calibration standard for nanoscale areal surface texturemeasurements}, journal = {Microelectronic Engineering}, year = {2015}, volume = {141}, number = {2015}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {250-255}, keywords = {Traceability Calibration standard Areal surface texture Sq Measurement uncertainty}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.mee.2015.04.021}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Koops, R and van Veghel, M and van de Nes, A} } @Article { , title = {Mode-resolved frequency comb interferometry for high-accuracy long distance measurement}, journal = {Scientific Reports}, year = {2015}, volume = {5}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {14661}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Nature Publishing Group}, language = {30}, DOI = {10.1038/srep14661}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {van den Berg, S. and van Eldrik, S. and Bhattacharya, N.} } @Proceedings { , title = {IMPROVEMENT IN LONG TERM STABILITY OF THE LONG RANGE AFMS}, journal = {XXI IMEKO World Congress - Full Papers}, year = {2015}, number = {1}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {2279}, keywords = {AFM, long range AFM, nanopositioning and nanomeasuring machine, NPM machine, long distance measurements}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Czech Technical University}, address = {Prague}, event_place = {Prague}, event_name = {XXI IMEKO World Congress}, event_date = {August 30 - September 4, 2015}, language = {30}, ISBN = {978-80-01-05793-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vorbringer-Dorozhovets, N. and Manske, E.} } @Article { , title = {Energy dependent track structure parametrisations for protons and carbon ions based on nanometric simulations}, journal = {The European Physical Journal D}, year = {2015}, volume = {69}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {216}, keywords = {track structure; particle beams; radiotherapy}, web_url = {http://link.springer.com/article/10.1140\%2Fepjd\%2Fe2015-60206-5}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Cham, Switzerland}, language = {30}, ISSN = {1434-6079}, DOI = {10.1140/epjd/e2015-60206-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Alexander, F and Villagrasa, C and Rabus, H and Wilkens, J J} } @Article { , title = {TestDose: a nuclear medicine software based on Monte-Carlo modelling for generating gamma camera acquisitions and dosimetry}, journal = {Medical Physics}, year = {2015}, volume = {42}, number = {12}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {6885-6894}, keywords = {nuclear medicine, GATE, Monte Carlo simulations, SPECT, dosimetry}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {American Association of Physicists in Medicine}, address = {Alexandria}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4934828}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Garcia, MP and Villoing, D and McKay, E and Ferrer, L and Cremonesi, M and Botta, F and Ferrari, M and Bardi{\`e}s, M} } @Article { , title = {Model-based versus specific dosimetry in diagnostic context: Comparison of three dosimetric approaches}, journal = {Medical Physics}, year = {2015}, volume = {42}, number = {3}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {1288-1296}, keywords = {radiopharmaceutical dosimetry, Monte Carlo modeling, GATE, OLINDA/EXM, STRATOS}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {American Association of Physicists in Medicine}, address = {Alexandria}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4907957}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Marcatili, S and Villoing, D and Mauxion, T and McParland, BJ and Bardi{\`e}s, M} } @Article { , title = {Experimental Plane Wave and Random Field Coupling to Uniform and Non-uniform Transmission Lines}, journal = {Proceedings of the 2015 IEEE International Symposium on EMC (EMC Europe), Dresden, 2015}, year = {2015}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {767 - 772}, keywords = {NUTL, coupling into cables, GTEM, reverberation chamber}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7256260}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {2158-110X}, DOI = {10.1109/ISEMC.2015.7256260}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogt-Ardatjew, R.A. and Leferink, F.B.J. and Buesink, Frits} } @Article { , title = {The effect of magneto-dielectric absorbing coating on unsymmetrical antenna cables}, journal = {Proceedings of the 2015 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Taipei, Taiwan}, year = {2015}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {624-627}, keywords = {Magneto-Dielectric, Coating, Absorbing, Unsymmetrical, Cables}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7175365}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {2162-7673}, DOI = {10.1109/APEMC.2015.7175365}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogt-Ardatjew, R.A. and Sowa, A.E. and Leferink, F.B.J.} } @Article { , title = {Quantification of Minimal Needed Cable Terminations}, journal = {Proceedings of the 2015 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Taipei, Taiwan}, year = {2015}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {470-473}, keywords = {Current Boundary, Zoning, Regions, Cable shield termination Cable transit}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7175236}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {2162-7673}, DOI = {10.1109/APEMC.2015.7175236}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {van Leersum, B.J.A.M. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Protection Against Common Mode Currents on Exposed Cables}, journal = {Proceedings of the 2015 IEEE International Symposium on EMC (EMC Europe), Dresden, 2015}, year = {2015}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1478 - 1483}, keywords = {system level EMC; exposed cables; HIRF; naval ship;}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7256392}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {2158-110X}, DOI = {10.1109/ISEMC.2015.7256392}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {van Leersum, B.J.A.M. and van der Ven, C.C.J. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Activity measurements of barrels filled with radioactive waste}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2015}, volume = {304}, number = {1}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {145–150}, keywords = {Technologically enhanced naturally occurring radioactive materials, Radioactive waste, Activity, Attenuation of gamma-rays, 226Ra, 228Ra}, web_url = {http://link.springer.com/article/10.1007\%2Fs10967-014-3666-0}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Springer}, address = {New York City}, language = {30}, DOI = {10.1007/s10967-014-3666-0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Glavič-Cindro, D. and Korun, M. and Vodenik, B. and Zorko, B.} } @Article { , title = {Optical feedback cavity-enhanced absorption spectroscopy with a 3.24 mu m interband cascade laser}, journal = {Applied Physics Letters}, year = {2015}, volume = {106}, number = {22}, number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments}, pages = {221106}, keywords = {DIODE-LASERS; SPECTROMETER; TEMPERATURE; SENSOR}, web_url = {http://scitation.aip.org/content/aip/journal/apl/106/22/10.1063/1.4922149}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Americal Institute of Physics}, address = {New York}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4922149}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Manfred, KM and Ritchie, GAD and Lang, N and Ropcke, J and van Helden, JP} } @Article { , title = {Application of Satellite-Based Spectrally-Resolved Solar Radiation Data to PV Performance Studies}, journal = {Energies}, year = {2015}, volume = {8}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {3455-3488}, keywords = {photovoltaic performance; spectral response; solar spectrum}, web_url = {http://www.mdpi.com/1996-1073/8/5/3455/pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {MDPI}, address = {Basel, Switzerland}, language = {30}, ISSN = {ISSN 1996-1073}, DOI = {10.3390/en8053455}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Gracia Amillo, A. and Huld, T. and Vourlioti, P. and Mueller, R. and Norton, M.} } @Article { , title = {In situ calibration of meteorological sensor in Himalayan high mountain environment}, journal = {METEOROLOGICAL APPLICATIONS}, year = {2015}, volume = {22}, number = {Supplement S1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {847-853}, keywords = {Metrology for Meteorology; Everest Pyramid; climatic chamber; MeteoMet; temperature sensors calibration; pressure sensors calibration; uncertainty}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/met.1503/abstract}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Royal Meteorological Society}, address = {Reading}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1503}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Merlone, A and Roggero, G and Verza, G P} } @Article { , title = {Arctic metrology: calibration of radiosondes ground check sensors in Ny-{\AA}lesund}, journal = {METEOROLOGICAL APPLICATIONS}, year = {2015}, volume = {22}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {854 - 860}, keywords = {atmospheric sensors calibration; GRUAN; MeteoMet; metrology; Ny-{\AA}lesund; radiosondes}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/met.1506/abstract}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Royal Meteorological Society}, address = {Reading}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1506}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Musacchio, C and Bellagarda, S and Maturilli, M and Graeser, J and Vitale, V and Merlone, A} } @Article { , title = {Metrological analysis of a gravimetric calibration system for tipping-bucket rain gauges}, journal = {METEOROLOGICAL APPLICATIONS}, year = {2015}, volume = {22}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {879 - 885}, keywords = {metrology; rain gauges; calibration; uncertainty; tipping-bucket; laboratory}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/met.1540/abstract}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Royal Meteorological Society}, address = {Reading}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1540}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Santana, M A A and Guimar{\~a}es, P L O and Lanza, L G and Vuerich, E} } @Proceedings { RoscoeFVCW2015, title = {Testing and validation of an algorithm for configuring distribution grid sensor networks}, journal = {23rd International Conference on Electricity Distribution}, year = {2015}, number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics}, keywords = {Smart grids, Distribution grid sensor networks, Sensor placement algorithm, Power flow, Electrical engineering}, tags = {SEG}, web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_0779_final.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Lyon, France}, event_name = {International Conference on Electricity Distribution}, event_date = {15-06-2015 to 18-06-2015}, language = {30}, ISSN = {2032-9644}, stag_bib_extends_levelofaccess = {NA}, author = {Roscoe, Andrew and Forbes, Alistair and Venturi, Alberto and Clarkson, Paul and Wright, Paul} } @Article { PeltolaVHFHM2014, title = {Frequency-comb-referenced mid-infrared source for high-precision spectroscopy}, journal = {Optics Express}, year = {2014}, month = {12}, day = {23}, volume = {22}, number = {26}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {32429-32439}, keywords = {optical parametric oscillator, cavity-ring-down spectroscopy, nitrous oxide, water vapor, methane}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW Washington DC 20036-1023, USA}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.22.032429}, stag_bib_extends_levelofaccess = {NA}, author = {Peltola, Jari and Vainio, Markku and Hieta, Tuomas and Fordell, Thomas and Halonen, Lauri and Merimaa, Mikko} } @Article { , title = {Global color estimation of special-effect coatings from measurements by commercially available portable multiangle spectrophotometers}, journal = {Journal of the Optical Society of America A}, year = {2014}, month = {12}, day = {3}, volume = {32}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1-11}, keywords = {OCIS codes: (330.1710) Color, measurement; (330.1720) Color vision; (290.1483) BSDF, BRDF, and BTDF.}, web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-1-1}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {OSA}, address = {Washington, DC, USA}, language = {30}, ISSN = {1084-7529 (print), 1520-8532 (online)}, DOI = {10.1364/JOSAA.32.000001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ferrero, A and Campos, J and Perales, E and Mart{\'i}nez-Verd{\'u}, F. M. and van der Lans, I and Kirchner, E} } @Article { RaffaeleLCCVVPPMRT2014, title = {Dosimetric characterization of a synthetic single crystal diamond detector in a clinical 62MeV ocular therapy proton beam}, journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment}, year = {2014}, month = {12}, volume = {767}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {310-317}, keywords = {synthetic diamond detector, proton beam, ocular therapy}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2014.09.004}, stag_bib_extends_levelofaccess = {NA}, author = {Raffaele, L. and La Rosa, R.M. and Cuttone, G. and Cirrone, G.A.P. and Verona-Rinati, G. and Verona, C. and Prestopino, G. and Pompili, F. and Marinelli, M. and Romano, F. and Tuv{\`e}, C.} } @Article { VanermenGPSLGPFEBE2014, title = {Novel concepts for preparation of reference materials as whole water samples for priority substances at nanogram-per-liter level using model suspended particulate matter and humic acids}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, month = {12}, volume = {407}, number = {11}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {3055-3067}, keywords = {Slurry, PBDE, PAH, TBT, Reference materials, Suspended particulate matter, Whole water, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-014-8349-8}, stag_bib_extends_levelofaccess = {NA}, author = {Vanermen, G. and Goenaga-Infante, H. and Petrov, P. and Swart, C. and Lal{\`e}re, B. and Gantois, F. and Philipp, R. and Fettig, I. and Elordui-Zapatarietxe, S. and Boom, G. and Emteborg, H.} } @Article { VaisanenSNL2014, title = {Application of enriched stable196Hg isotope for monitoring the stability of total mercury in water samples}, journal = {International Journal of Environmental Analytical Chemistry}, year = {2014}, month = {11}, day = {24}, volume = {95}, number = {1}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {1-15}, keywords = {-}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Informa UK Limited}, language = {30}, ISSN = {0306-7319, 1029-0397}, DOI = {10.1080/03067319.2014.983493}, stag_bib_extends_levelofaccess = {NA}, author = {V{\"a}is{\"a}nen, T. and Sara-Aho, T. and N{\"a}ykki, T. and Leito, I.} } @Article { RastelloDSKCPSMIKSHKTBMPTACMKV2014, title = {Metrology for industrial quantum communications: the MIQC project}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {10}, keywords = {Metrology, quantum cryptography, quantum communication}, web_url = {http://iopscience.iop.org/0026-1394/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S267}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rastello, M L and Degiovanni, I P and Sinclair, A G and K{\"u}ck, S and Chunnilall, C J and Porrovecchio, G and Smid, M and Manoocheri, F and Ikonen, E and Kubarsepp, T and Stucki, D and Hong, K S and Kim, S K and Tosi, A and Brida, G and Meda, A and Piacentini, F and Traina, P and Al Natsheh, A and Cheung, J Y and M{\"u}ller, I and Klein, R and Vaigu, A} } @Proceedings { VolkelBBW2014, title = {First results in the realization of the unit Watt in airborne sound}, year = {2014}, month = {11}, day = {16}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound Power, Metrology, Traceability}, web_url = {http://www.acoustics.asn.au/conference_proceedings/INTERNOISE2014/papers/p357.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Melbourne, Australia}, event_name = {Internoise - 43rd International Congress on Noise Control Engineering}, event_date = {16 to 19 November 2014}, language = {English}, ISSN = {978-0-909882-02-0}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {V{\"o}lkel, K and Bethke, C and Brezas, S and Wittstock, V} } @Article { , title = {High Aspect Ratio PS‑b‑PMMA Block Copolymer Masks for Lithographic Applications}, journal = {ACS Applied Materials \& Interfaces}, year = {2014}, month = {11}, day = {11}, volume = {6(23)}, number = {2014}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {21389−21396}, keywords = {block copolymer, self-assembly, nanolithography, high aspect-ratio, rapidt hermal processing, PS-b-PMMA}, web_url = {http://pubs.acs.org/doi/abs/10.1021/am506391n}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {ACS Publications Ameican Chemical Society}, address = {Washington}, language = {30}, DOI = {10.1021/am506391n}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrarese Lupi, F. and Giammaria, T.J. and Volpe, F.G. and Lotto, F. and Seguini, G. and Pivac, B. and Laus, M. and Perego, M.} } @Article { , title = {Frequency-comb-referenced tunable diode laser spectroscopy and laser stabilization applied to laser cooling}, journal = {Applied Optics}, year = {2014}, month = {11}, day = {1}, volume = {53}, number = {31}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {7476-7482}, keywords = {Laser stabilization; Lasers, distributed-feedback; Laser cooling; Spectroscopy, diode lasers; Spectroscopy, saturation}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-53-31-7476}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {2155-3165}, DOI = {10.1364/AO.53.007476}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Fordell, T. and Wallin, A.E. and Lindvall, T. and Vainio, M. and Merimaa, M.} } @Article { RoggeroBCVVM2014, title = {QA/QC Procedures for in-Situ Calibration of a High Altitude Automatic Weather Station: The Case Study of the AWS Pyramid, 5050 m asl, Khumbu Valley, Nepal}, journal = {Atmospheric and Climate Sciences}, year = {2014}, month = {11}, volume = {04}, number = {05}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {796-802}, keywords = {Automatic Weather Station, Himalaya, Climate Monitoring, AWSs Calibration, QA/QC Procedure}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Scientific Research Publishing Inc}, language = {30}, ISSN = {2160-0414, 2160-0422}, DOI = {10.4236/acs.2014.45070}, stag_bib_extends_levelofaccess = {NA}, author = {Roggero, G. and Bonasoni, P. and Cristofanelli, P. and Verza, G.P and Vuillermoz, E. and Merlone, A.} } @Article { MaringerSKCPGCDVHRMSJDTAHM2014, title = {Radioactive waste management: Review on clearance levelsand acceptance criteria legislation, requirements and standards}, journal = {Applied Radiation and Isotopes}, year = {2014}, month = {11}, volume = {81}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, keywords = {Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal}, web_url = {http://www.sciencedirect.com/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2013.03.046}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Maringer, F.J. and Šur{\'a}ň, J. and Kov{\'a}ř, P. and Chauvenet, B. and Peyres, V. and Garc{\'i}a-Tora{\~n}o, E. and Cozzella, M.L. and De Felice, P. and Vodenik, B. and Hult, M. and Roseng{\aa}rd, U. and Merimaa, M. and Sz{\"u}cs, L. and Jeffery, C. and Dean, J.C.J. and Tymińsk, Z. and Arnold, D. and Hincam, R. and Mirescu, G.} } @Manual { , title = {Good Practice Guide: Measurement of relative length changes in sample up to 50mm with picometre uncertainty over durations up to 1 week.}, year = {2014}, month = {10}, day = {31}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, keywords = {Picodrift interferometer}, web_url = {http://projects.npl.co.uk/T3D/publications.html}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {van de Nes, A.} } @Article { , title = {Preparation and characterization of poly(lactic acid)/poly(methyl methacrylate) blend tablets for application in quantitative analysis by micro Raman spectroscopy}, journal = {Journal of Raman Spectroscopy}, year = {2014}, month = {10}, day = {8}, volume = {46}, number = {2}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {273-279}, keywords = {poly(lactic acid)/poly(methyl methacrylate) blend; polymer blend; quantification; implant; micro Raman spectroscopy}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/jrs.4603/full}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wiley}, address = {Hoboken}, language = {30}, ISSN = {0377-0486}, DOI = {10.1002/jrs.4603}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vano-Herrera, K. and Misiun, A. and Vogt, C.} } @Article { , title = {Future development of biologically relevant dosimetry}, journal = {British Journal of Radiology}, year = {2014}, month = {9}, day = {26}, volume = {88}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Radiation quantities, biologically relevant dosimetry, microbeam, nanodosimetry, microdosimetry, reactive species, BioQuaRT}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0007-1285}, DOI = {10.1259/bjr.20140392}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Palmans, H. and Rabus, H. and Belchior, A. L. and Bug, M. U. and Galer, S. and Giesen, U. and Gonon, G. and Gruel, G. and Hilgers, G. and Moro, D. and Nettelbeck, H. and Pinto, M. and Pola, A. and Pszona, S. and Schettino, G. and Sharpe, P. H. G. and Teles, P. and Villagrasa, C. and Wilkens, J. J.} } @Article { LerardiBPFVJ2014, title = {Nano-holes as standard leak elements}, journal = {Measurement}, year = {2014}, month = {9}, day = {16}, volume = {58}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {Focused ion beam,Nanotechnology, SEM, STEM, AFM, Standard leak, Gas flow meter, Vacuum Metrology, DSMC.}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1016/j.measurement.2014.09.017}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lerardi, V. and Becker, U. and Pantazis, S. and Firpo, G. and Valbusa, U. and Jousten, K.} } @Article { , title = {G-SIMS analysis of organic solar cell materials}, journal = {Surface and Interface Analysis}, year = {2014}, month = {9}, day = {12}, volume = {1}, number = {46}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {96-99}, keywords = {TOF-SIMS, Gentle-SIMS (G-SIMS), organic solar cell, PC70BM, PCDTBT}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5650/full}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Wiley Online Library}, address = {New Jersey NYC}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.5650}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-9-12}, author = {Franquet, A. and Fleischmann, C. and Conard, T. and Voroshazi, E. and Poleunis, C. and Havelund, R. and Delcorte, A. and Vandervorst, W.} } @Article { WinterOOJvWISN2014, title = {On the RF Heating of Coronary Stents at 7.0 Tesla MRI}, journal = {Magnetic Resonance in Medicine}, year = {2014}, month = {9}, day = {11}, volume = {early view}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {ultrahigh field MR; RF heating; coronary stents; specific absorption rate; RF power deposition}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {english}, ISSN = {1522-2594}, DOI = {10.1002/mrm.25483}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, Lukas and Oberacker, Eva and Ozerdem, Celal {\euro} and Ji, Yiyi and von Knobelsdorff-Brenkenhoff, Florian and Weidemann, Gerd and Ittermann, Bernd and Seifert, Frank and Niendorf, Thoralf} } @Proceedings { MullerMVM2014, title = {MARKERS FOR REFERENCING TOPOGRAPHY MEASUREMENT DATA OF OPTICAL SURFACES}, journal = {58th ILMENAU SCIENTIFIC COLLOQUIUM}, year = {2014}, month = {9}, day = {9}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {markers, coordinate referencing, surface measurement data comparison}, web_url = {http://nbn-resolving.org/urn:nbn:de:gbv:ilm1-2014iwk:3}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Technische Universit{\"a}t Ilmenau}, event_name = {58th ILMENAU SCIENTIFIC COLLOQUIUM}, event_date = {08 – 12 September 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, Andreas and Mastylo, Rostislav and Vorbringer-Dorozhovets, Nataliya and Manske, Eberhard} } @Thesis { , title = {Determination of spring constants in atomic force microscopes}, year = {2014}, month = {9}, day = {3}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, keywords = {atomic force microscopy, spring constant, force measurements, nanomaterials,}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, school = {Aalto University}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://nbn-resolving.de/urn:nbn:fi:aalto-201410062756}, author = {Vesamo, S.} } @Article { , title = {LSMO thin films with high metal–insulator transition temperature on buffered SOI substrates for uncooled microbolometers}, journal = {Applied Surface Science}, year = {2014}, month = {9}, day = {1}, volume = {302}, number = {n/a}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {30-33}, keywords = {LSMO thin films, BTO/CeO2/YSZ buffered SOI substrate, Pulsed laser deposition, TCR coefficienta}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {n/a}, language = {30}, ISSN = {0169-4332}, DOI = {10.1016/j.apsusc.2014.05.051}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Chromik, Š. and Štrb{\'i}k, V. and Dobročka, E. and Roch, T. and Rosov{\'a}, A. and Špankov{\'a}, M. and Lalinsk{\'y}, T. and Vanko, G. and Lobotka, P. and Ralbovsk{\'y}, M. and Choleva, P.} } @Proceedings { vandeNesV2014, title = {PICOMETER RESOLUTION HETERODYNE INTERFEROMETRY FOR SHORT TO MEDIUM TERM DIMENSIONAL STABILITY MEASUREMENTS}, year = {2014}, month = {9}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, keywords = {dimensional stability, picometer uncertainty, optical metrology, displacement interferometry}, web_url = {http://www.db-thueringen.de/servlets/DerivateServlet/Derivate-30965/ilm1-2014iwk-148.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Ilmenau, Germany}, event_name = {58th Ilmenau Scientific Colloquium}, event_date = {2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {van de Nes, A.S. and Voigt, D.} } @Article { , title = {Biologically Weighted Quantities in Radiotherapy: an EMRP Joint Research Project}, journal = {EPJ Web of Conferences}, year = {2014}, month = {8}, day = {19}, volume = {77}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Radiation units, dose, microbeam, nanodosimetry, microdosimetry}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {2100-014X}, DOI = {10.1051/epjconf/20147700021}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rabus, H. and Palmans, H. and Hilgers, G. and Sharpe, P. and Pinto, M. and Villagrasa, C. and Nettelbeck, H. and Moro, D. and Pola, A. and Pszona, S. and Teles, P.} } @Proceedings { , title = {Practical Fabry-Perot displacement interferometry in ambient air conditions with subnanometer accuracy}, journal = {Proceedings of SPIE}, year = {2014}, month = {8}, day = {18}, volume = {9203}, number2 = {SIB08: subnano: Traceability of sub-nm length measurements}, pages = {920308}, keywords = {Fabry-Perot interferometers, interferometry, nanotechnology, calibration, sensors, engineering, refractive index}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {SPIE}, address = {Bellingham}, event_place = {San Diego, CA, USA}, event_name = {SPIE Optics \& Photonics Congress, Interferometry XVII: Techniques and Analysis}, event_date = {17-08-2014 to 21-08-2014}, language = {30}, ISSN = {1996-756X}, DOI = {10.1117/12.2060537}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Voigt, D. and van de Nes, A.S. and van den Berg, S.A.} } @Article { GoveniusLTPJMVM2014, title = {Microwave nanobolometer based on proximity Josephson junctions}, journal = {Physical Review B}, year = {2014}, month = {8}, day = {11}, volume = {90}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, keywords = {74.78.Na, 07.57.Kp, 74.45.+c, 85.25.Cp}, web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.90.064505}, web_url2 = {http://arxiv.org/abs/1403.6586}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {1098-0121}, DOI = {10.1103/PhysRevB.90.064505}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Govenius, J. and Lake, R. E. and Tan, K. Y. and Pietil{\"a}, V. and Julin, J. K. and Maasilta, I. J. and Virtanen, P. and M{\"o}tt{\"o}nen, M.} } @Article { CalamantePhDFIKKORSSv2014, title = {MR System Operator: Recommended Minimum Requirements for Performing MRI in Human Subjects in a Research Setting}, journal = {JOURNAL OF MAGNETIC RESONANCE IMAGING}, year = {2014}, month = {7}, day = {23}, volume = {early view}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {MR safety; research; human; education; training; guidelines}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {english}, ISSN = {1522-2586}, DOI = {10.1002/jmri.24717}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Calamante, PhD, Fernando and Faulkner Jr., BS, RT, William H. and Ittermann, PhD, Bernd and Kanal, MD, Emanuel and Kimbrell, BSRT, Vera and Owman, RT, Titti and Reeder, MD, PhD, Scott B. and Sawyer, BS, RT, Anne M. and Shellock, PhD, Frank G. and van den Brink, PhD on behalf of the ISMRM Safety Committee, Johan S.} } @Article { FalkeLGLWGHHAHVSL2014, title = {A strontium lattice clock with 3 x 10\verb=^=-17 inaccuracy and its frequency}, journal = {New Journal of Physics}, year = {2014}, month = {7}, volume = {16}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {073023}, web_url = {http://iopscience.iop.org/1367-2630/16/7/073023}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, DOI = {10.1088/1367-2630/16/7/073023}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Falke, S and Lemke, N and Grebing, C and Lipphardt, B and Weyers, S and Gerginov, V and Huntemann, N and Hagemann, C and Al-Masoudi, A and Haefner, S and Vogt, S and Sterr, U and Lisdat, C} } @Article { , title = {Feedback control of coherent spin states using weak nondestructive measurements}, journal = {Phys. Rev. A}, year = {2014}, month = {6}, day = {25}, volume = {89}, number = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {063619}, keywords = {37.25.+k,03.67.Pp,03.65.Yz}, web_url = {http://arxiv.org/abs/1405.4749}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1094-1622}, DOI = {10.1103/PhysRevA.89.063619}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vanderbruggen, T and Kohlhaas, R and Bertoldi, A and Cantin, E and Landragin, A and Bouyer, P} } @Article { , title = {Multi-scale analyis of simulated proton and alpha irradiation}, journal = {Radiation Protection Dosimetry}, year = {2014}, month = {6}, day = {10}, volume = {161}, number = {1-4}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {microdosimetry, nanodosimetry, track structure}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0144-8420}, DOI = {10.1093/rpd/ncu187}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bianco, D. and Villagrasa, C. and Dos Santos, M.} } @Proceedings { , title = {Design of the MSc degree in Colour Technology for the Automotive Sector}, journal = {Conference Proceedings of the 13th International Science-to-Business Marketing Conference on Cross Organizational Value Creation}, year = {2014}, month = {6}, day = {2}, volume = {1}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {17-29}, keywords = {Color Technology, Automotive Coatings, Internships, Design Thinking, University-Business cooperation}, web_url = {http://www.s2b-conference.com/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {School of Management and Law}, address = {Fachhochschule M{\"u}nster}, event_place = {Winterthur, Switzerland}, event_name = {13th International Science-to-Business Marketing Conference on Cross Organizational Value Creation}, event_date = {2-4/06/2014}, language = {30}, ISBN = {978-3-938137-57-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mart{\'i}nez-Verd{\'u}, FM and Viquiera, V and Perales, E and Chorro, E} } @Proceedings { , title = {Investigation on the thermal behaviour of an ultra-high precision system used in dimensional metrology}, journal = {Proceedings of the 14th euspen International Conference}, year = {2014}, month = {6}, volume = {1}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {305-308}, keywords = {high precision system, calibration, thermo mechanical, control}, web_url = {http://www.gbv.de/dms/tib-ub-hannover/79045372x.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Dubrovnik}, event_name = {14th euspen international conference}, event_date = {June 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bouderbala, K and Nouira, H and Girault, M and Videcoq, E and Salgado, J and Petit, D} } @Article { , title = {Towards reliable charge-mobility benchmark measurements for organic semiconductors}, journal = {Organic Electronics}, year = {2014}, month = {6}, volume = {15}, number = {6}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1263-1272}, keywords = {Mobility, Space-charge limited current, Injection-limited current, Charge-carrier mobility, Mobility benchmark}, web_url = {http://www.sciencedirect.com/science/article/pii/S1566119914000469}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, ISSN = {1566-1199}, DOI = {10.1016/j.orgel.2014.02.008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Blakesley, JCB and Castro, FAC and Kylberg, WK and Dibb, GFAD and Valaskib, RV and Cremona, WC and Arantes, CA and Kim, JSK and Kim, JSK} } @Article { , title = {A compact new-concept ellipsometer for accurate large scale thin films measurements}, journal = {Journal of Optics}, year = {2014}, month = {5}, day = {8}, volume = {16}, number = {6}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, keywords = {ellipsometry, thin films, large area}, web_url = {http://iopscience.iop.org/article/10.1088/2040-8978/16/6/065701/meta}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {2040-8978}, DOI = {10.1088/2040-8978/16/6/065701}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Koops, RK and Sonin, PS and Veghel, MV and El Gawhary, OEG} } @Article { , title = {Detecting multiparticle entanglement of Dicke states}, journal = {Phys. Rev. Lett.}, year = {2014}, month = {4}, day = {17}, volume = {112}, number = {15}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {155304}, keywords = {67.85.−d, 03.67.Bg, 03.67.Mn, 03.75.Mn}, web_url = {http://arxiv.org/abs/1403.4542v2}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.112.155304}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\"u}cke, B and Peise, J and Vitagliano, G and Arlt, J and Santos, L and T{\'o}th, G and Klempt, C} } @Article { , title = {Do we (need to) care about canopy radiation schemes in DGVMs?}, journal = {Biogeosciences}, year = {2014}, month = {4}, day = {8}, volume = {11}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {1873-1897}, web_url = {http://www.biogeosciences.net/11/1873/2014/bg-11-1873-2014.pdf}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {European Geosciences Union (EGU)}, address = {Munich}, language = {30}, ISSN = {1726-4170}, DOI = {10.5194/bg-11-1873-2014}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Loew, AL and van Bodegom, PMB and Widlowski, JLW and Otto, JO and Quaife, TQ and Pinty, BP and Raddatz, TR} } @Article { , title = {Current Sensing Noise Thermometry: A Fast Practical Solution to Low Temperature Measurement}, journal = {Journal of Low Temperature Physics}, year = {2014}, month = {3}, day = {18}, volume = {175}, number = {5-6}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {764-775}, keywords = {Johnson noise, Fixed point device, Precision, SQUID}, web_url = {http://link.springer.com/article/10.1007/s10909-014-1147-z}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer US}, address = {New York}, language = {30}, ISSN = {1573-7357}, DOI = {10.1007/s10909-014-1147-z}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Casey, A and Arnold, F and Levitin, L V and Lusher, C P and Nyeki, J and Saunders, J and Shibahara, A and van der Vliet, H and Yager, B and Drung, D and Schurig, Th and Batey, G and Cuthbert, M N and Matthews, A J} } @Article { , title = {Thermal conductivity analysis of delaminated thin films by scanning thermal microscopy}, journal = {Measurement Science and Technology}, year = {2014}, month = {3}, volume = {25}, number = {4}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {044022}, keywords = {scanning thermal microscopy, thin films, thermal conductivity}, web_url = {https://www.researchgate.net/publication/260559141_Thermal_conductivity_analysis_of_delaminated_thin_films_by_scanning_thermal_microscopy}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0957-0233/25/4/044022}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Martinek, JM and Valtr, MV and Cimrman, RC and Klapetek, PK} } @Proceedings { , title = {''Multidimensional reflectometry for industry'' (xD-Reflect) an European research project}, journal = {Proceedings of SPIE}, year = {2014}, month = {2}, day = {24}, volume = {9018}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {901804}, keywords = {Reflectometry ; Metrology ; Modeling ; Optical design ; Optical testing ; Bidirectional reflectance transmission function ; CCD cameras ; Calibration ; Data analysis ; Light sources}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835520}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE - The International Society for Optical Engineering}, address = {Bellingham}, event_place = {San Francisco (USA)}, event_name = {Measuring, Modeling, and Reproducing Material Appearance}, event_date = {4-5 February, 2014}, language = {30}, ISBN = {978-0-8194-9935-6}, ISSN = {0277-786X}, DOI = {10.1117/12.2035981}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {H{\"o}pe, A. and Koo, A. and Verdu, F.-M. and Leloup, F.-B. and Obein, G. and W{\"u}bbeler, G. and Campos, J. and Iacomussi, P. and Jaanson, P. and K{\"a}llberg, S. and Smids, M.} } @Proceedings { , title = {Towards a better understanding of the color shift of effect coatings by densely sampled spectral BRDF measurement}, journal = {Measuring, Modeling, and Reproducing Material Appearance 2014}, year = {2014}, month = {2}, day = {2}, volume = {9018}, number = {90180K}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {90180K-1 - 90180K-11}, keywords = {Special effect coatings, spectral BRDF, interference pigments, metallic coatings, rendering, spectrophotometry}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835535}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, address = {Bellingham WA, USA}, event_place = {San Francisco, California, USA}, event_name = {IS\&T/SPIE Electronic Imaging}, event_date = {2-6 February, 2014}, language = {30}, ISBN = {9780819499356}, ISSN = {0277786X}, DOI = {10.1117/12.2036726}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, Alejandro and Bernad, Berta and Campos, Joaqu{\'i}n and Mart{\'i}nez-Verd{\'u}, Francisco M and Perales, Esther and van de Lans, Ivo and kirchner, Eric} } @Article { KivelPGVG2014, title = {Modeling of the plasma extraction efficiency of an inductively coupled plasma-mass spectrometer interface using the direct simulation Monte Carlo method}, journal = {Spectrochimica Acta Part B}, year = {2014}, month = {1}, day = {27}, volume = {B 93}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {34-40}, keywords = {Multi-collector-ICP-MS, Mass discrimination, Shock wave formation, Direct Simulation Monte Carlo, High performance computing}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1016/j.sab.2013.12.010.}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kivel, Niko and Potthast, Heiko-Dirk and G{\"u}nther-Leopold, Ines and Vanhaecke, Frank and G{\"u}nther, Detlef} } @Proceedings { LapuhVKPSL2014, title = {Measurement of Repetitive Arbitrary Waveform RMS Value}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {420 - 421}, keywords = {Asynchronous sampling, arbitrary signals, time-domain windows, estimators, noise.}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898438}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lapuh, Rado and Voljc, Bostjan and Kokalj, Miha and Pinter, Borut and Svetik, Zoran and Lindic, Matjaz} } @Proceedings { , title = {Characterization of hybrid metal/semiconductor electron pumps for quantum metrology}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {442-443}, keywords = {Electron pumps, Cryogenic current comparator, Quantum metrology}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Charron, T. and Devoille, L. and Djordjevic, S. and S{\'e}ron, O. and Piquemal, F. and Clapera, P. and Ray, S. J. and Jehl, X. and Wacquez, R. and Vinet, M.} } @Proceedings { Margolis2014, title = {International Timescales with Optical Clocks}, journal = {Proceedings of European Frequency and Time Forum \& International Frequency Control Symposium (EFTF/IFC)}, year = {2014}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {908-911}, keywords = {geodesy, international timescales, optical clock, redefinition of the second, time and frequency transfer}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6702183}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Prague, Czech Republic}, event_name = {European Frequency and Time Forum \& International Frequency Control Symposium (EFTF/IFC)}, event_date = {21 - 25 July 2013}, language = {English}, DOI = {10.1109/EFTF-IFC.2013.6702183}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Margolis, H. and Godun, R. and Gill, P. and Johnson, L. and Shemar, L. and Whibberley, P. and Calonico, D. and Levi, F. and Lorini, L. and Pizzocaro, M. and Delva, P. and Bize, S. and Achkar, J. and Denker, H. and Timmen, L. and Voigt, C. and Falke, S. and Piester, D. and Lisdat, C. and Sterr, U. and Vogt, S. and Weyers, S. and Gersl, J. and Lindvall, T. and Merimaa, M.} } @Article { PaepenDMPVS2014, title = {A magnet system for the suppression of conversion electrons in alpha spectrometry}, journal = {Applied Radiation and Isotopes}, year = {2014}, volume = {87}, number2 = {ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants}, pages = {320-324}, keywords = {Alpha-particle spectrometry; conversion electrons; manget; Alpha-particle emission probabilities}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804313004430}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2013.11.023}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Paepen, Jan and Dirican, Abdullah and Marouli, Maria and Pomm{\'e}, Stefaan and Van Ammel, Raf and Stroh, Heiko} } @Article { PommeGMCJVPS2014, title = {High-resolutionalpha-particlespectrometryof 238U}, journal = {Applied Radiation and Isotopes}, year = {2014}, volume = {87}, number = {1}, number2 = {ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants}, keywords = {Alpha-particle spectrometry; 238U; Decay data; Alpha-particle emissionprobabilities}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2013.11.075}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pomm{\'e}, Stefaan and Garc{\'i}a-Tora{\~n}o, Eduardo and Marouli, Maria and Crespo, Maria-Teresa and Jobb{\'a}gy, Viktor and Van Ammel, Raf and Paepen, Jan and Stroh, Heiko} } @Article { PeksaGJVSKP2014_2, title = {Implementation of multi-opening orifices in the primary metrology of vacuums and small gas throughputs}, journal = {Vacuum}, year = {2014}, volume = {101}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {orifice, multi-opening-orifice, orifice flow standard, gas throughput}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0042-207X/$}, DOI = {10.1016/j.vacuum.2013.10.014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Peksa, Ladislav and Gronych, Tom{\'a}š and Jeř{\'a}b, Martin and Vičar, Martin and Staněk, František and Kraj{\'i}ček, Zdeněk and Praž{\'a}k, Dominik} } @Article { VargasNVPJ2014, title = {Time-dependent rarefied gas flow on single gases and binary gas mixtures into vacuum.}, journal = {Vacuum}, year = {2014}, volume = {109}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {Unsteady vacuum gas dynamics, Binary mixtures, Gas separation, DSMC, Hybrid models, Rarefied gas dynamics.}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1016/j.vacuum.2014.06.024}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Vargas, Manuel and Naris, Steryios and Valougeorgis, Dimitris and Pantazis, Sarantis and Jousten, Karl} } @Proceedings { ClaperaRJSVB2014, title = {A quantum device driven by an on-chip CMOS ring oscillator}, journal = {Low Temperature Electronics (WOLTE), 2014 11th International Workshop on, IEEE}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {73 to 76}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6881029\&pageNumber\%3D42493\%26rowsPerPage\%3D75}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Grenoble}, event_name = {11th International Workshop On Low Temperatures Electronics}, event_date = {7-9 July 2014}, language = {English}, DOI = {10.1109/WOLTE.2014.6881029}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Clapera, P and Ray, S and Jehl, X and Sanquer, M and Valentian, A and Barraud, S} } @Proceedings { VolkelSW2014, title = {Analytical and Numerical Investigation of the Sound Power Emission of a Vibrating Baffled Piston Into a Hemi-Anechoic Room}, year = {2014}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, pages = {794 to 795}, keywords = {Circular piston, Sound Power, Hemianechoic room.}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Oldenburg, Germany}, event_name = {Annual German Congress on Acoustics (DAGA 2014)}, event_date = {10 to 13 March 2014}, ISBN = {978-3-939296-06-5}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {V{\"o}lkel, K and Schmelzer, M and Wittstock, V} } @Article { GonzalezGagoSVHH2014, title = {The use of matrix-specific calibrations for oxygen in analytical glow discharge spectrometry}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, keywords = {GD-OES. GD-MS. Glow discharge analysis. Oxygen determination}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1007/s00216-014-8186-9}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gonzalez-Gago, C. and Smid, P. and Venzago, C. and Hofmann, T. and Hoffmann, V.} } @Proceedings { KohlmannBKDSSTGMJONLIWLVBECHvO2014, title = {A quantum standard for sampled electrical measurements - main goals and first results of the EMRP project Q-WAVE}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {522 - 523}, keywords = {AC Josephson voltage standards European Metrology Research Programme (EMRP) binary-divided Josephson series arrays pulse-driven Josephson series arrays}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898489}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kohlmann, J. and Behr, R. and Kieler, O. and Diaz de Aguilar Rois, J. and Sira, M. and Sosso, A. and Trinchera, B. and Gran, J. and Malmbekk, H. and Jeanneret, B. and Overney, F. and Nissil{\"a}, J. and Lehtonen, T. and Ireland, J. and Williams, J. and Lapuh, R. and Voljc, B. and Bergsten, T. and Eklund, G. and Coskun Ozturk, T. and Houtzager, E. and van den Brom, H.E. and Ohlckers, P.} } @Article { VorbringerDorozhovetsGMFHM2014, title = {Multifunctional nanoanalytics and long-range scanning probe microscope using a nanopositioning and nanomeasuring machine}, journal = {Meas. Sci. Technol.}, year = {2014}, volume = {25}, number = {044006}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, keywords = {nanopositioning and nanomeasuring machine, metrological scanning probe microscope, AFM, electromagnetic changer for SPM probes, fiducial marks}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, DOI = {10.1088/0957-0233/25/4/044006}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Vorbringer-Dorozhovets, N and Goj, B and Machleidt, T and Franke, K-H and Hoffmann, M and Manske, E} } @Proceedings { , title = {Determination of metrological structural resolution of a CT system using the frequency response on surface structures}, journal = {Macroscale 2014}, year = {2014}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, keywords = {dimensional metrology, computed tomography, structural resolution, frequency response, spatial frequency}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Vienna}, event_name = {Macroscale 2014}, event_date = {28-30 October, 2014}, language = {30}, DOI = {10.7795/810.20150223B}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Fle{\ss}ner, Matthias and Vujaklija, Nemanja and Helmecke, Eric and Hausotte, Tino} } @Proceedings { , title = {xD-Reflect - ''Multidimensional Reflectometry for Industry'' a research project of the European Metrology Research Program (EMRP)}, journal = {Proceedings of NEWRAD 2014}, year = {2014}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {295-297}, web_url = {http://newrad2014.aalto.fi/Newrad2014_Proceedings.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Seongchong Park}, address = {Yuseong-gu}, event_place = {Helsinki}, event_name = {NEWRAD 2014}, event_date = {2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}pe, A. and Koo, A. and Forthmann, C. and Verd{\'u}, F. M. and Manoocheri, F. and Leloup, F. B. and Obein, G. and W{\"u}bbeler, G. and Ged, G. and Campos, J. and Hauer, K. O. and Yang, L. and Šm{\'i}d, M. and Langovoy, M. and Iacomussi, P. and Jaanson, P. and K{\"a}llberg, S.} } @Article { , title = {Interferometer-based scanning probe microscope for high-speed, long-range, traceable measurements}, journal = {PAK}, year = {2014}, volume = {60}, number = {02 (2014)}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {069-072}, keywords = {nanopositioning and nanomeasuring machine, metrological scanning probe microscope, SPM, AFM}, web_url = {http://pak.info.pl/index.php?menu=artykulSzczegol\&idArtykul=3967}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {PAK}, address = {Gliwice}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Vorbringer-Dorozhovets, N. and Manske, E. and J{\"a}ger, G.} } @Proceedings { , title = {Towards Quantum Resistance Metrology Based on Graphene}, journal = {The EMRP Project GraphOhm - Towards Quantum Resistance Metrology Based on Graphene}, year = {2014}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {548-549}, keywords = {Measurement standards, resistance, quantum hall effect, graphene, C, Calibration, EMRP project GraphOhm, Electrical resistance measurement, Hall effect devices, JRP, Materials, Metrology, Resistance, Standards, electric resistance measurement, electrical measurement, intrinsically referenced resistance standard disse, joint research project, quantum resistance metrology standard, semiconductor quantum Hall device}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898502}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_date = {24-29 Aug. 2014}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898502}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ahlers, F. and Kučera, J. and Poirier, W. and Jeanneret, B. and Satrapinski, A. and Tzalenchuk, A. and Vrabček, P. and Bergsten, T. and Hwang, C. and Yakimova, R. and Kubatkin, S.} } @Article { , title = {Effect of Impurities on Water Triple Point Cells}, journal = {International Journal of Thermophysics}, year = {2014}, volume = {35}, number = {-}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {1084-1096}, keywords = {Impurities; Raoult’s law; Water triple point cells;}, web_url = {http://link.springer.com/article/10.1007/s10765-014-1702-5}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer US}, address = {-}, language = {30}, ISSN = {ISSN: 1572-9567}, DOI = {10.1007/s10765-014-1702-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Peruzzi, A. and Dobre, M. and van Geel, J. and Uytun, A. and Kalemci, M. and Uysa, E. and Strouse, G. and Davis, C.} } @Article { , title = {Time domain methods for the analysis of conducted interference on the power supply network of complex installations}, journal = {Proceedings of the 2014 International Symposium on EMC (EMC Europe) Gothenburg, Sweden}, year = {2014}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {605-610}, keywords = {power drive system; time variant periodic asynchronous; EFT; 150 kHz; LV-network; time-domain measurements}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6930977}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {2325-0356}, DOI = {10.1109/EMCEurope.2014.6930977}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {van Leersum, B.J.A.M. and Timens, R.B. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { SantoniPPPMMGFDBTVV2013, title = {Radiotherapy electron beams collimated by small tubular applicators: characterization by silicon and diamond diodes}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {11}, volume = {58}, number = {22}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {8121-8133}, keywords = {electron beam, applicators, radiotherapy, silicon diode, diamond detector}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/58/22/8121}, stag_bib_extends_levelofaccess = {NA}, author = {Santoni, R and Prestopino, G and Pompili, F and Pimpinella, M and Milani, E and Marinelli, M. and Guerra, A S and Falco, M D and Di Venanzio, C and Bagal{\`a}, P and Tonnetti, A and Verona, C and Verona-Rinati, G} } @Proceedings { , title = {Novel mathematical and statistical approaches to uncertainty evaluation in the context of regression and inverse problems}, journal = {16th International Congress of Metrology}, year = {2013}, month = {10}, day = {7}, volume = {-}, number = {2013}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {04003}, keywords = {-}, tags = {MAT}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_04003.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {EDP Sciences}, address = {Les Ulis \& London}, event_place = {Paris}, event_name = {16th International Congress of Metrology}, event_date = {07-10-2013 to 10-10-2013}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/201304003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Elster, C and Klauenberg, K and B{\"a}r, M and Allard, A and Fischer, N and Kok, G and van der Veen, A and Harris, P and Cox, M and Smith, I and Cowen, S and Wilson, P and Ellison, S} } @Article { , title = {HiTeMS: A pan-European project to solve high temperature measurement problems in industry}, journal = {AIP Conf. Proc. 1552}, year = {2013}, month = {9}, day = {11}, volume = {8}, number = {958}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {958-963}, keywords = {Industrial high temperature measurement, radiation thermometry, high temperature thermocouples, high temperature fixed points}, web_url = {http://www.npl.co.uk/content/ConPublication/5950}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {AIP Publishing LLC}, address = {1305 Walt Whitman Rd Suite 300, Melville, NY 11747, United States}, language = {30}, ISSN = {978-0-7354-1178-4}, DOI = {10.1063/1.4821414}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31}, author = {Machin, G and Anhalt, K and Edler, F and Pearce, J and Sadli, M and Strnad, R and Veulban, E} } @Article { BertrandCCRLTSPRV2013, title = {Conversion from dose-to-graphite to dose-to-water in an 80 MeV/A carbon ion beam}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {7}, day = {23}, volume = {58}, number = {16}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {5363-5380}, keywords = {carbon ion beam, graphite to water dose conversion}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/58/16/5363}, stag_bib_extends_levelofaccess = {NA}, author = {Bertrand, D and Cuttone, G and Cirrone, P and Romano, F and Lee, N and Thomas, R and Shipley, D and Palmans, H and Rossomme, S and Vynckier, S} } @Article { GeorgJCESPBHVA2013, title = {Dosimetry auditing procedure with alanine dosimeters for light ion beam therapy}, journal = {Radiotherapy and Oncology}, year = {2013}, month = {7}, volume = {108}, number = {1}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {99-106}, keywords = {Alanine; Audit; Carbon ions; Dosimetry; Protons}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/j.radonc.2013.04.029}, stag_bib_extends_levelofaccess = {NA}, author = {Georg, D. and J{\"a}kel, O. and Chaudhri, N. and Ecker, S. and Sharpe, P. and Palmans, H. and Bassler, N. and Herrmann, R. and Vatnitsky, S. and Ableitinger, A.} } @Article { , title = {Feedback control of trapped coherent atomic ensembles}, journal = {Phys. Rev. Lett.}, year = {2013}, month = {5}, day = {23}, volume = {110}, number = {21}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {210503}, keywords = {03.67.-a, 03.65.Yz, 37.30.+i}, web_url = {http://arxiv.org/abs/1207.3203}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.110.210503}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vanderbruggen, T and Kohlhaas, R and Bertoldi, A and Bernon, S and Aspect, A and Landragin, A and Bouyer, P} } @Article { MierRCV2013, subid = {2691}, title = {Magnetic and electric antennas calibration for partial discharge charge estimation in gas-insulated substations}, journal = {International Journal of Electrical Power and Energy Systems}, year = {2013}, month = {4}, day = {22}, volume = {141}, number = {October 20}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, keywords = {Partial discharges, Calibration, PD sensors, Gas-insulated substations, Charge}, tags = {SEG}, web_url = {https://authors.elsevier.com/sd/article/S0142-0615(22)00256-3}, misc2 = {EMPIR 2019: Energy}, publisher = {Elsevier}, language = {30}, ISSN = {0142-0615}, DOI = {10.1016/j.ijepes.2022.108226}, stag_bib_extends_levelofaccess = {NA}, author = {Mier, C. and Rodrigo Mor, A. and Castro, L. and Vaessen, P.} } @Article { AntonKKVGZM2013, title = {Difference in the relative response of the alanine dosimeter to megavoltage x-ray and electron beams}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {3}, day = {24}, volume = {58 (2013)}, number = {10}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {3259 - 3282}, keywords = {EPR, alanine, response, dosimetry, absorbed dose to water, megavoltage x-rays, high energy electrons}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {0031-9155 (print) ; 1361-6560 (online)}, DOI = {10.1088/0031-9155/58/10/3259}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Anton, Mathias and Kapsch, Ralf-Peter and Krauss, Achim and Voigts-Rhetz, Philip von and Giessen-Friedberg, Giessen and Zink, Klemens and McEwen, Malcolm} } @Article { , title = {An experimental system for the study of ultrasound exposure of isolated blood vessels}, journal = {PHYSICS IN MEDICINE AND BIOLOGY}, year = {2013}, month = {3}, day = {12}, volume = {58}, number = {7}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {2281-2304}, keywords = {Ultrasound, HIFU, blood vessels}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/23478592}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP publishing}, address = {Bristol}, language = {30}, ISSN = {N/A}, DOI = {10.1088/0031-9155/58/7/2281}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tokarczyk, A and Rivens, I and Van Bavel, E and Symonds-Tayler, R and Ter Haar, G} } @Article { BagalaFVVPMMDSP2013, title = {Characterization of a synthetic single crystal diamond Schottky diode for radiotherapy electron beam dosimetry}, journal = {Medical Physics}, year = {2013}, month = {1}, day = {24}, volume = {40}, number = {2}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {021712}, keywords = {electron beam dosimetry, synthetic diamond detector}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4774360}, stag_bib_extends_levelofaccess = {NA}, author = {Bagal{\`a}, P. and Falco, M. D. and Verona-Rinati, G. and Verona, C. and Prestopino, G. and Milani, E. and Marinelli, M. and Di Venanzio, C. and Santoni, R. and Pimpinella, M.} } @Article { JehlVCCRRSDDWV2013, title = {Hybrid Metal-Semiconductor Electron Pump for Quantum Metrology}, journal = {Physical Review X}, year = {2013}, volume = {3}, number = {021012}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {021012-1 - 021012-7}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, ISSN = {1098-0121}, DOI = {10.1103/PhysRevX.3.021012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Jehl, X. and Voisin, B. and Charron, T. and Clapera, P. and Ray, S. and Roche, B. and Sanquer, M. and Djordjevic, S. and Devoille, L. and Wacquez, R. and Vinet, M.} } @Article { NowyVNBG2013, title = {Development of monitoring sources based on UV light-emitting diodes}, journal = {UV News: Newsletter of the Thematic Network for Ultraviolet Measurements}, year = {2013}, number = {9}, number2 = {ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation}, web_url = {http://metrology.tkk.fi/uvnet/reports.htm}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {1456-2537}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nowy, S. and Van Hung, N. and Nevas, S. and Blattner, P. and Gr{\"o}bner, J.} } @Proceedings { AlexandrescuV2013, title = {On-site Power Quality Measurements in a Photovoltaic System Connected with the Distribution Network}, journal = {Proceedings of The 9th International Conference on Measurement}, year = {2013}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, keywords = {Power Quality, Photovoltaic System, Distribution Network Grid, Harmonics, Voltage Unbalance}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Smolenice, Slovakia}, event_name = {The 9th International Conference on Measurement}, event_date = {27 - 30 May 2013}, language = {English}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Alexandrescu, D. and Vrabcek, P.} } @Proceedings { IerardiFV2013, title = {Nano-holes for vacuum applications}, journal = {Journal of Physics: Conference Series}, year = {2013}, volume = {439}, number = {012033}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, web_url = {http://iopscience.iop.org/1742-6596/439/1/012033}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP}, event_place = {Islamabad, Pakistan}, event_name = {6th Vacuum and Surface Sciences Conference of Asia and Australia}, event_date = {9 - 13 October 2012}, language = {English}, DOI = {10.1088/1742-6596/439/1/012033}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ierardi, V. and Firpo, G. and Valbusa, U.} } @Article { JobbagyTVMMPG2013, title = {Preparation of high-resolution 238U \(\alpha\)-sources by electrodeposition: a comprehensive study}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2013}, volume = {298}, number2 = {ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants}, pages = {345-352}, keywords = {238U, High-resolution alpha-spectrometry, Alpha-emission probability, Electrodeposition}, web_url = {http://rd.springer.com/article/10.1007\%2Fs10967-013-2444-8\#}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, ISSN = {0236-5731}, DOI = {10.1007/s10967-013-2444-8}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Jobb{\'a}gy, V. and Teresa Crespo, M. and Van Ammel, R. and Marouli, M. and Moens, A. and Pomm{\'e}, S. and Garc{\'i}a-Tora{\~n}o, E.} } @Proceedings { MerloneLABBBdDDEGGHHJKKMMMdSSSSSV2013, title = {A new challenge for meteorological measurements: The ''MeteoMet'' project - Metrology for meteorology}, journal = {AIP Conference Proceedings}, year = {2013}, volume = {8}, number = {1552}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {1030-1035}, keywords = {air humidity, air pressure, air temperature, air speed and direction, historical temperature data series, meteorological instruments calibration, traceable climate measurements}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821419}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Los Angeles (USA)}, event_name = {9th International Temperature Symposium}, event_date = {19-23 March 2012}, DOI = {10.1063/1.4821419}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Merlone, A. and Lopardo, G. and Antonsen, I. and Bell, S. and Benyon, R and Boese, N. and del Campo, D. and Dobre, M. and Drnovsek, J. and Elkatmis, A. and Georgin, E. and Grudniewicz, E. and Heinonen, M. and Holstein-Rathlou, C. and Johansson, J. and Klason, P. and Knorova, R. and Melvad, C. and Merrison, J. and Migaa, K. and de Podesta, M. and Saathoff, H. and Smorgon, D. and Sparasci, F. and Strnad, R. and Szmyrka-Grzebyk, A. and Vuillermoz, E.} } @Article { VargasNVPJ2013, title = {Hybrid modeling of time-dependent rarefied gas expansion}, journal = {Journal of Vacuum Science and Technology A}, year = {2013}, volume = {32}, number = {2}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {vacuum, kinetic theory, Knudsen number, dynamic gas espansion, hybrid modeling}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1116/1.4830283}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Vargas, Manuel and Naris, Steryios and Valougeorgis, Dimitris and Pantazis, Sarantis and Jousten, Karl} } @Article { PraakZTP2013, title = {Perspectives of atmospheric reference leaks calibration by gravimetric method}, journal = {Measurement}, year = {2013}, volume = {46}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, pages = {621-627}, keywords = {vacuum leak; atmospheric leak; vacuum weighing; mass comparator}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2012.08.021}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Praž{\'a}k, D. and Zůda, J. and Tesař, J. and Peksa, L and Vicar, M.} } @Proceedings { WintervOHSMGSMN, title = {Hybrid MRI/RF-Heating at 7.0 Tesla and 11.7 Tesla: Electro-Magnetic Field Simulations, Temperature Simulations/Measurements, Dipole Antenna Design and Heating Experiments}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2013}, volume = {21}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/13/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Salt Lake City, USA}, event_name = {ISMRM 21st Annual Meeting \& Exhibition 2013}, event_date = {20-26 April 2013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, Lukas and van de Lindt, Tessa and {\"O}zerdem, Celal and Hoffmann, Werner and Santoro, Davide and Mueller, Alexander and Graessl, Andreas and Seemann, Reiner and Marek, Jaroslav and Niendorf, Thoralf} } @Article { , title = {A Transfer Function Approach to Studying the Size-of-Source and Distance Effects in Radiation Thermometry}, journal = {AIP Conference Proceedings}, year = {2013}, volume = {1552}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {672-677}, keywords = {transfer function, size-of-source effect}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4819622}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {AIP Publishing}, address = {New York}, language = {30}, ISSN = {978-0-7354-1178-4}, DOI = {10.1063/1.4819622}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31}, author = {Vuelban, E.M. and Dekker, P.R.} } @Proceedings { VoigtB2012, title = {Dimensional Stability Validation and Sensor Calibration with Sub-nanometer Accuracy}, year = {2012}, month = {10}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, keywords = {Optical metrology; dimensional stability; sensor calibration; displacement interferometry}, web_url = {http://www.congrexprojects.com/custom/icso/2012/papers/FP_ICSO-123.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Ajaccio, France}, event_name = {International Conference on Space Optics}, event_date = {2012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Voigt, Dirk and Bergmans, Rob H.} } @Proceedings { HoutzagerRHEv2012, title = {Selection and characterization of resistors for a HVDC reference divider}, journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2012}, year = {2012}, day = {1}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {HVDC, resistors, metrology, voltage coefficient, temperature coefficient, high-voltage techniques, resistance measurement}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {IEEE}, event_place = {Washington DC, USA}, event_name = {CPEM 2012}, event_date = {01 - 06 July 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Houtzager, E. and Rietveldt, G. and H{\"a}llstr{\"o}m, J. and Elg, A.-P. and van der Beek, J. H. N.} } @Article { PoglianoBVL2012, title = {Software Platform for PMU Algorithm Testing}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2012}, volume = {62}, number = {6}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, pages = {412-413}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2013.2239051}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pogliano, U. and Braun, J. and Voljc, B. and Lapuh, R.} } @Article { PollingerHVDAMM2012, title = {Effective humidity in length measurements: comparison of three approaches}, journal = {Measurement Science and Technology}, year = {2012}, volume = {23}, number = {2}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {025502-025503}, web_url = {http://stacks.iop.org/MST/23/025503}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pollinger, F. and Hieta, T. and Vainio, M. and Doloca, N. R. and Abou-Zeid, A. and Meiners-Hagen, K. and Merimaa, M.} } @Proceedings { BosMv2012, title = {Trinano N100 3D Measurements with Nanometer Repeatability and Effects of Probe-Surface Interaction}, journal = {Proceedings of the 27th Annual Meeting of the American Society for Precision Engineering}, year = {2012}, volume = {54}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {85-88}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Diego, CA USA}, event_name = {27th Annual Meeting of the American Society for Precision Engineering}, event_date = {21 - 26 October 2012}, language = {English}, ISBN = {978-1-887706-61-2}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bos, E. and Moers, A. and van Riel, M.} } @Proceedings { VolkersB2012, title = {The influence of source impedance on charge amplifier}, journal = {Proceedings of the XX IMEKO World Congress : Metrology for Green Growth}, year = {2012}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, web_url = {http://www.imeko.org/publications/wc-2012/IMEKO-WC-2012-TC22-O6.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Busan, Republic of Korea}, event_name = {XX IMEKO World Congress : Metrology for Green Growth}, event_date = {9 - 14 September 2012}, ISBN = {978-89-9500005-2}, DOI = {10.21014/acta_imeko.v2i2.81}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Volkers, H. and Bruns, T.} } @Article { BriscoeSVCWD2012, title = {Nanostructured p-n Junctions for Kinetic-to-Electrical Energy Conversion}, journal = {Advanced Energy Materials}, year = {2012}, volume = {2}, number2 = {ENG02: Harvesting: Metrology for Energy Harvesting}, pages = {1261-1268}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Briscoe, J. and Stewart, M. and Vopson, M. and Cain, M. and Weaver, P. and Dunn, S.} } @Article { VillamarinFPCRHVC2012, title = {Distribuci{\'o}n angular de la intensidad radiante espectral de LEDs blancos de alta luminosidad - Angular and spectral radiant intensity distribution of high brightness white LEDS}, journal = {Optica Pura y Aplicada}, year = {2012}, volume = {45}, number = {2}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, pages = {131-136}, keywords = {LEDs, Gonio‐Spectro‐Photometer, Luminous Intensity, LED Angular Distribution, LED Emission, Spectral Distribution, High Brightness, White LEDs}, web_url = {http://www.scopus.com/inward/record.url?eid=2-s2.0-84871420576\&partnerID=65\&md5=a928625cebaaaba8080da7225160b9ff}, misc2 = {EMRP A169: Call 2009 Energy}, language = {Spanish}, ISSN = {2171-8814}, DOI = {10.7149/OPA.45.2.131}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Villamarin, A. and Ferrero, A. and Pons, A. and Campos, J. and Rabal, A. and Hernanz, M. and Vel{\'a}squez, J. and Corrons, A.} } @Inbook { VelasquezCPFH2013, title = {Dise{\~n}o de un medidor mes{\'o}pico}, year = {2012}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, keywords = {Visi{\'o}n mes{\'o}pica, medidor mes{\'o}pico, fotometr{\'i}a mes{\'o}pica}, misc2 = {EMRP A169: Call 2009 Energy}, editor = {Joaquin Campos, Esther Perales and Rafael Huertas}, publisher = {Copicentro Granada S.L.}, booktitle = {Ciencia y Tecnolog{\'i}a del Color}, language = {Spanish}, ISSN = {978-84-15536-60-4}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Vel{\'a}squez, J. and Campos, J. and Pons, A. and Ferrero, A. and Hernanz, M.} } @Proceedings { VillamarinVPFCH2013, title = {Estudio de la iluminancia en funci{\'o}n de la distancia de LEDs de alta luminosidad}, journal = {Proceedings of X Reuni{\'o}n Nacional de {\'O}ptica}, year = {2012}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Zaragoza, Spain}, event_name = {X Reuni{\'o}n Nacional de {\'O}ptica}, event_date = {04 September 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Villamarin, A. and Vel{\'a}squez, J. and Pons, A. and Ferrero, A. and Campos, J. and Hermanz, M.} } @Article { LopezBRVSS2012, title = {LED near-field goniophotometer at PTB}, journal = {Metrologia}, year = {2012}, volume = {49}, number = {2}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, web_url = {http://iopscience.iop.org/0026-1394/49/2/S141}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, ISSN = {ISSN 0026-1394}, DOI = {10.1088/0026-1394/49/2/S141}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {L{\'o}pez, M. and Bredemeier, K. and Rohrbeck, N. and V{\'e}ron, C. and Schmidt, F. and Sperling, A.} } @Article { VandeWieleMVBDD2012, title = {A micromagnetic study of the reversal mechanism in permalloy antidot arrays}, journal = {Journal of Applied Physics}, year = {2012}, volume = {111}, number = {5}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, pages = {053915 - 053915-9}, keywords = {Micromagnetic modelling, Magnetic nanostructures, Magnetization reversal, Patterned films, Numerical models}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0021-8979 (print) 1089-7550 (online)}, DOI = {10.1063/1.3689846}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Van de Wiele, B. and Manzin, A. and Vansteenkiste, A. and Bottauscio, O. and Dupr{\'e}, L. and De Zutter, D.} } @Article { KipphardtSSGFDBMBRV2012, title = {Primary Standards for Challenging Elements - Joint Research Project EMRP-SIB09}, journal = {Metrologie Revue}, year = {2012}, volume = {59}, number = {3/4}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, keywords = {Primary standard, elemental calibration solutions, metrology in chemistry, traceability.}, web_url = {http://www.inm.ro/pdf/2012-3-4-03-etaloane-primare.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kipphardt, H. and Schiel, D. and Sargent, M. and Goenaga-Infante, H. and Fisicaro, P. and D’Agostino, G. and Bergamasch, L. and M{\'a}ri{\'a}ssy, M. and Buzoianu, M. and Richter, S. and Vogl, J.} } @Proceedings { FluggeBJMPRSSSVV2012, title = {The EMRP Project ''Thermal design and dimensional drift''}, year = {2012}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Stockholm, Sweden}, event_name = {Proceedings of the 12th euspen International Conference}, event_date = {June 2012}, ISBN = {978-0-9566790-0-0}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Fl{\"u}gge, J. and Beckert, E. and Jennett, N. and Maxwell, T. and Petit, D. and Rudtsch, S. and Salgado, J. and Schalles, M. and Sch{\"o}del, R. and Voigt, D. and Voigt, M.} } @Proceedings { BodermannBDBSKWKHKvYSEBS2011, title = {Joint Research on Scatterometry and AFM Wafer Metrology}, journal = {AIP Conference Proceedings}, year = {2011}, month = {11}, day = {10}, volume = {1395}, number = {319 (2011)}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, CD metrology, AFM, reference standard, rigorous modelling, inverse diffraction problem}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {American Institute of Physics}, event_place = {Grenoble, France}, event_name = {International Conference on Frontiers of Characterisation and Metrology for Nanoelectronics FCMN 2011}, event_date = {23-26 May 2011}, language = {30}, DOI = {10.1063/1.3657910}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bodermann, B. and Buhr, E. and Danzebrink, H.-U. and B{\"a}r, M. and Scholze, F. and Krumrey, M. and Wurm, M. and Klapetek, P. and Hansen, P.-E. and Korpelainen, V. and van Veghel, M. and Yacoot, A. and Siitonen, S. and El Gawhary, O. and Burger, S. and Saastamoinen, T.} } @Article { PramannRSGV2011, title = {Novel concept for the mass spectrometric determination of absolute isotopic abundances with improved measurement uncertainty: Part 3—Molar mass of silicon highly enriched in 28Si}, journal = {International Journal of Mass Spectrometry}, year = {2011}, month = {8}, day = {1}, volume = {305}, number = {1}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, keywords = {Molar mass, Silicon, MC-ICP-MS, Isotope dilution mass spectrometry, Measurement uncertainty, Avogadro constant}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pramann, A. and Rienitz, O. and Schiel, D. and Guettler, B. and Valkiers, S.} } @Article { RietveldvH2011, title = {DC Characterization of AC Current Shunts for Wideband Power Applications}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2011}, month = {7}, volume = {60}, number = {7}, number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques}, pages = {2191-2194}, keywords = {Current shunts , current , environmental factors , measurement standards , power coefficient , power measurements , stability , temperature coefficient}, tags = {SEG}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, Gert and van der Beek, J.H.N. and Houtzager, Ernest} } @Article { BoscoGLPRTVN2011, title = {Phase Comparison of High-Current Shunts uo to 100 kHz}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2011}, month = {7}, volume = {60}, number = {7}, number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques}, pages = {2359-2365}, tags = {SEG}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bosco, Gian Carlo and Garcocz, Martin and Lind, Kare and Pogliano, Umberto and Rietveld, Gert and Tarasso, Valter and Voljc, Bostjan and Novakova Zachovalova, Vera} } @Article { AndreasABBBBBFFFKKKMNPPRSVWZ2011, title = {Counting the atoms in a 28Si crystal for a new kilogram definition}, journal = {Metrologia}, year = {2011}, month = {3}, day = {22}, volume = {48}, number = {2}, number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram}, keywords = {Avogadro constant, kilogram redefinition, silicon, XRCD method}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0026-1394/48/2/S01}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Andreas, B. and Azuma, Y. and Bartl, G. and Becker, P. and Bettin, H. and Borys, M. and Busch, I. and Fuchs, P. and Fujii, K. and Fujimoto, H. and Kessler, E. and Krumrey, M. and Kuetgens, U. and Mizushima, N. and Nicolaus, A. and Picard, A. and Pramann, A. and Rienitz, O. and Schiel, D. and Valkiers, S. and Waseda, A. and Zakel, S.} } @Article { PramannRSSGV2011, title = {Molar mass of silicon highly enriched in 28Si determined by IDMS}, journal = {Metrologia}, year = {2011}, month = {3}, day = {22}, volume = {48}, number = {2}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, keywords = {Molar mass, Silicon, Isotope dilution mass spectrometry}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0026-1394/48/2/S03}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pramann, A. and Rienitz, O. and Schiel, D. and Schlote, J. and Guettler, B. and Valkiers, S.} } @Article { ValkiersMFB2011, title = {Si primary standards for the calibration of ion-current ratios in the molar-mass measurement of natural Si single crystals}, journal = {Metrologia}, year = {2011}, month = {3}, day = {22}, volume = {48}, number = {2}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, keywords = {Molar mass, Silicon, isotope amount ratios}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0026-1394/48/2/S04}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Valkiers, S. and Mana, G. and Fujii, K. and Becker, P.} } @Article { BulskaDMPRSV2011, title = {The isotopic composition of enriched Si: a data analysis}, journal = {Metrologia}, year = {2011}, month = {3}, day = {22}, volume = {48}, number = {2}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, keywords = {Molar mass, Silicon, isotopic composition, gas mass spectrometry, MC-ICP-MS}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0026-1394/48/2/S05}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bulska, E. and Drozdov, M. N. and Mana, G. and Pramann, A. and Rienitz, O. and Sennikov, P. and Valkiers, S.} } @Article { HughesFLSVN2011, title = {Laser tracker error determination using a network measurement}, journal = {Measurement Science and Technology}, year = {2011}, month = {3}, volume = {22}, number = {045103}, number2 = {T3.J2.2: NIMTech: Metrology for New Industrial Measurement Technologies}, pages = {12pp.}, misc2 = {iMERA-Plus: Call 2007 Length}, DOI = {10.1088/0957-0233/22/4/045103}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hughes, B. and Forbes, A. and Lewis, A. and Sun, W. and Veal, D. and Nasr, K.} } @Article { ParedisCFBWCVC2011, subid = {1224}, title = {Nanoscale 3D characterisation of soft organic material using conductive scanning probe tomography}, journal = {AIP Advances}, year = {2011}, month = {2}, day = {19}, volume = {9}, number = {2}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {025105}, keywords = {conductive AFM, organic semiconductor, nanostructure, scanning probe tomography, nanowire}, web_url = {https://aip.scitation.org/doi/full/10.1063/1.5066458}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP publishing}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/1.5066458}, stag_bib_extends_levelofaccess = {NA}, author = {Chintala, R.C. and Wood, S. and Blakesley, J.C. and Favia, P. and Celano, U. and Paredis, K. and Vandervorst, W. and Castro, F.A.} } @Article { AndreasABBBBBGFFFKKKKMMMMNPPRSVW2011, title = {Determination of the Avogadro Constant by Counting the Atoms in a 28Si Crystal}, journal = {Physical Review Letters}, year = {2011}, month = {1}, day = {21}, volume = {106}, number = {3}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, keywords = {Avogadro constant, kilogram redefinition, silicon, XRCD method}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Andreas, B. and Azuma, Y. and Bartl, G. and Becker, P. and Bettin, H. and Borys, M. and Busch, I. and Gray, M. and Fuchs, P. and Fujii, K. and Fujimoto, H. and Kessler, E. and Krumrey, M. and Kuetgens, U. and Kuramoto, N. and Mana, G. and Manson, P. and Massa, E. and Mizushima, S. and Nicolaus, A. and Picard, A. and Pramann, A. and Rienitz, O. and Schiel, D. and Valkiers, S. and Waseda, A.} } @Article { JeanneretROvH2011, title = {High precision comparison between a programmable and a pulse-driven Josephson voltage standard}, journal = {Metrologia}, year = {2011}, volume = {48}, number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications}, pages = {311-316}, note = {Only available as publisher's version.}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, DOI = {10.1088/0026-1394/48/5/011}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Jeanneret, B. and Ruefenacht, A. and Overney, F. and van den Brom, H. and Houtzager, E.} } @Article { HaldNPVP2011, title = {Fiber laser optical frequency standard at 1.54 µm}, journal = {Optics Express}, year = {2011}, volume = {19}, number = {3}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {2052-2063}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1364/OE.19.002052}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hald, J. and Nielsen, L. and Petersen, J. C. and Varming, P. and Pedersen, J. E.} } @Article { StoicaYVF2011, title = {Evaluation of standard potential of Ag/AgCl electrode in a 50 wt\% water-ethanol mixture}, journal = {Journal of Solution Chemistry}, year = {2011}, volume = {40}, number2 = {ENG09: Biofuels: Metrology for Biofuels}, pages = {1819-1834}, tags = {EnG}, misc2 = {EMRP A169: Call 2009 Energy}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Stoica, D. and Yardin, Y. and Vaslin-Reimann, S. and Fisicaro, P.} } @Proceedings { VillamarinFPCHC2013, title = {Distribuci{\'o}n angular de la intensidad radiante espectral de LEDs blancos de alta luminosidad - Angular distribution of spectral radiant intensity emitted by high brightness white LEDs}, journal = {Proceedings of VII Reuni{\'o}n Espa{\~n}ola de Optoelectr{\'o}nica OPTOEL 2011}, year = {2011}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, keywords = {Gonio-spectro-photometer, radiant intensity, angular distribution, emission, spectral distribution, high brightness LEDs}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Santander, Spain}, event_name = {VII Reuni{\'o}n Espa{\~n}ola de Optoelectr{\'o}nica OPTOEL 2011}, event_date = {19 June 2011}, language = {Spanish}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Villamarin, A. and Ferrero, A. and Pons, A. and Campos, J. and Hernanz, M. and Corrons, A.} } @Article { CerasoliRHRBVR2010, title = {MiS-MALDI: Microgel-Selected on-probe detection of protein biomarkers by MALDI-ToF mass spectrometry}, journal = {Molecular BioSystems}, year = {2010}, month = {8}, day = {23}, volume = {6}, number = {11}, number2 = {T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine}, pages = {2214-2217}, misc2 = {iMERA-Plus: Call 2007 Health}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Cerasoli, E. and Rakowska, P. D. and Horgan, A. and Ravi, J. and Bradley, M. and Vincent, B. and Ryadnov, M.} } @Article { FerreroAMNv2010, subid = {2794}, title = {Design and Characterization of an RF Applicator for In Vitro Tests of Electromagnetic Hyperthermia}, journal = {Sensors}, year = {2010}, month = {5}, day = {22}, volume = {22}, number = {10}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {3610}, keywords = {thermal therapies, electromagnetic hyperthermia, RF applicator, TEM mode, coaxial cable, electromagnetic modelling, thermal modelling, temperature measurements, phantoms}, web_url = {https://www.mdpi.com/1424-8220/22/10/3610}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI}, language = {30}, DOI = {10.3390/s22103610}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Androulakis, I. and Martino, L. and Nadar, R. and van Rhoon, G.C.} } @Article { ValkiersVBd2010, title = {Preparation of argon Primary Measurement Standards for the calibration of ion current ratios measured in argon}, journal = {International Journal of Mass Spectrometry}, year = {2010}, month = {3}, volume = {291}, number = {1-2}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {41-47}, note = {no pdf available}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1016/j.ijms.2010.01.004}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Valkiers, S. and Vandelbo, D. and Berglund, M. and de Podesta, M.} } @Proceedings { vandenBromH2010, title = {Minimizing voltage lead corrections for a pulse-driven Josephson voltage standard}, journal = {2010 Conference on Precision Electromagnetic Measurements digest}, year = {2010}, number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications}, pages = {6-7}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, event_place = {Daejeon, Korea}, event_name = {2010 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {13-18 June, 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {van den Brom, Helko E. and Houtzager, Ernest} } @Article { PersijnHv2010, title = {Quantitative gas measurements using a versatile OPO-based cavity ringdown spectrometer and the comparison with spectroscopic databases}, journal = {Applied Physics B}, year = {2010}, volume = {100}, number2 = {T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection}, pages = {383-390}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, DOI = {10.1007/s00340-009-3875-3}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Persijn, S. and Harren, F. and van der Veen, A.} } @Article { SuttonUPdV2010, title = {Acoustic Resonator Experiments at the Triple Point of Water: First Results for the Boltzmann Constant and Remaining Challenges}, journal = {International Journal of Thermophysics}, year = {2010}, volume = {31}, number = {7}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {1310-13-46}, note = {no pdf available}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1007/s10765-010-0722-z}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Sutton, G. and Underwood, R. and Pitre, L. and de Podesta, M. and Valkiers, S.} } @Proceedings { TarassoZGLMPRV2010, title = {A survey of current shunts for AC power measurements}, journal = {2010 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2010}, number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques}, keywords = {power and energy, ac-dc transfer, shunts, wideband, power coefficient}, tags = {SEG}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, event_place = {Deajeon, Korea}, event_name = {2010 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {13 - 18 June 2010}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Tarasso, V. and Zachovalov{\'a}, V.N. and Garcocz, M. and Lind, K. and Mansten, T. and Pogliano, U. and Rietveld, G. and Voljc, B.} } @Article { JitaruGVF2010, title = {A systematic approach to the accurate quantification of selenium in serum selenoalbumin by HPLC-ICP-MS}, journal = {Analytica Chimica Acta}, year = {2010}, volume = {657}, number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry}, pages = {100-107}, keywords = {Human serum; Speciation analysis; Selenoaminoacids and selenoproteins; High performance liquid chromatography coupled to inductively coupled plasma-mass spectrometry; Species-specific isotope dilution}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Jitaru, Petru and Goenaga-Infante, Heidi and Vaslin-Reimann, Sophie} } @Article { PinotMGGHLVH2010, title = {Study of flexure strips made of copper-beryllium alloy to be used for the French watt balance experiment}, journal = {Revue Fran\c{c}aise de M{\'e}trologie}, year = {2010}, volume = {21}, number = {1}, number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram}, pages = {9-21}, keywords = {flexure pivot, stiffness, gimbals, watt balance, copper-beryllium alloy}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {French}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pinot, Patrick and Mac{\'e}, St{\'e}phane and Genev{\`e}s, G{\'e}rard and Gournay, Pierre and Haddad, Darine and Lecollinet, Michel and Villar, Francois and Himbert, Marc} } @Proceedings { VillarGD2010, title = {Determination and minimization of parasitic forces and moments in the static step of the LNE watt balance experiment}, journal = {2010 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2010}, number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, event_place = {Deajeon, Korea}, event_name = {2010 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {13 - 18 June 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Villar, F. and Genev{\`e}s, G. and David, J.} } @Proceedings { GenevesBEGJVDMPBP2010, title = {The e-mass euramet joint research project: the watt balance route towards a new definition of the kilogram}, journal = {2010 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2010}, number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, event_place = {Deajeon, Korea}, event_name = {2010 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {13 - 18 June 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Genev{\`e}s, G. and Bielsa, F. and Eichenberger, A. and Gilbert, O. and Juncar, P. and Villar, F. and D'Agostino, G. and Merlet, S. and Pinot, P. and Baumann, H. and Pereira Dos Santos, F.} } @Article { SegoviaVMGTd2010, title = {An Apparatus Based on a spehrical resonator for measuring the speed of sound in gases and for determining the Boltzmann constant}, journal = {International Journal of Thermophysics}, year = {2010}, volume = {31}, number = {7}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {1294-1309}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1007/s10765-010-0746-4}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Segovia, J. J. and Vega Maza, D. and Martin, M. C. and Gomez, E. and Tabacaru, C. and del Campo, D.} } @Article { JitaruRBVF2010, title = {Challenges in the accurate speciation analysis of selenium in humans: first report on indicative levels of selenoproteins in a serum certified reference material for total selenium (BCR-637)}, journal = {Accreditation and Quality Assurance}, year = {2010}, volume = {15}, number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry}, pages = {343-350}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Jitaru, Petru and Roman, Marco and Barbante, C. and Vaslin-Reimann, Sophie and Fisicaro, Paola} } @Proceedings { KazakovavPH2009, title = {Magnetic Properties of Single Crystalline Ge(1-x)Mn(x) Nanowires}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2009}, month = {10}, volume = {45}, number = {10}, number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics}, note = {No pdf received}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, event_place = {Sacramento, CA, USA}, event_name = {International Magnetics Conference 2009 (INTERMAG)}, event_date = {4 - 8 May 2009}, language = {English}, DOI = {10.1109/TMAG.2009.2023073}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazakova, O. and van der Meulen, M. I. and Petkov, N. and Holmes, J. D.} } @Article { ManaMVW2009, title = {Uncertainty assessment of Si molar mass measurements}, journal = {International Journal of Mass Spectrometry}, year = {2009}, month = {9}, day = {11}, volume = {289}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, pages = {6-10}, keywords = {Isotope ratio mass spectrometry; Si molar mass; metrology; measurement uncertainty}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Mana, G. and Massa, E. and Valkiers, S. and Willenberg, G.-D.} } @Article { BeckerFFGMPPRV2009, title = {The Avogadro constant determination via enriched silicon-28}, journal = {Measurement Science and Technology}, year = {2009}, month = {8}, day = {21}, volume = {20}, number = {092002}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, pages = {20 pages}, keywords = {Avogadro constant determination; kilogram rede?nition; fundamental physical constants; enriched silicon-28; mass measurements; density measurements; molar mass measurements; lattice parameter measurements; volume measurements; crystal characterization; x-ray, interferometry; optical interferometry}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Becker, P. and Friedrich, H. and Fujii, K. and Giardini, W. and Mana, G. and Picard, A. and Pohl, H.-J. and Riemann, H. and Valkiers, S.} } @Article { Rietveldv2009, title = {DC and Low-Frequency Humidity Dependence of a 20pF Air-Gap Capacitor}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2009}, month = {4}, volume = {58}, number = {4}, number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere}, pages = {967-972}, keywords = {Air-gap capacitor, capacitance measurement, current measurement, humidity dependence, small currents}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, Gert and van den Brom, Helko E.} } @Article { BuschVB2009, title = {Determination of the Avogadro constant. A contribution to the new definition of the mass}, journal = {French College of Metrology}, year = {2009}, month = {2}, volume = {-}, number = {-}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, pages = {6 pages}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, publisher = {ISTE-Wiley}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Busch, I. and Valkiers, S. and Becker, P.} } @Article { vanderMeulenPMKHWJH2009, title = {Single Crystalline Ge(1.x)Mn(x) Nanowires as Building Blocks for Nanoelectronics}, journal = {Nano Letters}, year = {2009}, month = {1}, volume = {9}, number = {1}, number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics}, note = {No pdf received}, keywords = {FIELD-EFFECT TRANSISTORS; GERMANIUM NANOWIRES; MAGNETIC-PROPERTIES; SURFACE-CHEMISTRY; GE NANOWIRES; NANOCRYSTALS; NANOPARTICLES; MN3O4; FERROMAGNETISM; SEMICONDUCTORS}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, DOI = {10.1021/nl802114x}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {van der Meulen, M. I. and Petkov, N. and Morris, M. A. and Kazakova, O. and Han, X. H. and Wang, K. L. and Jacob, A. P. and Holmes, J. D.} } @Article { vandenBromHVMR2009, title = {Influence of Sampling Voltmeter Parameters on RMS Measurements of Josephson Stepwise-Approximated Sine Waves}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2009}, volume = {58}, number = {10}, number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications}, pages = {3806-3812}, keywords = {AC Josephson voltage standards; binary Josephson arrays; measurement standards; sampling voltmeter; voltage measurement}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, ISSN = {0018-9456}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {van den Brom, H. E. and Houtzager, E. and Verhoeckx, S. and Martina, Q. E. and Rietveld, G.} } @Article { HoutzagerBv2009, title = {Operating Margins for a Pulse-Driven Josephson Arbitrary Waveform Synthesizer Using a Ternary Bit-Stream Generator}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2009}, volume = {58}, number = {4}, number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications}, pages = {775-780}, keywords = {AC voltage standard; digital-to-analog conversion; Josephson arrays; signal synthesis; superconductor-normal-superconductor devices; voltage measurement}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, ISSN = {0018-9456}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Houtzager, E. and Benz, S. P. and van den Brom, H. E.} } @Article { BallingKMv2009, title = {Femtosecond frequency comb based distance measurement in air}, journal = {Optics Express}, year = {2009}, volume = {17}, number = {11}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {9300-9313}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, DOI = {10.1364/OE.17.009300}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Balling, Petr and Křen, Petr and Mašika, Pavel and van den Berg, S.A.} } @Proceedings { KramerBvDDDKKKKPS2009, title = {Metrology in External Beam Cancer Therapy}, journal = {Proceedings 14th International Congress of Metrology}, year = {2009}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, misc2 = {iMERA-Plus: Call 2007 Health}, event_place = {Paris}, event_name = {14th International Congress of Metrology}, event_date = {22 - 25 June 2009}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kramer, H.-M. and Bordy, J.-M. and van Dijk, E. and Dobrovodsky, J. and Duane, S. and Durando, G. and Kapsch, R.-P. and Karab{\"o}ce, B. and Koch, Ch. and Kosunen, A. and Pimpinella, M. and Shaw, A.} } @Article { TrincheroSLGFdABTBV2009, title = {Experimental setup for the characterization of field probes performance in presence of digitally modulated radio signals}, journal = {IEEE Antennas and Wireless Propagation Letters}, year = {2009}, volume = {8}, number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive}, pages = {224-227}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Trinchero, D. and Stefanelli, R. and Longobardi, F. and Galardini, A. and Fiorelli, B. and d'Amore, G. and Anglesio, L. and Benedetto, A. and Trinchero, S. and Borsero, M. and Vizio, G.} } @Article { TrincheroSLGFdABTBV2009_2, title = {Field probes performance for the measurement of spread-spectrum radio signals}, journal = {IEEE Antennas and Wireless Propagation Letters}, year = {2009}, volume = {8}, number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive}, pages = {494-497}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Trinchero, D. and Stefanelli, R. and Longobardi, F. and Galardini, A. and Fiorelli, B. and d'Amore, G. and Anglesio, L. and Benedetto, A. and Trinchero, S. and Borsero, M. and Vizio, G.} } @Article { AlfonsoACSKKMPRSUV2008, title = {A new formalism for reference dosimetry of small and non-standard fields}, journal = {Medical Physics}, year = {2008}, volume = {35}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, pages = {5179-5186}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, DOI = {10.1118/1.3005481}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Alfonso, R. and Andreo, P. and Capote, R. and Saiful Huq, M. and Kilby, W. and Kj{\"a}ll, P. and Mackie, T. R. and Palmans, H. and Rosser, K. and Seuntjens, J. and Ullrich, W. and Vatnitsky, S.} } @Miscellaneous { KuipervNV, subid = {2245}, title = {Data underlying the figures in the paper: ''Reliable measurements of extracellular vesicles by clinical flow cytometry''}, journal = {American Journal of Reproductive Immunology}, volume = {85}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {e13350}, keywords = {extracellular vesicles, standardization, flow cytometry, calibration, data interpretation}, misc2 = {EMPIR 2018: Health}, publisher = {John Wiley \& Sons Ltd}, ISSN = {1600-0897}, DOI = {10.5281/zenodo.4561815}, stag_bib_extends_levelofaccess = {NA}, author = {Kuiper, M. and van de Nes, A. and Nieuwland, R. and Varga, Z.} } @Article { NwabohMLPLvCPQWE, subid = {1790}, title = {Accurate analysis of HCl in biomethane using laser absorption spectroscopy and ion-exchange chromatography}, journal = {The Analyst}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, keywords = {biomethane, laser spectroscopy, TDLAS, hydrogen chloride, ion chromatography}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0003-2654, 1364-5528}, DOI = {10.1039/d0an01955k}, stag_bib_extends_levelofaccess = {NA}, author = {Nwaboh, J.A. and Meuzelaar, H. and Liu, J. and Persijn, S. and Li, J. and van der Veen, A.M.H. and Chatellier, N. and Papin, A. and Qu, Z. and Werhahn, O. and Ebert, V.} } @Manual { vanderVeen_2, subid = {1783}, title = {Test methods for the conformity assessment of biomethane}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, keywords = {biomethane, conformity assessment, test methods}, tags = {EnG}, web_url = {http://empir.npl.co.uk/biomethane/wp-content/uploads/sites/28/2020/11/EMPIR-16ENG05-D11_Methods_for_biomethane_characterisation.pdf}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://empir.npl.co.uk/biomethane/wp-content/uploads/sites/28/2020/11/EMPIR-16ENG05-D11_Methods_for_biomethane_characterisation.pdf}, author = {van der Veen, A.M.H.} } @Miscellaneous { BosnjakoviKav, subid = {2068}, title = {EMUE-D4-4-TransformerPowerLoadLoss}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {measurement uncertainty evaluation, power transformers losses, Monte Carlo method, law of propagation of uncertainty}, misc2 = {EMPIR 2017: Pre-Co-Normative}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4896452}, author = {Bošnjakovic, A. and Karahožić, V. and Čaušević, M. and van der Veen, A.M.H.} } @Miscellaneous { TiainenVHH, subid = {2265}, title = {Total Rotor Runout Dataset}, number2 = {19ENG07: Met4Wind: Metrology for enhanced reliability and efficiency of wind energy systems}, keywords = {Multi-probe roundness data, Electrical runout data, simultaneous tactile and eddy current probe measurement, Scaling}, misc2 = {EMPIR 2019: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5615524}, author = {Tiainen, T. and Viitala, R. and Holopainen, T. and Hemming, B.} } @Miscellaneous { Vasilatou, subid = {2148}, title = {Calibration of optical particle size spectrometers against a primary standard: Counting efficiency profile of the TSI Model 3330 OPS and Grimm 11-D monitor in the particle size range from 300 nm to 10 \(\mu\)m}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, keywords = {Calibration, Optical particle size spectrometers, Counting efficiency, Polystyrene particles, Standardisation}, misc2 = {EMPIR 2019: Environment}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.5141907}, author = {Vasilatou, K.} } @Miscellaneous { PeinerVFMABLBXDBKDH, subid = {1495}, title = {Long Slender Piezo-Resistive Silicon Microprobes for Fast Measurements of Roughness and Mechanical Properties inside Micro-Holes with Diameters below 100 µm}, journal = {Open Access Repository PTB}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {cantilever microprobe, high-speed, contact resonance, tip wear, piezo-resistive, mechanical damping, tip-testing standard, cantilevers, micromechanical devices, surface topography measurement, shape measurement}, web_url = {https://oar.ptb.de/resources/show/10.7795/720.20200515}, misc2 = {EMPIR 2017: Industry}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, language = {30}, DOI = {10.7795/720.20200515}, stag_bib_extends_levelofaccess = {NA}, author = {Brand, U. and XU, M. and Doering, L. and Langfahl-Klabes, J. and Behle, H. and B{\"u}tefisch, S. and Ahbe, T. and Mickan, B. and Peiner, E. and V{\"o}llmeke, S. and Frank, T. and Kiselev, I. and Drexel, M. and Hauptmannl, M.} } @Miscellaneous { KlauiJPDGVCCK, subid = {1350}, title = {Individual skyrmion manipulation by local magnetic field gradients - Dataset}, journal = {Zenodo}, volume = {N/A}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {N/A}, keywords = {skyrmion, AFM, manipulation, nanomagnetism}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Zenodo}, language = {197}, ISSN = {N/A}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/3601425}, author = {Kl{\"a}ui, M. and Jakob, G. and Pasquale, M. and Durin, G. and Garcia-Sanchez, F. and Vafaee, M. and Corte-Le{\'o}n, H. and Casiraghi, A. and Kazakova, O.} } @Miscellaneous { SousaBDFPRMRv, subid = {2158}, title = {EMUE-D5-5-Microflow}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty, Microflow, Bayesian}, misc2 = {EMPIR 2017: Pre-Co-Normative}, DOI = {10.5281/zenodo.5497823}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Batista, E. and Demeyer, S. and Fischer, N. and Pelegrino, O. and Ribeiro, A.S. and Martins, L.L. and Reader-Harris, M and van der Veen, A.M.H} } @Miscellaneous { AlKhafajiGWBV, subid = {2246}, title = {SAXS dataset and algorithms for the paper ''Particle Size Distribution of Bimodal Silica Nanoparticles: A Comparison of Different Measurement Techniques''}, journal = {Materials}, volume = {13}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {3101}, keywords = {silica nanoparticle, size distribution, light scattering, small-angle X-ray scattering, microfluidic resistive pulse sensing}, misc2 = {EMPIR 2018: Health}, publisher = {Multidisciplinary Digital Publishing Institute}, ISSN = {1996-1944}, DOI = {10.5281/zenodo.4545822}, stag_bib_extends_levelofaccess = {NA}, author = {Al-Khafaji, M. and Ga{\'a}l, A. and Wacha, A. and B{\'o}ta, A. and Varga, Z.} } @Miscellaneous { FerreroCBVSYACMT, subid = {2164}, title = {Dataset: Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes}, journal = {Zenodo}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations}, misc2 = {EMPIR 2018: Health}, DOI = {10.5281/zenodo.5040394}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Celegato, F. and Barrera, G. and Vicentini, M. and S{\"o}zeri, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.} } @Miscellaneous { VedurmudiGD, subid = {2171}, title = {Sensor data set of one electromechanical cylinder at ZeMA testbed (ZeMA DAQ and Smart-Up Unit)}, journal = {Zenodo}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {dynamic measurement, measurement uncertainty, sensor network, digital sensors, MEMS, machine learning, European Union (EU), Horizon 2020, EMPIR}, web_url = {https://zenodo.org/record/5185953\#.YUnXrn1CSUk}, misc2 = {EMPIR 2017: Industry}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5185953}, author = {Vedurmudi, A.P. and Gruber, M. and Dorst, T.} } @Miscellaneous { VedurmudiGD0, subid = {2171}, title = {Sensor data set of one electromechanical cylinder at ZeMA testbed (ZeMA DAQ and Smart-Up Unit)}, journal = {Zenodo}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {dynamic measurement, measurement uncertainty, sensor network, digital sensors, MEMS, machine learning, European Union (EU), Horizon 2020, EMPIR}, web_url = {https://zenodo.org/record/5185953\#.YUnXrn1CSUk}, misc2 = {EMPIR 2017: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5185953}, author = {Vedurmudi, A.P. and Gruber, M. and Dorst, T.} } @Miscellaneous { MilanoLLBRV, subid = {2237}, title = {Structure-Dependent Influence of Moisture on Resistive Switching Behavior of ZnO Thin Films - Dataset}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, keywords = {effect of moisture on electroforming, electrical conductivity, memristors, nanostructures, resistive switching}, misc2 = {EMPIR 2020: Fundamental}, language = {30}, DOI = {10.5281/zenodo.5095263}, stag_bib_extends_levelofaccess = {NA}, author = {Milano, G. and Luebben, M. and Laurenti, M. and Boarino, L. and Ricciardi, C. and Valov, I.} } @Miscellaneous { MierEscurraMV, subid = {2498}, title = {Dataset for publication: Design and Characterization of a Magnetic Loop Antenna for Partial Discharge Measurements in Gas Insulated Substations}, journal = {IEEE SENSORS JOURNAL}, volume = {21, Sept 2}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {18618- 18625}, keywords = {Magnetic loop antenna, partial discharges, transfer function, electric circuit, GIS, broadband antenna,VHF, high voltage}, tags = {SEG}, misc2 = {EMPIR 2019: Energy}, publisher = {IEEE}, language = {30}, ISSN = {N/A}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5913233}, author = {Mier Escurra, C. and Mor, A.R. and Vaessen, P.} } @Miscellaneous { VidiMRHAUPPM, subid = {2562}, title = {Specific heat of tungsten from 23 \(^{\circ}\)C to 3266 \(^{\circ}\)C}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Specific heat, High temperature, Tungsten}, misc2 = {EMPIR 2017: Industry}, publisher = {ZENODO}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6091579}, author = {Vidi , S. and Manara, J. and Razouk, R. and Hay, B. and Anhalt, K. and Urban , D. and Pichler, P. and Pottlacher, G. and Milosevic, N.} } @Miscellaneous { VidiMRHAUPPM_2, subid = {2561}, title = {Specific heat of molybdenum from 23 \(^{\circ}\)C to 2607 \(^{\circ}\)C}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Specific heat, High temperature, Molybdenum}, misc2 = {EMPIR 2017: Industry}, publisher = {ZENODO}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6091492}, author = {Vidi , S. and Manara, J. and Razouk, R. and Hay, B. and Anhalt, K. and Urban , D. and Pichler, P. and Pottlacher, G. and Milosevic, N.} } @Miscellaneous { HohlsVSWKS, subid = {2632}, title = {Dataset for Hohls et al ''Controlling the error mechanism in a tunable-barrier non-adiabatic charge pump by dynamic gate compensation''}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, keywords = {single-electron source, control of error mechanism, non-adiabatic single-electron pump}, misc2 = {EMPIR 2017: Fundamental}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6046089}, author = {Hohls, F. and Vyacheslavs Kashcheyevs, V. and Stein, F. and Wenz, T. and Kaestner, B. and Schumacher, H.W.} }