% % This file was created by the TYPO3 extension % bib % --- Timezone: CEST % Creation date: 2022-05-22 % Creation time: 00-49-09 % --- Number of references % 641 % @Article { AmicoTPSN2022, subid = {2720}, title = {Recent applications and novel strategies for mercury determination in environmental samples using microextraction-based approaches: A review}, journal = {Journal of Hazardous Materials}, year = {2022}, month = {7}, volume = {433}, number2 = {19NRM03: SI-Hg: Metrology for traceable protocols for elemental and oxidised mercury concentrations}, pages = {128823}, keywords = {Mercury determination, Microextraction techniques, Environmental monitoring, Exposomics studies, Green analytical chemistry (GAC), Sample preparation}, web_url = {https://doi.org/10.1016/j.jhazmat.2022.128823}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3894}, DOI = {10.1016/j.jhazmat.2022.128823}, stag_bib_extends_levelofaccess = {NA}, author = {Amico, D. and Tassone, A. and Pirrone, N. and Sprovieri, F. and Naccarato, A.} } @Article { BriantKCLBWRMPCESTHPKKDZWMSNB2022, subid = {2714}, title = {Photonic and Optomechanical Thermometry}, journal = {Optics}, year = {2022}, month = {4}, day = {29}, volume = {3}, number = {2}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {159-176}, keywords = {thermometry; photonic; optomechanic; temperature sensors; photonic integrated circuit}, web_url = {https://doi.org/10.3390/opt3020017}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2673-3269}, DOI = {10.3390/opt3020017}, stag_bib_extends_levelofaccess = {NA}, author = {Briant, T. and Krenek, S. and Cupertino, A. and Loubar, F. and Braive, R. and Weituschat, L. and Ramos, D. and Martin, M.J. and Postigo, P.A. and Casas, A. and Eisermann, R. and Schmid, D. and Tabandeh, S. and Hahtela, O. and Pourjamal, S. and Kozlova, O. and Kroker, S. and Dickmann, W. and Zimmermann, L. and Winzer, G. and Martel, T. and Steeneken, P.G. and Norte, R.A. and Briaudeau, S.} } @Article { VolkovaHTBCMARERBPN2022, subid = {2712}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {color centers, optical quantum technology}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { VolkovaHTBCMARERBPN2022_2, subid = {2721}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { ZibordiKMTCDG2022, subid = {2594}, title = {Assessment of OLCI-A and OLCI-B radiometric data products across European seas}, journal = {Remote Sensing of Environment}, year = {2022}, month = {4}, volume = {272}, number2 = {19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system}, pages = {112911}, keywords = {Ocean and Land Colour Instruments, Radiometry, AeroNET-OC, Copernicus Sentinel-3}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0034-4257}, DOI = {10.1016/j.rse.2022.112911}, stag_bib_extends_levelofaccess = {NA}, author = {Zibordi, G. and Kwiatkowska, E. and M{\'e}lin, F. and Talone, M. and Cazzaniga, I. and Dessailly, D. and Gossn, J.I.} } @Article { GogneauCSCLTHJTH2022, subid = {2666}, title = {Electromechanical conversion efficiency of GaN NWs: critical influence of the NW stiffness, the Schottky nano-contact and the surface charge effects}, journal = {Nanoscale}, year = {2022}, month = {3}, day = {17}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, keywords = {piezoelectric nanowires, NW, AFM, stiffness, GaN, energy, harvesting}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2022/NR/D1NR07863A}, misc2 = {EMPIR 2019: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/d1nr07863a}, stag_bib_extends_levelofaccess = {NA}, author = {Gogneau, N. and Chr{\'e}tien, P. and Sodhi, T. and Couraud, L. and Leroy, L. and Travers, L. and Harmand, J-C. and Julien, F.H. and Tchernycheva, M. and Houz{\'e}, F.} } @Article { ChaeKKPTKPGYSCCS2022, subid = {2653}, title = {Investigation of the stability of graphene devices for quantum resistance metrology at direct and alternating current}, journal = {Measurement Science and Technology}, year = {2022}, month = {3}, volume = {33}, number = {6}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {065012}, keywords = {quantum Hall effect, quantized Hall resistance, graphene, impedance standard,F4-TCNQ doping, stability}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/ac4a1a}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac4a1a}, stag_bib_extends_levelofaccess = {NA}, author = {Chae, D-H. and Kruskopf, M. and Kucera, J. and Park, J. and Tran, N.T.M. and Kim, D.B. and Pierz, K. and G{\"o}tz, M. and Yin, Y. and Svoboda, P. and Chrobok, P. and Cou{\"e}do, F. and Schopfer, F.} } @Article { GeorgiKNSSTJ2022, subid = {2621}, title = {Toward 3D dose verification of an electronic brachytherapy source with a plastic scintillation detector}, journal = {Medical Physics}, year = {2022}, month = {3}, volume = {1-12}, number = {1-12}, number2 = {18NRM02: PRISM-eBT: Primary standards and traceable measurement methods for X-ray emitting electronic brachytherapy devices}, pages = {1-12}, keywords = {dose verification, electronic brachytherapy, Monte Carlo dosimetry, plastic scintillators}, web_url = {https://doi.org/10.1002/mp.15568}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.15568}, stag_bib_extends_levelofaccess = {NA}, author = {Georgi, P. and Kertzscher, G. and Nyvang, L. and Solc, J. and Schneider, T. and Tanderup, K. and Johansen, J.G.} } @Article { MingottiCPT2022_2, subid = {2717}, title = {Accuracy Type Test for Rogowski Coils Subjected to Distorted Signals, Temperature, Humidity, and Position Variations}, journal = {Sensors}, year = {2022}, month = {2}, day = {11}, volume = {22}, number = {4}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, pages = {1397}, keywords = {accuracy, type test, low-power instrument transformer, Rogowski coil, temperature, humidity, positioning, measurements}, web_url = {https://www.mdpi.com/1424-8220/22/4/1397}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s22041397}, stag_bib_extends_levelofaccess = {NA}, author = {Mingotti, A. and Costa, F. and Peretto, L. and Tinarelli, R.} } @Article { VillegasQUTL2022, subid = {2535}, title = {Identification of Model Particle Mixtures Using Machine-Learning-Assisted Laser Diffraction}, journal = {Photonics}, year = {2022}, month = {1}, day = {28}, volume = {9}, number = {2}, number2 = {20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light}, pages = {74}, keywords = {Particle characterization; Laser diffraction; Machine learning; Neural networks}, web_url = {https://www.mdpi.com/2304-6732/9/2/74}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2304-6732}, DOI = {10.3390/photonics9020074}, stag_bib_extends_levelofaccess = {NA}, author = {Villegas, A. and Quiroz-Ju{\'a}rez, M.A. and U’Ren, A.B. and Torres, J.P. and Le{\'o}n-Montiel, R. de J.} } @Article { KuckLHGCRPSGBFLTTCMDTRR2022, subid = {2486}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Single photon sources, quantum radiometry, quantum metrology}, web_url = {https://doi.org/10.1007/s00340-021-07734-2}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { KuckLHGCRPSGBFLTTCMDTRR2022_2, subid = {2752}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, keywords = {Single-photon sources, quantum radiometry, calibration, single photon detectors. defect centres, (nano-)diamonds, molecule semiconductor quantum dots, photon flux, single-photon purity, spectral power distribution}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { TongBKRGGGCHC2022, subid = {2570}, title = {Cathodoluminescence mapping of electron concentration in MBE-grown GaAs:Te nanowires}, journal = {Nanotechnology}, year = {2022}, month = {1}, day = {22}, volume = {33}, number = {18}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {185704}, keywords = {nanowires, GaAs, doping, cathodoluminescence}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/ac4d58}, misc2 = {EMPIR 2019: Energy}, publisher = {IOP}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://hal.archives-ouvertes.fr/hal-03539939}, author = {Tong, C. and Bidaud, T. and Koivusalo, E. and Rizzo Piton, M. and Guina, M. and Galeti, H. and Galvao Gobato, Y. and Cattoni, A. and Hakkarainen, T. and Collin, S.} } @Article { BeckhoffURHTHE2022, subid = {2463}, title = {Investigating Membrane‐Mediated Antimicrobial Peptide Interactions with Synchrotron Radiation Far‐Infrared Spectroscopy}, journal = {ChemPhysChem}, year = {2022}, month = {1}, day = {14}, number2 = {HLT10: BiOrigin: Metrology for biomolecular origin of disease}, pages = {1-11}, keywords = {antimicrobialpeptides, electrostatic interactions, IR spectroscopy, phospholipid membranes, protein folding}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley}, language = {30}, ISSN = {1439-4235, 1439-7641}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1002/cphc.202100815}, author = {Beckhoff, B. and Ulm, G. and Ryadnov, M.G. and Hoehl, A. and Tiersch, B. and Hornemann, A. and Eichert, D.M.} } @Article { ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022, subid = {2567}, title = {2022 roadmap on neuromorphic computing and engineering}, journal = {Neuromorphic Computing and Engineering}, year = {2022}, month = {1}, day = {12}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, keywords = {neuromorphic computing, neuromorphic engineering}, web_url = {https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2634-4386}, DOI = {10.1088/2634-4386/ac4a83}, stag_bib_extends_levelofaccess = {NA}, author = {Christensen, D.V. and Dittmann, R. and Linares-Barranco, B. and Sebastian, A. and Le Gallo, M. and Redaelli, A. and Slesazeck, S. and Mikolajick, T. and Spiga, S. and Menzel, S. and Valov, I. and Milano, G. and Ricciardi, C. and Liang, S-J. and Miao, F. and Lanza, M. and Quill, T.J. and Keene, S.T. and Salleo, A. and Grollier, J. and Markovic, D. and Mizrahi, A. and Yao, P. and Yang, J.J. and Indiveri, G. and Strachan, J.P. and Datta, S. and Vianello, E. and Valentian, A. and Feldmann, J. and Li, X. and Pernice, W.H.P. and Bhaskaran, H. and Furber, S. and Neftci, E. and Scherr, F. and Maass, W. and Ramaswamy, S. and Tapson, J. and Panda, P. and Kim, Y. and Tanaka, G. and Thorpe, S. and Bartolozzi, C. and Cleland, T.A. and Posch, C. and Liu, S-C. and Panuccio, G. and Mahmud, M. and Mazumder, A.N. and Hosseini, M. and Mohsenin, T. and Donati, E. and Tolu, S. and Galeazzi, R. and Christensen, M.E. and Holm, S. and Ielmini, D. and Pryds, N.} } @Article { PearceTICFWC2022, subid = {2429}, title = {Correlation between insulation resistance breakdown and temperature measurement error in Type K and N mineral insulated, metal sheathed thermocouples}, journal = {International Journal of Thermophysics}, year = {2022}, month = {1}, day = {10}, volume = {43}, number = {N/A}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {35}, keywords = {Insulation resistance breakdown, Mineral insulated metal sheathedthermocouple, Temperature, Thermocouple, Thermoelectric}, web_url = {https://link.springer.com/content/pdf/10.1007/s10765-021-02967-x.pdf}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer}, address = {London}, language = {30}, ISSN = {0195-928X}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1007/s10765-021-02967-x}, author = {Pearce, J. and Tucker, D. and Izquierdo, C.G. and Caballero, R. and Ford, T. and Williams, P. and Cowley, P.} } @Article { GuilloryTWA2022, subid = {2169}, title = {Absolute multilateration-based coordinate measurement system using retroreflecting glass spheres}, journal = {Precision Engineering}, year = {2022}, month = {1}, volume = {73}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {214-227}, keywords = {Large volume metrologyAbsolute distance metreRetroreflecting glass spheresCoordinate measurement systemMultilateration technique with self-calibration}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2021.09.009}, stag_bib_extends_levelofaccess = {NA}, author = {Guillory, J. and Truong, D. and Wallerand, J.-P. and Alexandre, C.} } @Article { GuilloryTWA2022_2, subid = {2172}, title = {Absolute multilateration-based coordinate measurement system using retroreflecting glass spheres}, journal = {Precision Engineering}, year = {2022}, month = {1}, volume = {73}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, pages = {214-227}, keywords = {Large Volume Metrology; Absolute Distance Metre; retroreflecting glass spheres; coordinate measurementsystem; multilateration technique with self-calibration.}, web_url = {https://hal.archives-ouvertes.fr/hal-03349168v1}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2021.09.009}, stag_bib_extends_levelofaccess = {NA}, author = {Guillory, J. and Truong, D. and Wallerand, J-P. and Alexandre, C.} } @Article { SantourianQTHS2022, subid = {2420}, title = {Novel LED-based radiation source and its application in diffuse reflectometry and polarization measurements}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149 (2022}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {1-8}, keywords = {Source based radiometry, BRDF, Spectral radiance factor, LED sphere radiator, polarisation, diffuse reflection}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {NEWRAD 2021 - IOP Publishing}, language = {30}, ISSN = {1742-6588}, DOI = {10.1088/1742-6596/2149/1/012010}, stag_bib_extends_levelofaccess = {NA}, author = { Santourian, I. and Quast, T. and Teichert, S. and Hauer, K-O. and Schirmacher, A.} } @Article { MingottiCPT2022, subid = {2520}, title = {Effect of Proximity, Burden, and Position on the Power Quality Accuracy Performance of Rogowski Coils}, journal = {Sensors}, year = {2022}, month = {1}, volume = {22}, number = {1}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, pages = {397}, keywords = {low-power instrument transformer, Rogowski coil, position, burden, proximity, accuracy, harmonic, power quality}, web_url = {https://www.mdpi.com/1424-8220/22/1/397}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s22010397}, stag_bib_extends_levelofaccess = {NA}, author = {Mingotti, A. and Costa, F. and Peretto, L. and Tinarelli, R.} } @Article { KatonaTSKN2022, subid = {2568}, title = {Geometric system analysis of ILMD-based LID measurement systems using Monte-Carlo simulation}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {1}, number2 = {19NRM02: RevStdLED: Revision and extension of standards for test methods for LED lamps, luminaires and modules}, pages = {012015}, keywords = {ILMD, goniophotometer, geoemtric uncertainty, monte carlo simulation,}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/2149/1/012015}, stag_bib_extends_levelofaccess = {NA}, author = {Katona, M. and Trampert, K. and Schwanengel, C. and Kr{\"u}ger, U. and Neumann, C.} } @Article { ZibordiTM2022, subid = {2593}, title = {Uncertainty Estimate of Satellite-Derived Normalized Water-Leaving Radiance}, journal = {IEEE Geoscience and Remote Sensing Letters}, year = {2022}, volume = {19}, number2 = {19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system}, pages = {1-5}, keywords = {Ocean color, remote sensing, uncertainties, Satellite broadcasting, Image color analysis, Oceans, Radiometry, Standards, Sea measurements}, misc2 = {EMPIR 2019: Environment}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1545-598X, 1558-0571}, DOI = {10.1109/LGRS.2021.3134876}, stag_bib_extends_levelofaccess = {NA}, author = {Zibordi, G. and Talone, M. and M{\'e}lin, F.} } @Article { GollwitzerDSTCMPDFCH2021, subid = {2389}, title = {Correlative Analysis of the Dimensional Properties of Bipyramidal Titania Nanoparticles by Complementing Electron Microscopy with Other Methods}, journal = {Nanomaterials}, year = {2021}, month = {12}, day = {10}, volume = {11}, number = {12}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {3359}, keywords = {nanoparticle; complex‐shape; bipyramid; electron microscopy; atomic force microscopy;size measurements; TKD; STEM‐in‐SEM; SAXS; nanoparticle concentration; correlative analysis}, web_url = {https://www.mdpi.com/2079-4991/11/12/3359}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11123359}, stag_bib_extends_levelofaccess = {NA}, author = {Gollwitzer, C. and Deumer, J. and Salzmann, C. and Tokarski, T. and Cios, G. and Maurino, V. and Pellegrino, F. and Delvall{\'e}e, A. and Feltin, N. and Crouzier, L. and Hodoroaba, V-D.} } @Proceedings { ThorsethLB2021, subid = {2547}, title = {SENSITIVITY ANALYSIS ON THE EFFECT OF MEASUREMENT NOISE AND SAMPLING FREQUENCY ON THE CALCULATION OF THE TEMPORAL LIGHT ARTEFACTS}, journal = {Proceedings of the Conference CIE 2021}, year = {2021}, month = {12}, volume = {x48}, number2 = {20NRM01: MetTLM: Metrology for temporal light modulation}, pages = {OP28}, keywords = {Photometry, Temporal light modulation, TLM, Temporal light artefacts, TLA, Flicker, Measurement uncertainty, Propagation of uncertainty.}, web_url = {https://orbit.dtu.dk/en/publications/sensitivity-analysis-on-the-effect-of-measurement-noise-and-sampl}, misc2 = {EMPIR 2020: Pre-Co-Normative}, publisher = {International Commission on Illumination, CIE}, event_place = {Kuala Lumpur, Malaysia}, event_name = {CIE 2021 Midterm Meeting \& Conference}, event_date = {27-09-2021 to 29-09-2021}, language = {30}, DOI = {10.25039/x48.2021.OP28}, stag_bib_extends_levelofaccess = {NA}, author = {Thorseth, A. and Lind{\'e}n, J. and Bouroussis, C.A.} } @Proceedings { FerreroT2021, subid = {2555}, title = {IMPACT OF THE NORMALIZATION OF THE SPECTRAL RESPONSIVITY ON THE PERFORMANCE OF THE GENERAL V(\(\lambda\)) MISMATCH INDEX}, journal = {Proceedings of the Conference CIE 2021}, year = {2021}, month = {12}, number2 = {19NRM02: RevStdLED: Revision and extension of standards for test methods for LED lamps, luminaires and modules}, keywords = {Photometry, LED sources, LED reference spectrum, photometric calibrations,spectral mismatch}, web_url = {https://orbit.dtu.dk/en/publications/impact-of-the-normalization-of-the-spectral-responsivity-on-the-p}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {International Commission on Illumination, CIE}, event_place = {Malaysia}, event_name = {CIE 2021, Miterm meetting and conference}, event_date = {27-09-2021 to 29-09-2021}, language = {30}, DOI = {10.25039/x48.2021.PO20}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Thorseth, A.} } @Article { SudTSBSDSSWZZRCKKC2021, subid = {2383}, title = {Tailoring interfacial effect in multilayers with Dzyaloshinskii–Moriya interaction by helium ion irradiation}, journal = {Scientific Reports}, year = {2021}, month = {12}, volume = {11}, number = {23626}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {Spintronics, Nano magnetism, Magnetic skyrmions, Dzyaloshinskii–Moriya interaction}, web_url = {https://www.nature.com/articles/s41598-021-02902-y.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, DOI = {10.1038/s41598-021-02902-y}, stag_bib_extends_levelofaccess = {NA}, author = { Sud, A. and Tacchi, S. and Sagkovits, D. and Barton, C. and Sall, M. and Diez, L.H. and Stylianidis, E. and Smith, N. and Wright, L. and Zhang, S. and Zhang, X. and Ravelosona, D. and Carlotti, G. and Kurebayashi, H. and Kazakova, O. and Cubukcu, M. } } @Article { AssoulineJBWTJGKRPR2021, subid = {2371}, title = {Excitonic nature of magnons in a quantum Hall ferromagnet}, journal = {Nature Physics}, year = {2021}, month = {12}, volume = {17}, number = {12}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {1369-1374}, keywords = {Graphene, mangons, interferometry, p-n-junction}, web_url = {https://arxiv.org/abs/2102.02068}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-021-01411-z}, stag_bib_extends_levelofaccess = {NA}, author = {Assouline, A. and Jo, M. and Brasseur, P. and Watanabe, K. and Taniguchi, T. and Jolicoeur, Th. and Glattli, D.C. and Kumada, N. and Roche, P. and Parmentier, F.D. and Roulleau, P.} } @Article { LieberherrACCCGKMMMOSSTV2021, subid = {2368}, title = {Assessment of real-time bioaerosol particle counters using reference chamber experiments}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {12}, volume = {14}, number = {12}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {7693-7706}, keywords = {bioaerosol monitors, calibration, counting efficiency, fluorescence}, web_url = {https://amt.copernicus.org/articles/14/7693/2021/}, misc2 = {EMPIR 2019: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-7693-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Lieberherr, G. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Gysel-Beer, M. and Konzelmann, T. and Manzano, J. and Mihajlovic, A. and Moallemi, A. and O'Connor, D. and Sikoparija, B. and Sauvageat , E. and Tummon, F. and Vasilatou, K.} } @Article { GrahamTKBBNBOZZ2021, subid = {2275}, title = {Ultra-low flow rate measurement techniques}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {100279}, keywords = {Flow metrologyDrug deliveryCalibrationUncertaintyNanoflow}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100279}, stag_bib_extends_levelofaccess = {NA}, author = {Graham, E. and Thiemann, K. and Kartmann, S. and Batista, E. and Bissig, H. and Niemann, A. and Boudaoud, A.W. and Ogheard, F. and Zhang, Y. and Zagnoni, M.} } @Article { MiuraNTS2021, subid = {2604}, title = {GD\&T task specific measurement uncertainty evaluation for manufacturing floor}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number = {Part of sp}, number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry}, pages = {100141}, keywords = {Coordinate measuring machine, Uncertainty, Analysis of variance, Maximum entropy model}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001045}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100141}, stag_bib_extends_levelofaccess = {NA}, author = {Miura, Y. and Nakanishi, S. and Takatsuji, T. and Sato, O.} } @Article { KoybasiNTPRPBMSKGOIG2021, subid = {2601}, title = {High Performance Predictable Quantum Efficient Detector Based on Induced-Junction Photodiodes Passivated with SiO2/SiNx}, journal = {Sensors}, year = {2021}, month = {11}, day = {24}, volume = {21}, number = {23}, number2 = {18SIB10: chipS·CALe: Self-calibrating photodiodes for the radiometric linkage to fundamental constants}, pages = {7807}, keywords = {silicon photodetector; inversion layer photodiode; induced-junction; surface passivation;PECVD silicon nitride; radiometry; optical power; primary standard; predictable quantum efficiency}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21237807}, stag_bib_extends_levelofaccess = {NA}, author = {Koybasi, O. and Nordseth, {\O}. and Tran, T. and Povoli, M. and Rajteri, M. and Pepe, C. and Bardalen, E. and Manoocheri, F. and Summanwar, A. and Korpusenko, M. and Getz, M.N. and Ohlckers, P. and Ikonen, E. and Gran, J.} } @Article { ChretienGST2021, subid = {2471}, title = {Fast Hyperparameter Calibration of Sparsity Enforcing Penalties in Total Generalised Variation Penalised Reconstruction Methods for XCT Using a Planted Virtual Reference Image}, journal = {Mathematics}, year = {2021}, month = {11}, day = {19}, volume = {9}, number = {22}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {2960}, keywords = {XCT reconstruction, sparsity enforcing penalties, hyperparameter selection, Bayesian optimisation, virtual planted reference image}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-7390}, DOI = {10.3390/math9222960}, stag_bib_extends_levelofaccess = {NA}, author = {Chretien, S. and Giampiccolo, C. and Sun, W. and Talbott, J.} } @Article { CorteSDLPTDMOMGF2021, subid = {2503}, title = {Spectral Emission Dependence of Tin‐Vacancy Centers in Diamond from Thermal Processing and Chemical Functionalization}, journal = {Advanced Photonics Research}, year = {2021}, month = {11}, volume = {3}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {2100148}, keywords = {tin vacancy centers, single-photon sources, nanodiamond}, web_url = {https://onlinelibrary.wiley.com/doi/epdf/10.1002/adpr.202100148}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2699-9293, 2699-9293}, DOI = {10.1002/adpr.202100148}, stag_bib_extends_levelofaccess = {NA}, author = {Corte, E. and Sachero, S. and Ditalia Tchernij, S. and L{\"u}hmann, T. and Pezzagna, S. and Traina, P. and Degiovanni, I.P. and Moreva, E. and Olivero, P. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { CorteSDLPTDMOMGF2021_2, subid = {2678}, title = {Spectral Emission Dependence of Tin‐Vacancy Centers in Diamond from Thermal Processing and Chemical Functionalization}, journal = {Advanced Photonics Research}, year = {2021}, month = {11}, volume = {3}, number = {1}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {2100148}, keywords = {color centers, confocal microscopy}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/adpr.202100148}, misc2 = {EMPIR 2020: Industry}, publisher = {Wiley}, language = {30}, ISSN = {2699-9293, 2699-9293}, DOI = {10.1002/adpr.202100148}, stag_bib_extends_levelofaccess = {NA}, author = {Corte, E. and Sachero, S. and Ditalia Tchernij, S. and L{\"u}hmann, T. and Pezzagna, S. and Traina, P. and Degiovanni, I.P. and Moreva, E. and Olivero, P. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021, subid = {2336}, title = {Frequency drift in MR spectroscopy at 3T}, journal = {NeuroImage}, year = {2021}, month = {11}, volume = {241}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {118430}, keywords = {Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2021.118430}, stag_bib_extends_levelofaccess = {NA}, author = {Hui, S.C.N. and Mikkelsen, M. and Z{\"o}llner, H.J. and Ahluwalia, V. and Alcauter, S. and Baltusis, L. and Barany, D.A. and Barlow, L.R. and Becker, R. and Berman, J.I. and Berrington, A. and Bhattacharyya, P.K. and Blicher, J.U. and Bogner, W. and Brown, M.S. and Calhoun, V.D. and Castillo, R. and Cecil, K.M. and Choi, Y.B. and Chu, W.C.W. and Clarke, W.T. and Craven, A.R. and Cuypers, K. and Dacko, M. and de la Fuente-Sandoval, C. and Desmond, P. and Domagalik, A. and Dumont, J. and Duncan, N.W. and Dydak, U. and Dyke, K. and Edmondson, D.A. and Ende, G. and Ersland, L. and Evans, C.J. and Fermin, A.S.R. and Ferretti, A. and Fillmer, A. and Gong, T. and Greenhouse, I. and Grist, J.T. and Gu, M. and Harris, A.D. and Hat, K. and Heba, S. and Heckova, E. and Hegarty, J.P. and Heise, K-F. and Honda, S. and Jacobson, A. and Jansen, J.F.A. and Jenkins, C.W. and Johnston, S.J. and Juchem, C. and Kangarlu, A. and Kerr, A.B. and Landheer, K. and Lange, T. and Lee, P. and Levendovszky, S.R. and Limperopoulos, C. and Liu, F. and Lloyd, W. and Lythgoe, D.J. and Machizawa, M.G. and MacMillan, E.L. and Maddock, R.J. and Manzhurtsev, A.V. and Martinez-Gudino, M.L. and Miller, J.J. and Mirzakhanian, H. and Moreno-Ortega, M. and Mullins, P.G. and Nakajima, S. and Near, J. and Noeske, R. and Nordh{\o}y, W. and Oeltzschner, G. and Osorio-Duran, R. and Otaduy, M.C.G. and Pasaye, E.H. and Peeters, R. and Peltier, S.J. and Pilatus, U. and Polomac, N. and Porges, E.C. and Pradhan, S. and Prisciandaro, J.J. and Puts, N.A. and Rae, C.D. and Reyes-Madrigal, F. and Roberts, T.P.L. and Robertson, C.E. and Rosenberg, J.T. and Rotaru, D-G. and O'Gorman Tuura, R.L. and Saleh, M.G. and Sandberg, K. and Sangill, R. and Schembri, K. and Schrantee, A. and Semenova, N.A. and Singel, D. and Sitnikov, R. and Smith, J. and Song, Y. and Stark, C. and Stoffers, D. and Swinnen, S.P. and Tain, R. and Tanase, C. and Tapper, S. and Tegenthoff, M. and Thiel, T. and Thioux, M. and Truong, P. and van Dijk, P. and Vella, N. and Vidyasagar, R. and Vovk, A. and Wang, G. and Westlye, L.T. and Wilbur, T.K. and Willoughby, W.R. and Wilson, M. and Wittsack, H-J. and Woods, A.J. and Wu, Y-C. and Xu, J. and Lopez, M.Y. and Yeung, D.K.W. and Zhao, Q. and Zhou, X. and Zupan, G. and Edden, R.A.E.} } @Article { DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021, subid = {2365}, title = {A Comprehensive Description of Multi-Term LSM for Applying Multiple a Priori Constraints in Problems of Atmospheric Remote Sensing: GRASP Algorithm, Concept, and Applications}, journal = {Frontiers in Remote Sensing}, year = {2021}, month = {10}, day = {19}, volume = {2}, number2 = {19ENV04: MAPP: Metrology for aerosol optical properties}, keywords = {GRASP, Radiative Transfer, Inversion model}, web_url = {https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full}, misc2 = {EMPIR 2019: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-6187}, DOI = {10.3389/frsen.2021.706851}, stag_bib_extends_levelofaccess = {NA}, author = {Dubovik, O. and Fuertes, D. and Litvinov, P. and Lopatin, A. and Lapyonok, T. and Doubovik, I. and Xu, F. and Ducos, F. and Chen, C. and Torres, B. and Derimian, Y. and Li, L. and Herreras-Giralda, M. and Herrera, M. and Karol, Y. and Matar, C. and Schuster, G.L. and Espinosa, R. and Puthukkudy, A. and Li, Z. and Fischer, J. and Preusker, R. and Cuesta, J. and Kreuter, A. and Cede, A. and Aspetsberger, M. and Marth, D. and Bindreiter, L. and Hangler, A. and Lanzinger, V. and Holter, C. and Federspiel, C.} } @Proceedings { MingottiCPT2021, subid = {2575}, title = {External Magnetic Fields Effect on Harmonics Measurements with Rogowski coils}, journal = {Workshop AMPS 2021}, year = {2021}, month = {10}, volume = {1}, number = {1}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, pages = {1-6}, keywords = {instrument transformer}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Cagliari}, event_name = {Workshop on Applied Measurement for Power Systems}, event_date = {29-09-2021 to 01-10-2021}, language = {30}, ISBN = {978-1-7281-6923-1}, ISSN = {2475-2304}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5946938}, author = {Mingotti, A. and Costa, F. and Peretto, L. and Tinarelli, R.} } @Article { SantafeGabardaFTC2021, subid = {2273}, title = {Primary facility for traceable measurement of the BSSRDF}, journal = {Optics Express}, year = {2021}, month = {10}, volume = {29}, number = {21}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {34175}, keywords = {BSSRDF, translucency, reflectance, measurement, gonispectrophotometry}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.439108}, stag_bib_extends_levelofaccess = {NA}, author = {Santaf{\'e}-Gabarda, P. and Ferrero, A. and Tejedor-Sierra, N. and Campos, J.} } @Article { TangSJHCMT2021, subid = {2730}, title = {Cavity-immune spectral features in the pulsed superradiant crossover regime}, journal = {Physical Review Research}, year = {2021}, month = {9}, day = {17}, volume = {3}, number = {3}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {superradiance}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.3.033258}, stag_bib_extends_levelofaccess = {NA}, author = {Tang, M. and Sch{\"a}ffer, S.A. and J{\o}rgensen, A.A. and Henriksen, M.R. and Christensen, B.T.R. and M{\"u}ller, J.H. and Thomsen, J.W.} } @Article { BuonacorsiSSTKHHRWB2021, subid = {2168}, title = {Non-adiabatic single-electron pumps in a dopant-free GaAs/AlGaAs 2DEG}, journal = {Applied Physics Letters}, year = {2021}, month = {9}, day = {13}, volume = {119}, number = {11}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {114001}, keywords = {Single electron transport, quantum dot, dopant-free GaAs/AlGaAs system, quantum transport, single electron pump}, web_url = {https://arxiv.org/abs/2102.13320}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0062486}, stag_bib_extends_levelofaccess = {NA}, author = {Buonacorsi, B. and Sfigakis, F. and Shetty, A. and Tam, M.C. and Kim, H.S. and Harrigan, S.R. and Hohls, F. and Reimer, M.E. and Wasilewski, Z.R. and Baugh, J.} } @Article { TeirLWHBFPL2021, subid = {2254}, title = {In-Line Measurement of the Surface Texture of Rolls Using Long Slender Piezoresistive Microprobes}, journal = {Sensors}, year = {2021}, month = {9}, volume = {21}, number = {17}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {5955}, keywords = {silicon microprobe, high speed, roughness, paper machine roll, metrology}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21175955}, stag_bib_extends_levelofaccess = {NA}, author = {Teir, L. and Lindstedt, T. and Widmaier, T. and Hemming, B. and Brand, U. and Fahrbach, M. and Peiner, E. and Lassila, A.} } @Article { YamakawaATBFBKRD2021, subid = {2038}, title = {Hg isotopic composition of one-year-old spruce shoots: Application to long-term Hg atmospheric monitoring in Germany}, journal = {Chemosphere}, year = {2021}, month = {9}, volume = {279}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {130631}, keywords = {Hg isotopic composition, spruce shoots, Hg atmospheric monitoring}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0045-6535}, DOI = {10.1016/j.chemosphere.2021.130631}, stag_bib_extends_levelofaccess = {NA}, author = {Yamakawa, A. and Amouroux, D. and Tessier, E. and B{\'e}rail, S. and Fettig, I. and Barre, J.P.G. and Koschorreck, J. and R{\"u}del, H. and Donard, O.F.X.} } @Article { SeegerT2021, subid = {2194}, title = {Primary calibration of mechanical sensors with digital output for dynamic applications}, journal = {Acta IMEKO}, year = {2021}, month = {9}, volume = {10}, number = {3}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, pages = {177 - 184}, keywords = {Primary calibration; MEMS; complex frequency response; digital interface; dynamic measurement}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-10\%20\%282021\%29-03-24/0}, misc2 = {EMPIR 2017: Industry}, publisher = {IMEKO}, address = {Braunschweig}, language = {30}, ISSN = {2221-870X}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {IMEKO-ACTA-10 (2021)-03-24}, author = {Seeger, B. and Thomas, B.} } @Article { FerreroBCVHYACMT2021, subid = {2146}, title = {Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes}, journal = {Nanomaterials}, year = {2021}, month = {8}, day = {25}, volume = {11}, number = {9}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {2179}, keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11092179}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Barrera, G. and Celegato, F. and Vicentini, M. and H{\"u}seyin, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.} } @Article { AhlawatSGTW2021, subid = {2479}, title = {Observation of systematic deviations between Faraday cup aerosol electrometers for varying particle sizes and flowrates—results of the AEROMET FCAE workshop}, journal = {Metrologia}, year = {2021}, month = {8}, day = {5}, volume = {58}, number = {5}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {8}, keywords = {Faraday cup aerosol electrometer, CPC calibration, inter-comparison}, web_url = {https://iopscience.iop.org/journal/0026-1394}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/1681-7575/ac0710}, stag_bib_extends_levelofaccess = {NA}, author = {Ahlawat, A. and Seeger, S. and Gottschalk, M. and Tuch, T. and Wiedensohler, A.} } @Article { EdlerBGJTAASZ2021, subid = {2137}, title = {Pt-40\%Rh Versus Pt-6\%Rh Thermocouples: An emf-Temperature Reference Function for the Temperature Range 0 \(^{\circ}\)C to 1769 \(^{\circ}\)C}, journal = {International Journal of Thermophysics}, year = {2021}, month = {8}, volume = {42}, number = {11}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {1-13}, keywords = {Noble metal thermocouples, Reference function, Thermoelectric stability and homogeneity}, web_url = {https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf.}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-021-02895-w}, stag_bib_extends_levelofaccess = {NA}, author = {Edler, F. and Bojkovski, J. and Garcia Izquerdo, C. and Jose Martin, M. and Tucker, D. and Arifovic, N. and Andersen, S.L. and Šindel{\'a}rov{\'a}, L. and Žužek, V.} } @Article { HodoroabaHPMDT2021, subid = {2142}, title = {Nanoparticle size, shape, and concentration measurement at once – two VAMAS pre-standardization projects ready to start}, journal = {Microscopy and Microanalysis}, year = {2021}, month = {7}, day = {30}, volume = {27}, number = {S1}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {2250-2251}, keywords = {Electron microscopy, Inter-laboratory comparison, Nanoparticles, SiO2, TiO2, VAMAS}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press (CUP)}, language = {30}, ISSN = {1431-9276, 1435-8115}, DOI = {10.1017/S1431927621008126}, stag_bib_extends_levelofaccess = {NA}, author = {Hodoroaba, V-D. and H{\"o}renz, C. and Pellegrino, F. and Maurino, V. and Durand, B. and Tache, O.} } @Article { FogliettaPGBPDTSC2021, subid = {2264}, title = {Sonodynamic Treatment Induces Selective Killing of Cancer Cells in an In Vitro Co-Culture Model}, journal = {Cancers}, year = {2021}, month = {7}, day = {30}, volume = {13}, number = {15}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {3852}, keywords = {ultrasound; sonodynamic therapy; cancer cells; membrane fluidity}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-6694}, DOI = {10.3390/cancers13153852}, stag_bib_extends_levelofaccess = {NA}, author = {Foglietta, F. and Pinnelli, V. and Giuntini, F. and Barbero, N. and Panzanelli, P. and Durando, G. and Terreno, E. and Serpe, L. and Canaparo, R.} } @Article { SilvaniKTC2021, subid = {2426}, title = {Impact of the interfacial Dzyaloshinskii-Moriya interaction on the band structure of one-dimensional artificial magnonic crystals: a micromagnetic study}, journal = {Journal of Magnetism and magnetic Materials}, year = {2021}, month = {7}, day = {27}, volume = {539}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {168342}, keywords = {Magnonic Crystals, spin waves, DMI}, web_url = {https://doi.org/10.1016/j.jmmm.2021.168342}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier}, language = {30}, ISSN = {0304-8853}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2112.05360}, author = {Silvani, R. and Kuepferling, M. and Tacchi, S. and Carlotti, G.} } @Article { TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021, subid = {2260}, title = {A multicentre and multi-national evaluation of the accuracy of quantitative Lu-177 SPECT/CT imaging performed within the MRTDosimetry project}, journal = {EJNMMI Physics}, year = {2021}, month = {7}, day = {23}, volume = {8}, number = {1}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, keywords = {Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2197-7364}, DOI = {10.1186/s40658-021-00397-0}, stag_bib_extends_levelofaccess = {NA}, author = {Tran-Gia, J. and Denis-Bacelar, A.M. and Ferreira, K.M. and Robinson, A.P. and Calvert, N. and Fenwick, A.J. and Finocchiaro, D. and Fioroni, F. and Grassi, E. and Heetun, W. and Jewitt, S.J. and Kotzassarlidou, M. and Ljungberg, M. and McGowan, D.R. and Scott, N. and Scuffham, J. and Gleisner, K.S. and Tipping, J. and Wevrett, J. and Bardi{\`e}s, M. and Berenato, S. and Bilas, I. and Bobin, C. and Capogni, M. and Chauvin, M. and COLLINS, S. and Cox, M. and Dabin, J. and D’Arienzo, M. and Gustafsson, J. and Hallam, A. and Kalathas, T. and Kayal, G. and Lorusso, G. and Maringer, F-J. and Morgan, D. and Smyth, V. and Solc, J. and Štemberkov{\'a}, L. and Struelens, L. and Vergara-Gil, A. and Wiedner, H. and Lassmann, M.} } @Proceedings { TeichelLW2021, subid = {2355}, title = {Assessing Time Transfer Methods for Accuracy and Reliability: Navigating the Time Transfer Trade-off Triangle}, journal = {2021 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)}, year = {2021}, month = {7}, day = {17}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, keywords = {time transfer techniques, synchronization techniques, NTP, Network Time Security, assessment, accuracy, evaluation}, web_url = {https://oar.ptb.de/resources/show/10.7795/820.20211123K}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Online}, event_name = {2021 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {07-07-2021 to 17-07-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {10.7795/820.20211123K}, author = {Teichel, K. and Lehtonen, T. and Wallin, A.} } @Article { tenHaveAHPMSL2021, subid = {2120}, title = {Estimation of Static Energy Meter Interference in Waveforms Obtained in On-Site Scenarios}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2021}, month = {7}, day = {12}, volume = {1}, number = {1}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {1-8}, keywords = {Electromagnetic interference (EMI), nonlinear waveforms, on-site survey, static energy meters, time domain.}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2021.3089877}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Azpurua, M.A. and Hartman, T. and Pous, M. and Moonen, N. and Silva, F. and Leferink, F.} } @Article { MarzanoTDSEOPKC2021, subid = {2115}, title = {Design and development of a coaxial cryogenic probe for precision measurements of the quantum Hall effect in the AC regime}, journal = {ACTA IMEKO}, year = {2021}, month = {6}, day = {29}, volume = {10}, number = {2}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {24}, keywords = {Quantum Hall effect, Metrology, Impedance, Graphene, Cryogenic probe}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-10\%20\%282021\%29-02-05}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v10i2.925}, stag_bib_extends_levelofaccess = {NA}, author = {Marzano, M. and Tran, N.T.M. and D'Elia, V. and Serazio, D. and Enrico, E. and Ortolano, M. and Pierz, K. and Kucera, J. and Callegaro, L.} } @Article { TrimMH2021, subid = {2112}, title = {Spectroradiometer spectral calibration, ISRF shapes, and related uncertainties}, journal = {Applied Optics}, year = {2021}, month = {6}, day = {16}, volume = {60}, number = {18}, number2 = {19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system}, pages = {5405}, keywords = {Spectroradiometer, spectral calibration, ISRF Shapes, Instrument line shape, slit function}, misc2 = {EMPIR 2019: Environment}, publisher = {The Optical Society}, language = {30}, ISSN = {1559-128X, 2155-3165}, DOI = {10.1364/AO.425676}, stag_bib_extends_levelofaccess = {NA}, author = {Trim, S.A. and Mason, K. and Hueni, A.} } @Proceedings { ThompsonRSEHL2021, subid = {2410}, title = {Calibration of X-ray computed tomography for surface topography measurement using metrological characteristics}, journal = {Proceedings 21st euspen International Conference and Exhibition}, year = {2021}, month = {6}, day = {10}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {Metrology, surface topography, metrological characteristics, X-ray computed tomography}, misc2 = {EMPIR 2017: Industry}, event_place = {Online Conference}, event_name = {21st euspen International Conference and Exhibition}, event_date = {07-06-2021 to 10-06-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE21165.pdf}, author = {Thompson, A. and Rodr{\'i}guez-S{\'a}nchez, {\'A}. and Senin, N. and Eifler, M. and Hering, J. and Leach, R.} } @Proceedings { SchodelKMTHWSPP2021, subid = {2106}, title = {Design and manufacture of a reference interferometer for long-range distance metrology}, journal = {Proceedings of the euspen 21st International Conference \& Exhibition}, year = {2021}, month = {6}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {511-512}, keywords = {Geodetic length instrumentation, closed-frame design, thermal and long-term stability, manual positioning system, precision assembly}, misc2 = {EMPIR 2018: SI Broader Scope}, event_place = {Copenhagen, DK}, event_name = {euspen 21st International Conference \& Exhibition}, event_date = {07-06-2021 to 11-06-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE21222.pdf}, author = {Sch{\"o}del, R. and K{\"o}chert, P. and Meyer, T. and Truong, D. and Huismann, J. and Weinrich, S. and Schmaljohann, F. and Pilarski, F. and Pollinger, F.} } @Article { DitaliaTchernijCLTPDPMMOGF2021, subid = {2261}, title = {Spectral features of Pb-related color centers in diamond – a systematic photoluminescence characterization}, journal = {New Journal of Physics}, year = {2021}, month = {6}, volume = {23}, number = {6}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {063032}, keywords = {diamond, ion implantation, single photon emitters, luminescent centers, Pb-related color center}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac038a}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and Corte, E. and L{\"u}hmann, T. and Traina, P. and Pezzagna, S. and Degiovanni, I.P. and Provatas, G. and Moreva, E. and Meijer, J. and Olivero, P. and Genovese, M. and Forneris, J.} } @Article { DitaliaTchernijCLTPDPMMOGF20210, subid = {2261}, title = {Spectral features of Pb-related color centers in diamond – a systematic photoluminescence characterization}, journal = {New Journal of Physics}, year = {2021}, month = {6}, volume = {23}, number = {6}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {063032}, keywords = {diamond, ion implantation, single photon emitters, luminescent centers, Pb-related color center}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac038a}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and Corte, E. and L{\"u}hmann, T. and Traina, P. and Pezzagna, S. and Degiovanni, I.P. and Provatas, G. and Moreva, E. and Meijer, J. and Olivero, P. and Genovese, M. and Forneris, J.} } @Article { DitaliaTchernijCLTPDPMMOGF20211, subid = {2261}, title = {Spectral features of Pb-related color centers in diamond – a systematic photoluminescence characterization}, journal = {New Journal of Physics}, year = {2021}, month = {6}, volume = {23}, number = {6}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {063032}, keywords = {diamond, ion implantation, single photon emitters, luminescent centers, Pb-related color center}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac038a}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and Corte, E. and L{\"u}hmann, T. and Traina, P. and Pezzagna, S. and Degiovanni, I.P. and Provatas, G. and Moreva, E. and Meijer, J. and Olivero, P. and Genovese, M. and Forneris, J.} } @Article { LombardiCDMMT2021, subid = {2509}, title = {Triggered emission of indistinguishable photons from an organic dye molecule}, journal = {Applied Physics Letters}, year = {2021}, month = {5}, day = {17}, volume = {118}, number = {20}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {204002}, keywords = {single-photon source, indistinguishability, molecule single-photon source}, web_url = {https://aip.scitation.org/doi/10.1063/5.0048567}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0048567}, stag_bib_extends_levelofaccess = {NA}, author = {Lombardi, P. and Colautti, M. and Duquennoy, R. and Murtaza, G. and Majumder, P. and Toninelli, C.} } @Proceedings { D039AvanzoFLLLLOT2021, subid = {2566}, title = {Improving Harmonic Measurements with Instrument Transformers: a Comparison Among Two Techniques}, journal = {2021 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2021}, month = {5}, day = {17}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, keywords = {Instrument Transformers (IT), Power Quality (PQ), harmonics, harmonics measurement, power systemmeasurements, harmonic distortion, nonlinearity, compensation}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Glasgow, United Kingdom}, event_name = {2021 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {17-05-2021 to 20-05-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6104280}, author = {D'Avanzo, G. and Faifer, M. and Landi, C. and Laurano, C. and Letizia, P.S. and Luiso, M. and Ottoboni, R. and Toscani, S.} } @Article { GolokolenovGKPT2021, subid = {2051}, title = {On the origin of the controversial electrostatic field effect in superconductors}, journal = {Nature Communications}, year = {2021}, month = {5}, day = {12}, volume = {12}, number = {1}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, keywords = {superconducting devices, superconductor electronics, electrostatic field effect}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-021-22998-0}, stag_bib_extends_levelofaccess = {NA}, author = {Golokolenov, I. and Guthrie, A. and Kafanov, S. and Pashkin, Y.A. and Tsepelin, V.} } @Article { RebufelloPALVTGBCVDG2021, subid = {2447}, title = {Protective Measurement—A New Quantum Measurement Paradigm: Detailed Description of the First Realization}, journal = {Applied Sciences}, year = {2021}, month = {5}, volume = {11}, number = {9}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4260}, keywords = {Quantum Measurement, Weak Measurement, Quantum Metrology, Single Photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11094260}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and Avella, A. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { SiekkinenKKSFSTISTT2021, subid = {2109}, title = {Assessment of a digital and an analog PET/CT system for accurate myocardial perfusion imaging with a flow phantom}, journal = {Journal of Nuclear Cardiology}, year = {2021}, month = {5}, volume = {n/a}, number = {n/a}, number2 = {19SIP04: TracPETperf: Software for evaluating PET cardiac perfusion imaging uncertainties for more accurate diagnosis}, pages = {n/a}, keywords = {digital and analog PET/CT system, myocardial perfusion imaging, flow phantom}, misc2 = {EMPIR 2019: Support for Impact}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1071-3581, 1532-6551}, DOI = {10.1007/s12350-021-02631-9}, stag_bib_extends_levelofaccess = {NA}, author = {Siekkinen, R. and Kirjavainen, A.K. and Koskensalo, K. and Smith, N.A.S. and FENWICK, A. and Saunavaara, V. and Tolvanen, T. and Iida, H. and Saraste, A. and Ter{\"a}s, M. and Teuho, J.} } @Article { MelendezSanchezTGL2021, subid = {2078}, title = {Mapping of temperature and CO2 column density in a standard flame by multispectral imaging}, journal = {Thermosense: Thermal Infrared Applications XLIII}, year = {2021}, month = {4}, day = {28}, volume = {N/A}, number = {N/A}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {N/A}, keywords = {flame thermometry, EMPRESS 2, combustion thermometry, temperature, temperature traceability}, web_url = {https://www.spiedigitallibrary.org/conference-proceedings-of-spie/11743/2585805/Mapping-of-temperature-and-CO2-column-density-in-a-standard/10.1117/12.2585805.full}, misc2 = {EMPIR 2017: Industry}, publisher = {SPIE}, language = {30}, DOI = {10.1117/12.2585805}, stag_bib_extends_levelofaccess = {NA}, author = {Mel{\'e}ndez Sanchez, J. and Talavante, J. and Guarnizo, G. and L{\'o}pez, F.} } @Article { PeikSSPWT2021, subid = {2228}, title = {Nuclear clocks for testing fundamental physics}, journal = {Quantum Science and Technology}, year = {2021}, month = {4}, day = {15}, volume = {6}, number = {3}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {034002}, keywords = {nuclear clock, fundamental physics, thorium-229 isomer, dark matter searches}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2058-9565}, DOI = {10.1088/2058-9565/abe9c2}, stag_bib_extends_levelofaccess = {NA}, author = {Peik, E. and Schumm, T. and Safronova, M.S. and P{\'a}lffy, A. and Weitenberg, J. and Thirolf, P.G.} } @Article { JoBAFSWTDRGKPR2021, subid = {2125}, title = {Quantum Hall Valley Splitters and a Tunable Mach-Zehnder Interferometer in Graphene}, journal = {Physical Review Letters}, year = {2021}, month = {4}, volume = {126}, number = {14}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {146803}, keywords = {Graphene, electron interferometer, Mach-Zehnder, Quantum Hall Valley Beam Splitter}, web_url = {https://arxiv.org/abs/2011.04958}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.146803}, stag_bib_extends_levelofaccess = {NA}, author = {Jo, M. and Brasseur, P. and Assouline, A. and Fleury, G. and Sim, H-S. and Watanabe, K. and Taniguchi, T. and Dumnernpanich, W. and Roche, P. and Glattli, D.C. and Kumada, N. and Parmentier, F.D. and Roulleau, P.} } @Article { GruberBALBPCPDTCFSQ2021, subid = {2028}, title = {Comparison of radon mapping methods for the delineation of radon priority areas – an exercise}, journal = {Journal of the European Radon Association}, year = {2021}, month = {3}, day = {31}, volume = {2}, number = {2021}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {1-14}, keywords = {radon, mapping, prediction, interpolation, radon priority areas, risk, hazard}, web_url = {https://radonjournal.net/index.php/radon/article/view/5755}, misc2 = {EMPIR 2016: Environment}, publisher = {European Radon Association}, language = {30}, ISSN = {2736-2272}, DOI = {10.35815/radon.v2.5755}, stag_bib_extends_levelofaccess = {NA}, author = {Gruber, V. and Baumann, S. and Alber, O. and Laubichler, C. and Bossew, P. and Petermann, E. and Ciotoli, G. and Pereira , A. and Domingos, F. and Tondeur, F. and Cinelli, G. and Fernandez , A. and Sainz, C. and Quindos-Poncela, L.} } @Article { PanuTTMAKF2021, subid = {2201}, title = {Real-time HCl gas detection at parts-per-billion level concentrations utilising a diode laser and a bismuth-doped fibre amplifier}, journal = {Measurement Science and Technology}, year = {2021}, month = {3}, day = {26}, volume = {32}, number = {5}, number2 = {17IND09: MetAMCII: Metrology for Airborne Molecular Contaminants II}, pages = {055206}, keywords = {gas sensing, photoacoustic spectroscopy, laser, bismuth, fibre, cleanroom}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abd651}, stag_bib_extends_levelofaccess = {NA}, author = {Panu, H. and Timo, R. and Thomas, F. and Makkonen, J. and Alyshev, S. and Kharakhordin, A. and Firstov, S.} } @Article { SilvaniATC2021, subid = {2021}, title = {Effect of the Interfacial Dzyaloshinskii–Moriya Interaction on the Spin Waves Eigenmodes of Isolated Stripes and Dots Magnetized In-Plane: A Micromagnetic Study}, journal = {Applied Sciences}, year = {2021}, month = {3}, day = {25}, volume = {11}, number = {7}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {2929}, keywords = {Micromagnetism, DMI, Magnetic dots}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11072929}, stag_bib_extends_levelofaccess = {NA}, author = {Silvani, R. and Alunni, M. and Tacchi, S. and Carlotti, G.} } @Article { KietheTLKMM2021, subid = {2421}, title = {Finite-temperature spectrum at the symmetry-breaking linear to zigzag transition}, journal = {Physical Review B}, year = {2021}, month = {3}, volume = {103}, number = {10}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {104106}, keywords = {research areas, second order phase transitions, structural phase transition, physical systems, trapped ions, techniques, atom and ion cooling, molecular dynamics, atomic, molecular and optical}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {ISSN 2469-9969 (online), 2469-}, DOI = {10.1103/PhysRevB.103.104106}, stag_bib_extends_levelofaccess = {NA}, author = {Kiethe, J. and Timm, L. and Landa, H. and Kalincev, D. and Morigi, G. and Mehlst{\"a}ubler, T.E.} } @Article { GogyanTZ2021, subid = {2734}, title = {Multi-reference ab initio calculations of Hg spectral data and analysis of magic and zero-magic wavelengths}, journal = {Optics Express}, year = {2021}, month = {3}, volume = {29}, number = {6}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {8654}, keywords = {Hg spectrum, magic wavelength}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.416106}, stag_bib_extends_levelofaccess = {NA}, author = {Gogyan, A. and Tecmer, P. and Zawada, M.} } @Article { OkhapkinTSSBP2021, subid = {2227}, title = {The thorium-229 low-energy isomer and the nuclear clock}, journal = {Nature Reviews Physics}, year = {2021}, month = {2}, day = {25}, volume = {3}, number = {4}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {238-248}, keywords = {Atomic and molecular interactions with photonsExperimental nuclear physics}, web_url = {https://oar.ptb.de/resources/show/10.7795/120.20211006}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2522-5820}, DOI = {10.1038/s42254-021-00286-6}, stag_bib_extends_levelofaccess = {NA}, author = {Okhapkin, M.V. and Thielking, J. and Schumm, T. and Sikorsky, T. and Beeks, K. and Peik, E.} } @Article { ZuccaCBSLCTFP2021, subid = {1918}, title = {Assessment of the Overall Efficiency in WPT Stations for Electric Vehicles}, journal = {Sustainability}, year = {2021}, month = {2}, day = {24}, volume = {13}, number = {5}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {2436}, keywords = {electric vehicles; inductive charging; measurement uncertainty; power system measurements}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2071-1050}, DOI = {10.3390/su13052436}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Cirimele, V. and Bruna, J. and Signorino, D. and Laporta, E. and Colussi, J. and Tejedor, M.A.A. and Fissore, F. and Pogliano, U.} } @Article { KuttTSLKSL2021, subid = {2184}, title = {Strengths of Acids in Acetonitrile}, journal = {European Journal of Organic Chemistry}, year = {2021}, month = {2}, day = {16}, volume = {2021}, number = {9}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1407-1419}, keywords = {acidity;acetonitrile pKa scale}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {1434-193X, 1099-0690}, DOI = {10.1002/ejoc.202001649}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}tt, A. and Tshepelevitsh, S. and Saame, J. and L{\~o}kov, M. and Kaljurand, I. and Selberg, S. and Leito, I.} } @Article { LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021, subid = {2093}, title = {Roadmap on quantum nanotechnologies}, journal = {Nanotechnology}, year = {2021}, month = {2}, volume = {32}, number = {16}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {162003}, keywords = {Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/abb333}, stag_bib_extends_levelofaccess = {NA}, author = {Laucht, A. and Hohls, F. and Ubbelohde, N. and Fernando Gonzalez-Zalba, M. and Reilly, D.J. and Stobbe, S. and Schr{\"o}der, T. and Scarlino, P. and Koski, J.V. and Dzurak, A. and Yang, C-H. and Yoneda, J. and Kuemmeth, F. and Bluhm, H. and Pla, J. and Hill, C. and Salfi, J. and Oiwa, A. and Muhonen, J.T. and Verhagen, E. and LaHaye, M.D. and Kim, H.H. and Tsen, A.W. and Culcer, D. and Geresdi, A. and Mol, J.A. and Mohan, V. and Jain, P.K. and Baugh, J.} } @Article { SobanskiTSLKIPHE2021, subid = {1916}, title = {Advances in High-Precision NO2 Measurement by Quantum Cascade Laser Absorption Spectroscopy}, journal = {Applied Sciences}, year = {2021}, month = {1}, day = {29}, volume = {11}, number = {3}, number2 = {16ENV05: MetNO2: Metrology for nitrogen dioxide}, pages = {1222}, keywords = {air pollution; trace gas; nitrogen dioxide; laser spectroscopy; mid-infrared; quantum cascade laser; selective detection}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11031222}, stag_bib_extends_levelofaccess = {NA}, author = {Sobanski, N. and Tuzson, B. and Scheidegger, P. and Looser, H. and Kupferschmid, A. and Iturrate, M. and Pascale, C. and H{\"u}glin, C. and Emmenegger, L.} } @Article { GutierrezRivasTRD2021, subid = {2061}, title = {Enhancing White Rabbit Synchronization Stability and Scalability using P2P Transparent and Hybrid Clocks}, journal = {IEEE Transactions on Industrial Informatics}, year = {2021}, month = {1}, day = {25}, number2 = {17IND14: WRITE: Precision Time for Industry}, pages = {1-1}, keywords = {White RabbitPTPSyncEScalabilityStabilityAcceleratorsTelecom5G}, misc2 = {EMPIR 2017: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1551-3203, 1941-0050}, DOI = {10.1109/TII.2021.3054365}, stag_bib_extends_levelofaccess = {NA}, author = {Gutierrez-Rivas, J.L. and Torres-Gonzalez, F. and Ros, E. and Diaz, J.} } @Article { SteierDBTOCC2021, subid = {1871}, title = {Insights from Transient Absorption Spectroscopy into Electron Dynamics Along the Ga‐Gradient in Cu(In,Ga)Se2 Solar Cells}, journal = {Advanced Energy Materials}, year = {2021}, month = {1}, day = {14}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {2003446}, keywords = {CIGS, transient absorption spectroscopy}, misc2 = {EMPIR 2016: Energy}, publisher = {Wiley}, language = {30}, ISSN = {1614-6832, 1614-6840}, DOI = {10.1002/aenm.202003446}, stag_bib_extends_levelofaccess = {NA}, author = {Steier, L. and Durrant, J.R. and Bozal‐Ginesta, C. and Tiwari, A.N. and Ochoa, M. and Carron, R. and Chang, Y‐H.} } @Article { LangeHRSSLTWP2021, subid = {1854}, title = {Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons}, journal = {Physical Review Letters}, year = {2021}, month = {1}, volume = {126}, number = {1}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {011102}, keywords = {Optical clocks, Tests of fundamental principles, Time \& frequency standards, Quantum metrology}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.011102}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Rahm, J.M. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Weyers, S. and Peik, E.} } @Article { LangeHRSSLTWP20210, subid = {1854}, title = {Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons}, journal = {Physical Review Letters}, year = {2021}, month = {1}, volume = {126}, number = {1}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {011102}, keywords = {Optical clocks, Tests of fundamental principles, Time \& frequency standards, Quantum metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.011102}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Rahm, J.M. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Weyers, S. and Peik, E.} } @Article { KrasniqiKLETRT2021, subid = {1827}, title = {Standoff UV-C imaging of alpha particle emitters}, journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment}, year = {2021}, month = {1}, volume = {987}, number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities}, pages = {164821}, keywords = {Optical remote detection, alpha radiation}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2020.164821}, stag_bib_extends_levelofaccess = {NA}, author = {Krasniqi, F.S. and Kerst, T. and Leino, M. and Eisheh, J-T. and Toivonen, H. and R{\"o}ttger, A. and Toivonen, J.} } @Article { JenningerABBDGISJKRSSSTTW2021, subid = {1775}, title = {Development of a design for an ionisation vacuum gauge suitable as a reference standard}, journal = {Vacuum}, year = {2021}, month = {1}, volume = {183}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {109884}, keywords = {Ionisation gauge, Hot cathode, Sensitivity, Simulation, Reference standard}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109884}, stag_bib_extends_levelofaccess = {NA}, author = {Jenninger, B. and Anderson, J. and Bernien, M. and Bundaleski, N. and Dimitrova, H. and Granovskij, M. and Illgen, C. and Šetina, J. and Jousten, K. and Kucharski, P. and Reinhardt, C. and Scuderi, F. and Silva, R.A.S. and St{\"o}ltzel, A. and Teodoro, O.M.N.D. and Trzpil-Jurgielewicz, B. and W{\"u}est, M.} } @Article { BescondOFGQTLO2021, subid = {2140}, title = {Method for Preparation of a Candidate Reference Material of PM10 and PM2.5 Airborne Particulate Filters Loaded with Incineration Ash-Inter Comparison Results for Metal Concentrations}, journal = {Atmosphere}, year = {2021}, month = {1}, volume = {12}, number = {1}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {67}, keywords = {aerosol; ambient air; EU air quality directives; ICP-MS intercomparison; incineration ash; particulate matter (PM); PM10; PM2.5; heavy metal analysis}, web_url = {https://www.mdpi.com/2073-4433/12/1/67}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4433}, DOI = {10.3390/atmos12010067}, stag_bib_extends_levelofaccess = {NA}, author = {Bescond, A. and Oster, C. and Fisicaro, P. and Goddard, S. and Quincey, P. and Tsakanika, L-A. and Lymperopoulou, T. and Ochsenkuehn-Petropoulou, M.} } @Article { VicarJJIBJBBST2021, subid = {2647}, title = {Electrons on a straight path: A novel ionisation vacuum gauge suitable as reference standard}, journal = {VACUUM}, year = {2021}, volume = {189}, number = {2021}, number2 = {20SIP01: ISO Gauge: Developing an ISO Technical Specification ''Characteristics for a stable ionisation vacuum gauge''}, pages = {110239}, keywords = {Ionisation vacuum gaugeHot cathodeSensitivitySecondary electronsIon induced secondary electron yield}, web_url = {https://arxiv.org/abs/2103.03566}, misc2 = {EMPIR 2020: Support for Impact}, publisher = {Elsevier Ltd}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2021.110239}, stag_bib_extends_levelofaccess = {NA}, author = {Vicar, M. and J{\"o}nnson, G. and Jenninger, B. and Illgen, C. and Bundaleski, N. and Jousten, K. and Boineau, F. and Bernien, M. and Šetina, J. and Teodoro, O.} } @Proceedings { CrottiMVMCTL2021, subid = {2572}, title = {ASSESSMENT OF INSTRUMENT TRANSFORMER ACCURACY FOR POWER QUALITY MEASUREMENTS IN DISTRIBUTION GRIDS: RECENT ACTIVITIES AND FIRST RESULTS FROM 19NRM05 IT4PQ PROJECT}, journal = {CIRED 2021 - The 26th International Conference and Exhibition on Electricity Distribution}, year = {2021}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, keywords = {Instrument Transformers, Power Quality Measurements, Calibration, Measurement Technique, Measurement Uncertainty}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Institution of Engineering and Technology}, event_place = {Virtual Conference}, event_name = {CIRED 2021}, event_date = {20-09-2021 to 23-09-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6136940}, author = {Crotti, G. and Meyer, J. and van den Brom, H. and Mohns, E. and Chen, Y. and Tinarelli, R. and Luiso, M.} } @Article { LovenDBKTRWI2021, subid = {1897}, title = {Toxicological effects of zinc oxide nanoparticle exposure: an in vitro comparison between dry aerosol air-liquid interface and submerged exposure systems}, journal = {Nanotoxicology}, year = {2021}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, keywords = {Air-liquid interface; NACIVT, aerosol, cell response, toxicity}, web_url = {https://www.tandfonline.com/doi/full/10.1080/17435390.2021.1884301}, misc2 = {EMPIR 2018: Health}, language = {30}, DOI = {10.1080/17435390.2021.1884301}, stag_bib_extends_levelofaccess = {NA}, author = {Lov{\'e}n , K. and Dobric, J. and B{\"o}l{\"u}kbas, D.A. and K{\aa}redal, M. and Tas, S. and Rissler, J. and Wagner, D.E. and Isaxon, C. } } @Article { TiainenVHH2021, subid = {2075}, title = {Analysis of total rotor runout components with multi-probe roundness measurement method}, journal = {Measurement}, year = {2021}, volume = {179}, number = {109422}, number2 = {19ENG07: Met4Wind: Metrology for enhanced reliability and efficiency of wind energy systems}, pages = {109422}, keywords = {Relative shaft displacement,Runout, Roundness, Shaft geometry, Electrical runout,Mechanical runout, Multi-probe roundness}, web_url = {https://www.sciencedirect.com/science/article/pii/S0263224121004115}, misc2 = {EMPIR 2019: Energy}, publisher = {Elsevier}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2021.109422}, stag_bib_extends_levelofaccess = {NA}, author = {Tiainen, T. and Viitala, R. and Holopainen, T.P. and Hemming, B.} } @Article { GeislerNSTR2021, subid = {2177}, title = {Analyzing the surface of functional nanomaterials – how to quantify the total and derivatizable number of functional groups and ligands}, journal = {Microchimica Acta}, year = {2021}, volume = {188}, number = {10}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {321}, keywords = {Functional group quantification, Surface ligand, Nanomaterial, Nanoparticle, Bead, Dye-based assay, Opticaldetection, Electrochemical titration, Instrumental analysis, Nanosafety, Safe-by-design}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Nature}, language = {30}, DOI = {10.1007/s00604-021-04960-5}, stag_bib_extends_levelofaccess = {NA}, author = {Gei{\ss}ler, D. and Nirmalananthan-Budau, N. and Scholtz, L. and Tavernaro, I. and Resch-Genger, U.} } @Article { GeislerNSTR20210, subid = {2177}, title = {Analyzing the surface of functional nanomaterials – how to quantify the total and derivatizable number of functional groups and ligands}, journal = {Microchimica Acta}, year = {2021}, volume = {188}, number = {10}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, pages = {321}, keywords = {Functional group quantification, Surface ligand, Nanomaterial, Nanoparticle, Bead, Dye-based assay, Opticaldetection, Electrochemical titration, Instrumental analysis, Nanosafety, Safe-by-design}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Nature}, language = {30}, DOI = {10.1007/s00604-021-04960-5}, stag_bib_extends_levelofaccess = {NA}, author = {Gei{\ss}ler, D. and Nirmalananthan-Budau, N. and Scholtz, L. and Tavernaro, I. and Resch-Genger, U.} } @Proceedings { KhanbabaeeRBRFHZTLdBGLCA2021, subid = {2235}, title = {Support for a European Metrology Network on reliable radiation protection: Gaps in radiation protection metrology}, journal = {Book of Abstracts}, year = {2021}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {European Metrology Network, radiation protection, radionuclide, radon, reference field, traceability}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {RAD Centre}, event_place = {Herceg Novi, Montenegro}, event_name = {RAD-Conference}, event_date = {14-06-2021 to 18-06-2021}, language = {30}, DOI = {10.21175/rad.abstr.book.2021.31.8}, stag_bib_extends_levelofaccess = {NA}, author = {Khanbabaee, B. and R{\"o}ttger, A. and Behrens, R. and R{\"o}ttger, S. and Feige, S. and Hupe, O. and Zutz, H. and Toroi, P. and Leonard, P. and de la Fuente Rosales, L. and Burgess, P. and Gressier, V. and Luis Gutierrez Villanueva, J. and Cruz Su{\'a}rez, R. and Arnold, D.} } @Proceedings { KhanbabaeeRBRFHZTLdBGGCA2021, subid = {2377}, title = {SUPPORT FOR A EUROPEAN METROLOGY NETWORK ON RELIABLE RADIATION PROTECTION: GAPS IN RADIATION PROTECTION AND RELATED METROLOGY}, journal = {RAD Conference Proceedings}, year = {2021}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {Activity standards, new operational quantities in radiation protection, type testing, calibration, radon,reference field, pulsed radiation, dosimetry, standards, radiological emergency response}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {RAD Centre}, event_place = {Herceg Novi, Montenegro}, event_name = {9th international conference on Radiation in various fields of research}, event_date = {14-06-2021 to 18-06-2021}, language = {30}, DOI = {10.21175/RadProc.2021.04}, stag_bib_extends_levelofaccess = {NA}, author = {Khanbabaee, B. and R{\"o}ttger, A. and Behrens, R. and R{\"o}ttger, S. and Feige, S. and Hupe, O. and Zutz, H. and Toroi, P. and Leonard, P. and de la Fuente Rosales, L. and Burgess, P. and Gressier, V. and Guti{\'e}rrez Villanueva, J–L. and Cruz Su{\'a}rez, R. and Arnold, D.} } @Proceedings { SinghTNMKGBBWZ2021, subid = {2732}, title = {Towards a Continuous Active Optical Atomic Clock With Cold Strontium Atoms}, journal = {2021 JOINT CONFERENCE OF THE EUROPEAN FREQUENCY AND TIME FORUM AND IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM (IEEE EFTF-IFCS 2021)}, year = {2021}, volume = {1}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Contiunous clock,}, web_url = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip}, misc2 = {EMPIR 2017: Fundamental}, event_place = {on line}, event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {09-07-2021 to 14-07-2021}, language = {30}, ISBN = {978-1-6654-3935-0}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {2327-1914}, author = {Singh, V. and Tonoyan, A. and Naroznik, M. and Morzyński, P. and Kovacic, D. and Gogyan, A. and Bilicki, S. and Bober, M. and Witkowski, M. and Zawada, M.} } @Article { NaccaratoTMMMZPAPNMWSMMSBPSW2020, subid = {2035}, title = {A field intercomparison of three passive air samplers for gaseous mercury in ambient air}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {12}, day = {29}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {atmnospheric gaseous mercury, passive samplers, intercomparison}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, DOI = {10.5194/amt-2020-455}, stag_bib_extends_levelofaccess = {NA}, author = {Naccarato, A. and Tassone, A. and Martino, M. and Moretti, S. and Macagnano, A. and Zampetti, E. and Papa, P. and Avossa, J. and Pirrone, N. and Nerentorp, M. and Munthe, J. and W{\"a}ngberg, I. and Stupple, G.W. and Mitchell, C.P.J. and Martin, A.R. and Steffen, A. and Babi, D. and Prestbo, E.M. and Sprovieri, F. and Wania, F.} } @Article { PojtingerNGPPKT2020, subid = {2375}, title = {Experimental determination of magnetic field correction factors for ionization chambers in parallel and perpendicular orientations}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {12}, day = {15}, volume = {65}, number = {24}, number2 = {19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy}, pages = {245044}, keywords = {MR-linac, dosimetry, alanine dosimetry, ionization chambers, magnetic field correction factors}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/abca06}, stag_bib_extends_levelofaccess = {NA}, author = {Pojtinger, S. and Nachbar, M. and Ghandour, S. and Pisaturo, O. and Pachoud, M. and Kapsch, R-P. and Thorwarth, D.} } @Article { Teir2020, subid = {1896}, title = {Microprobe surface roughness characterization}, journal = {Thesis - Master's Programme in Mechanical Engineering (MEC)}, year = {2020}, month = {12}, day = {14}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {Surface roughness, Microprobe, MicroProbes, Calibration}, web_url = {https://aaltodoc.aalto.fi/bitstream/handle/123456789/97492/master_Teir_Linus_2020.pdf?sequence=1\&isAllowed=y}, misc2 = {EMPIR 2017: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://urn.fi/URN:NBN:fi:aalto-2020122056319}, author = {Teir, L.} } @Article { DitaliaTchernijLCSPTBCPPDMAOSMGF2020, subid = {1730}, title = {Fluorine-based color centers in diamond}, journal = {Scientific Reports}, year = {2020}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {21537}, keywords = {Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-78436-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Corte, E. and Sardi, F. and Picollo, F. and Traina, P. and Brajković, M. and Crnjac, A. and Pezzagna, S. and Pastuović, Ž. and Degiovanni, I.P. and Moreva, E. and Apr{\`a}, P. and Olivero, P. and Siketić, Z. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { DitaliaTchernijLCSPTBCPPDMAOSMGF2020_2, subid = {1806}, title = {Fluorine-based color centers in diamond}, journal = {Scientific Reports}, year = {2020}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-78436-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Corte, E. and Sardi, F. and Picollo, F. and Traina, P. and Brajković, M. and Crnjac, A. and Pezzagna, S. and Pastuović, Ž. and Degiovanni, I.P. and Moreva, E. and Apr{\`a}, P. and Olivero, P. and Siketić, Z. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020, subid = {1841}, title = {The European Joint Research Project UHDpulse – Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, journal = {Physica Medica}, year = {2020}, month = {12}, volume = {80}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {134-150}, keywords = {Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2020.09.020}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}ller, A. and Heinrich, S. and Fouillade, C. and Subiel, A. and De Marzi, L. and Romano, F. and Peier, P. and Trachsel, M. and Fleta, C. and Kranzer, R. and Caresana, M. and Salvador, S. and Busold, S. and Sch{\"o}nfeld, A. and McEwen, M. and Gomez, F. and Solc, J. and Bailat, C. and Linhart, V. and Jakubek, J. and Pawelke, J. and Borghesi, M. and Kapsch, R-P. and Knyziak, A. and Boso, A. and Olsovcova, V. and Kottler, C. and Poppinga, D. and Ambrozova, I. and Schmitzer, C-S. and Rossomme, S. and Vozenin, M-C.} } @Article { HancockDBLBTDBHBM2020, subid = {1894}, title = {Arbitrarily large tomography with iterative algorithms on multiple GPUs using the TIGRE toolbox}, journal = {Journal of Parallel and Distributed Computing}, year = {2020}, month = {12}, volume = {146}, number = {1}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {52-63}, keywords = {Computed TomographyIterative reconstructionSoftwaremulti-GPU}, web_url = {https://arxiv.org/abs/1905.03748}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0743-7315}, DOI = {10.1016/j.jpdc.2020.07.004}, stag_bib_extends_levelofaccess = {NA}, author = {Hancock, S. and Dosanjh, M. and Biguri, A. and Lindroos, R. and Bryll, R. and Towsyfyan, H. and Deyhle, H. and Blumensath, T. and Harrane, I.E.K. and Boardman, R. and Mavrogordato, M.} } @Inbook { IoanRZTB2020, subid = {2624}, title = {Proiecte nationale si europene de metrologia radiatiilor, suport pentru implementarea Directivei 2013/59, in sanatate si protectia mediului}, year = {2020}, month = {12}, number2 = {19ENV02: RemoteALPHA: Remote and real-time optical detection of alpha-emitting radionuclides in the environment}, keywords = {Remote detection, optical detection, alpha particles}, web_url = {https://srrp.ro/wp-content/uploads/2020/12/Conf.Nat_._SRRp_-2020-A4-ver.12.pdf}, misc2 = {EMPIR 2019: Environment}, booktitle = {Conferinta Nationala Aniversara a Societatii Romane de Radioprotectie –„SRRp-30”}, language = {30}, ISBN = {978-973-1985-64-0}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {978-973-1985-64-0}, author = {Ioan, M-R. and Radulescu, I. and Zadehrafi, M. and Tugulan, L. and Barna, C.} } @Article { BarreQSDBTESdA2020, subid = {2036}, title = {Comparison of the Isotopic Composition of Hg and Pb in Two Atmospheric Bioaccumulators in a Pyrenean Beech Forest (Iraty Forest, Western Pyrenees, France/Spain)}, journal = {Frontiers in Environmental Chemistry}, year = {2020}, month = {11}, day = {23}, volume = {1}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {isotopic composition, mercury, biomonitoring}, misc2 = {EMPIR 2016: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-4486}, DOI = {10.3389/fenvc.2020.582001}, stag_bib_extends_levelofaccess = {NA}, author = {Barre, J.P.G. and Queipo-Abad, S. and Sola-Larra{\~n}aga, C. and Deletraz, G. and B{\'e}rail, S. and Tessier, E. and Elustondo Valencia, D. and Santamar{\'i}a, J.M. and de Diego, A. and Amouroux, D.} } @Article { AqeelSTMMBBGPB2020, subid = {2388}, title = {Microwave Spectroscopy of the Low-Temperature Skyrmion State in Cu2OSeO3}, journal = {Physical Review Letters}, year = {2020}, month = {11}, day = {17}, volume = {126}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {017202-1 - 017202-7}, keywords = {Lattice dynamics, Magnetic order, Magnetism, Magnetization dynamics, Skyrmions, Spin waves}, web_url = {https://arxiv.org/abs/2011.07826}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.126.017202}, stag_bib_extends_levelofaccess = {NA}, author = {Aqeel, A. and Sahliger, J. and Taniguchi, T. and M{\"a}ndl, S. and Mettus, D. and Berger, H. and Bauer, A. and Garst, M. and Pfleiderer, C. and Back, C.H.} } @Article { IstrateATRG2020, subid = {1755}, title = {Traceable measurements of harmonic (2 to 150) kHz emissions in smart grids: uncertainty calculation}, journal = {Journal of Sensors and Sensor Systems}, year = {2020}, month = {11}, day = {10}, volume = {9}, number = {2}, number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods}, pages = {375-381}, keywords = {Supraharmonics, Measurement, Uncertainty, Smart Grids}, web_url = {https://jsss.copernicus.org/articles/9/375/2020/}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-9-375-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Istrate, D. and Amaripadath, D. and Toutain, E. and Roche, R. and Gao, F.} } @Article { GuilloryTW2020_2, subid = {2003}, title = {Uncertainty assessment of a prototype of multilateration coordinate measurement system}, journal = {Precision Engineering}, year = {2020}, month = {11}, volume = {66}, number = {November}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, pages = {496-506}, keywords = {dimensional metrology, large volume metrology, absolute distance meters, coordinate measurement systems, multilateration technique with self calibration}, web_url = {https://www.sciencedirect.com/science/article/abs/pii/S0141635920305055?via\%3Dihub}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier}, language = {30}, ISSN = {0141-6359}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://hal-cnam.archives-ouvertes.fr/hal-03190544}, author = {Guillory, J. and Truong, D. and Wallerand, J-P.} } @Article { IllgenJTBF2020, subid = {1695}, title = {Influence of ion induced secondary electron emission on the stability of ionisation vacuum gauges}, journal = {Vacuum}, year = {2020}, month = {11}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {109907}, keywords = {Ion induced secondary electron emissionIonisation vacuum gaugesXPS}, web_url = {https://arxiv.org/abs/2011.08568}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109907}, stag_bib_extends_levelofaccess = {NA}, author = {Illgen, C. and Jousten, K. and Teodoro, O.M.N.D. and Bundaleski, N. and Figueiredo, I.} } @Article { BlakesleyKDHTMSA2020, subid = {1949}, title = {Effective Spectral Albedo from Satellite Data for Bifacial Gain Calculations of PV Systems}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {1292 - 1297}, keywords = {Albedo, Bificial PV Module}, web_url = {https://zenodo.org/record/4055920}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {3-936338-73-6}, author = {Blakesley, J.C. and Koutsourakis, G. and Douglas, S. and Holder, J.K.L. and Torry, J. and Mukadam, F. and Schmid, A. and Abrams, R.S.J.} } @Article { RomanoSMLPTMMBMAFGS2020, subid = {1839}, title = {Challenges in dosimetry of particle beams with ultra-high pulse dose rates}, journal = {Journal of Physics: Conference Series}, year = {2020}, month = {10}, volume = {1662}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {012028}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, electrons}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1662/1/012028}, stag_bib_extends_levelofaccess = {NA}, author = {Romano, F. and Subiel, A. and McManus, M. and Lee, N. D. and Palmans, H. and Thomas, R. and McCallum, S. and Milluzzo, G. and Borghesi, M. and McIlvenny, A. and Ahmed, H. and Farabolini, W. and Gilardi, A. and Sch{\"u}ller, A.} } @Article { BremerWFTSKRHSPMGR2020, subid = {1803}, title = {Quantum dot single-photon emission coupled into single-mode fibers with 3D printed micro-objectives}, journal = {APL Photonics}, year = {2020}, month = {10}, volume = {5}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {106101}, keywords = {Quantum dot single-photon emission}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {2378-0967}, DOI = {10.1063/5.0014921}, stag_bib_extends_levelofaccess = {NA}, author = {Bremer, L. and Weber, K. and Fischbach, S. and Thiele, S. and Schmidt, M. and Kaganskiy, A. and Rodt, S. and Herkommer, A. and Sartison, M. and Portalupi, S.L. and Michler, P. and Giessen, H. and Reitzenstein, S.} } @Article { PojtingerNKT2020, subid = {2376}, title = {Influence of beam quality on reference dosimetry correction factors in magnetic resonance guided radiation therapy}, journal = {Physics and Imaging in Radiation Oncology}, year = {2020}, month = {10}, volume = {16}, number2 = {19NRM01: MRgRT-DOS: Traceable dosimetry for small fields in MR-guided radiotherapy}, pages = {95-98}, keywords = {MR-linac, Dosimetry, Ionization chambers, Magnetic field correction factors, EGSnrc, Monte Carlo}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {2405-6316}, DOI = {10.1016/j.phro.2020.10.005}, stag_bib_extends_levelofaccess = {NA}, author = {Pojtinger, S. and Nachbar, M. and Kapsch, R-P. and Thorwarth, D.} } @Article { SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI2020, subid = {1664}, title = {Intercontinental comparison of optical atomic clocks through very long baseline interferometry}, journal = {Nature Physics}, year = {2020}, month = {10}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology}, web_url = {http://hdl.handle.net/11696/64130}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-020-01038-6}, stag_bib_extends_levelofaccess = {NA}, author = {Sekido, M. and Takefuji, K. and Ujihara, H. and Hachisu, H. and Nemitz, N. and Tsutsumi, M. and Kondo, T. and Kawai, E. and Ichikawa, R. and Namba, K. and Okamoto, Y. and Takahashi, R. and Komuro, J. and Clivati, C. and Bregolin, F. and Barbieri, P. and Mura, A. and Cantoni, E. and Cerretto, G. and Levi, F. and Maccaferri, G. and Roma, M. and Bortolotti, C. and Negusini, M. and Ricci, R. and Zacchiroli, G. and Roda, J. and Leute, J. and Petit, G. and Perini, F. and Calonico, D. and Pizzocaro, M. and Ido, T.} } @Article { LangeHSSLTP2020, subid = {1671}, title = {Coherent Suppression of Tensor Frequency Shifts through Magnetic Field Rotation}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {second-rank tensor frequency shifts, atomic clocks}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.125.143201}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.143201}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Peik, E.} } @Article { LangeHSSLTP20200, subid = {1671}, title = {Coherent Suppression of Tensor Frequency Shifts through Magnetic Field Rotation}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {second-rank tensor frequency shifts, atomic clocks}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.125.143201}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.143201}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Peik, E.} } @Article { WelshvBCHLLLvNTWWJ2020, subid = {1707}, title = {Towards defining reference materials for measuring extracellular vesicle refractive index, epitope abundance, size and concentration}, journal = {Journal of Extracellular Vesicles}, year = {2020}, month = {9}, day = {24}, volume = {9}, number = {1}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {1816641}, keywords = {Calibration; exosomes; extracellular vesicles; microvesicles; optical analysis; reference materials; standardization; quality control; validation}, misc2 = {EMPIR 2018: Health}, language = {30}, ISSN = {2001-3078}, DOI = {10.1080/20013078.2020.1816641}, stag_bib_extends_levelofaccess = {NA}, author = {Welsh, J.A. and van der Pol, E. and Bettin, B.A. and Carter, D.R.F. and Hendrix, A. and Lenassi, M. and Langlois, M-A. and Llorente, A. and van de Nes, A.S. and Nieuwland, R. and Tang, V. and Wang, L. and Witwer, K.W. and Jones, J.C. } } @Proceedings { tenHaveHML2020, subid = {2086}, title = {Unfairly Faulty Energy Meter Reading due to Inappropriate Use of the Blondel Theorem}, journal = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2020}, month = {9}, day = {23}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Blondel theorem, Distribution system, Energy measurement, Residual current device, Unbalance}, web_url = {https://research.utwente.nl/en/publications/unfairly-faulty-energy-meter-reading-due-to-inappropriate-use-of-}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Barcelona}, event_name = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {23-09-2020 to 25-09-2020}, language = {30}, DOI = {10.1109/EMCEUROPE48519.2020.9245714}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Hartman, T. and Moonen, N. and Leferink, F.} } @Proceedings { tenHaveAPSL2020, subid = {2085}, title = {On-Site Waveform Survey in LV Distribution Network using a Photovoltaic Installation}, journal = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2020}, month = {9}, day = {23}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Conducted electromagnetic interference, Distribution network, Non-linear, Photovoltaic installation, Static energy meter}, web_url = {https://research.utwente.nl/en/publications/on-site-waveform-survey-in-lv-distribution-network-using-a-photov}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Barcelona}, event_name = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {23-09-2020 to 25-09-2020}, language = {30}, DOI = {10.1109/EMCEUROPE48519.2020.9245831}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Azpurua, M.A. and Pous, M. and Silva, F. and Leferink, F.} } @Article { MomeniPakdehiSNZWNSPSTP2020, subid = {1696}, title = {Silicon Carbide Stacking‐Order‐Induced Doping Variation in Epitaxial Graphene}, journal = {Advanced Functional Materials}, year = {2020}, month = {9}, day = {11}, volume = {30}, number = {45}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {2004695}, keywords = {epitaxial graphenes, hexagonal silicon carbides, SiC spontaneous polarization, surface-dependent polarization doping}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/adfm.202004695}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Wiley}, language = {30}, ISSN = {1616-301X, 1616-3028}, DOI = {10.1002/adfm.202004695}, stag_bib_extends_levelofaccess = {NA}, author = {Momeni Pakdehi, D. and Sch{\"a}dlich, P. and Nguyen, T.T.N. and Zakharov, A.A. and Wundrack, S. and Najafidehaghani, E. and Speck, F. and Pierz, K. and Seyller, T. and Tegenkamp, C. and Pierz, K.} } @Proceedings { MubarakMTRS2020, subid = {1723}, title = {Automated Contacting of On-Wafer Devices for RF Testing}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {9}, day = {10}, volume = {N/A}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1-2}, keywords = {On-wafer probing, on-wafer contacting, microwave measurements, measurement techniques, measurement uncertainty, precision measurements, uncertainty}, web_url = {https://zenodo.org/record/4276095}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Denver (Aurora), CO, USA, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5899-0}, ISSN = {2160-0171}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1109/CPEM49742.2020.9191800}, author = {Mubarak, F. and Martino, C.D. and Toskovic, R. and Rietveld, G. and Spirito, M.} } @Article { GunkelDHLKRUBT2020, subid = {1684}, title = {Phonon‐Enhanced Near‐Field Spectroscopy to Extract the Local Electronic Properties of Buried 2D Electron Systems in Oxide Heterostructures}, journal = {Advanced Functional Materials}, year = {2020}, month = {9}, volume = {30}, number = {46}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {2004767}, keywords = {2D electron systems, electronic properties, LaAlO/SrTiO, near-field spectroscopy, oxide heterostructure}, misc2 = {EMPIR 2016: Energy}, publisher = {Wiley}, language = {30}, ISSN = {1616-301X, 1616-3028}, DOI = {10.1002/adfm.202004767}, stag_bib_extends_levelofaccess = {NA}, author = {Gunkel, F. and Dittmann, R. and Hoehl, A. and Lewin, M. and K{\"a}stner, B. and Rose, M‐A. and Ulrich, G. and Barnett, J. and Taubner, T.} } @Article { CrottivMTLSACMMA2020, subid = {2130}, title = {Measurement Methods and Procedures for Assessing Accuracy of Instrument Transformers for Power Quality Measurements}, journal = {Conference on Precision Electromagnetic Measurements CPEM 2020 Proceedings}, year = {2020}, month = {8}, day = {24}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, keywords = {Instrument transformers, calibration, measurement standards, measurement techniques, measurementuncertainty, precision measurements}, misc2 = {EMPIR 2019: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.5136547}, stag_bib_extends_levelofaccess = {NA}, author = {Crotti, G. and van den Brom, H.E. and Mohns, E. and Tinarelli, R. and Luiso, M. and Styblikova, R. and Agazar, M. and \c{C}aycı, H. and Mazza, P. and Meyer, J. and Almutairi, M. } } @Article { CainSTLWKBLF2020, subid = {1615}, title = {In Situ Electric-Field Study of Surface Effects in Domain Engineered Pb(In1/2Nb1/2)O3-Pb(Mg1/3Nb2/3)O3-PbTiO3 Relaxor Crystals by Grazing Incidence Diffraction}, journal = {Crystals}, year = {2020}, month = {8}, day = {20}, volume = {10}, number = {9}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {728}, keywords = {-}, web_url = {https://electrosciences.co.uk/2020/08/27/grazing_incidence/}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4352}, DOI = {10.3390/cryst10090728}, stag_bib_extends_levelofaccess = {NA}, author = {Cain, M.G. and Staruch, M. and Thompson, P. and Lucas, C. and Wermeille, D. and Kayser, Y. and Beckhoff, B. and Lofland, S.E. and Finkel, P.} } @Article { ClivatiABBDDMMMNLPRRSSSTC2020, subid = {1773}, title = {Common-clock very long baseline interferometry using a coherent optical fiber link}, journal = {Optica}, year = {2020}, month = {8}, day = {20}, volume = {7}, number = {8}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {1031}, keywords = {fiber links, coherent phase transfer, frequency dissemination with fibers, VLBI}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.393356}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Aiello, R. and Bianco, G. and Bortolotti, C. and De Natale, P. and Di Sarno, V. and Maddaloni, P. and Maccaferri, G. and Mura, A. and Negusini, M. and Levi, F. and Perini, F. and Ricci, R. and Roma, M. and Santamaria Amato, L. and Siciliani de Cumis, M. and Stagni, M. and Tuozzi, A. and Clivati, C.} } @Article { MullerSUT2020, subid = {1616}, title = {Determining nonuniformities of core‐shell nanoparticle coatings by analysis of the inelastic background of X‐ray photoelectron spectroscopy survey spectra}, journal = {Surface and Interface Analysis}, year = {2020}, month = {8}, day = {18}, volume = {1}, number = {1}, number2 = {17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses}, pages = {1-1}, keywords = {XPS, core-shell nanoparticles}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421, 1096-9918}, DOI = {10.1002/sia.6865}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, A. and Sparnacci, K. and Unger, W.E.S. and Tougaard, S.} } @Article { GomezCGSPHFPTMB2020, subid = {1698}, title = {Rapid three-dimensional multiparametric MRI with quantitative transient-state imaging}, journal = {Scientific Reports}, year = {2020}, month = {8}, day = {13}, volume = {10}, number = {1}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, keywords = {Magnetic Resonance Imaging (MRI)Quantitative MRIMagnetic Resonance Fingerprinting}, web_url = {https://www.nature.com/articles/s41598-020-70789-2}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-70789-2}, stag_bib_extends_levelofaccess = {NA}, author = {G{\'o}mez, P.A. and Cencini, M. and Golbabaee, M. and Schulte, R.F. and Pirkl, C. and Horvath, I. and Fallo, G. and Peretti, L. and Tosetti, M. and Menze, B.H. and Buonincontri, G.} } @Article { NiemeierT2020, subid = {1585}, title = {Stochastic Properties of Confidence Ellipsoids after Least Squares Adjustment, Derived from GUM Analysis and Monte Carlo Simulations}, journal = {Mathematics}, year = {2020}, month = {8}, volume = {8}, number = {8}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {1318}, keywords = {GUM analysis, geodetic network adjustment, stochastic properties, random number generator, Monte Carlo simulation}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-7390}, DOI = {10.3390/math8081318}, stag_bib_extends_levelofaccess = {NA}, author = {Niemeier, Wolfgang and Tengen, Dieter} } @Article { WeimerSMT2020, subid = {1687}, title = {Energy localization in an atomic chain with a topological soliton}, journal = {Physical Review Research}, year = {2020}, month = {8}, volume = {2}, number = {3}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {cold atoms, ion trapping, soliton, localization}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.2.033198}, stag_bib_extends_levelofaccess = {NA}, author = {Weimer, H. and Santos, L. and Mehlst{\"a}ubler, T. E. and Timm, L.} } @Article { RuutelYKSIDHHTBL2020, subid = {2185}, title = {Design, synthesis and application of carbazole macrocycles in anion sensors}, journal = {Beilstein Journal of Organic Chemistry}, year = {2020}, month = {8}, volume = {16}, number = {2020}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1901-1914}, keywords = {anion sensors; carboxylates;ionophores; acrocycles; sensor prototype}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Beilstein Institut}, language = {30}, ISSN = {1860-5397}, DOI = {10.3762/bjoc.16.157}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"u}{\"u}tel, A. and Yrj{\"a}n{\"a}, V. and Kadam, S.A. and Saar, I. and Ilisson, M. and Darnell, A. and Haav, K. and Haljasorg, T. and Toom, L. and Bobacka, J. and Leito, I.} } @Article { BiguriLBTDBMDHB2020, subid = {1885}, title = {Arbitrarily large iterative tomographic reconstruction on multiple GPUs using the TIGRE toolbox}, journal = {Journal of Parallel and Distributed Computing}, year = {2020}, month = {7}, day = {29}, volume = {146}, number = {2020}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {52-63}, keywords = {Computed Tomography, multi GPU computing, iterative reconstruction}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1905.03748}, author = {Biguri, A. and Lindroos, R. and Bryll, R. and Towsyfyan, H. and Deyhle, H. and Boardman, R. and Mavrogordato, M. and Dosanjh, M. and Hancock, S. and Blumensath, T.} } @Article { MayerBTOPAGMIMSK2020, subid = {1600}, title = {Flexible numerical simulation framework for dynamic PET-MR data}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {7}, day = {21}, volume = {65}, number = {14}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, pages = {145003}, keywords = {PET-MR,motion correction,simulation,image registration,open source}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab7eee}, stag_bib_extends_levelofaccess = {NA}, author = {Mayer, J. and Brown, R. and Thielemans, K. and Ovtchinnikov, E. and Pasca, E. and Atkinson, D. and Gillman, A. and Marsden, P. and Ippoliti, M. and Makowski, M. and Schaeffter, T. and Kolbitsch, C.} } @Proceedings { tenHaveML2020, subid = {2084}, title = {On-Site Efficiency Analysis of a Generator in the Millisecond Range}, journal = {2020 IEEE International Symposium on Electromagnetic Compatibility \& Signal/Power Integrity (EMCSI)}, year = {2020}, month = {7}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {209-212}, keywords = {Efficiency, Generator, Non-linear loads, Power Quality, Time-domain measurements}, web_url = {https://research.utwente.nl/en/publications/on-site-efficiency-analysis-of-a-generator-in-the-millisecond-ran}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Reno, NV, USA}, event_name = {2020 IEEE International Symposium on Electromagnetic Compatibility \& Signal/Power Integrity (EMCSI)}, event_date = {28-07-2020 to 28-08-2020}, language = {30}, DOI = {10.1109/EMCSI38923.2020.9191607}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Moonen, N. and Leferink, F.} } @Article { SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020, subid = {1522}, title = {Determination of consensus kQ values for megavoltage photon beams for the update of IAEA TRS-398}, journal = {Physics in Medicine and Biology}, year = {2020}, month = {6}, day = {22}, volume = {65}, number = {9}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {095011}, keywords = {TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Institute of Physics}, address = {London}, language = {30}, DOI = {10.5281/zenodo.3903294}, stag_bib_extends_levelofaccess = {NA}, author = {Seuntjens, J. and de Prez, L.A. and Pinto, M. and Pimpinella, M. and Oliver, C.P. and Ojala, J. and Muir, B. and Mirzakhanian, L. and Hanlon, M.D. and Francescon, P. and Delaunay, F. and Borbinha, J. and Ballester, F. and Andersen, C.E. and Vatnitsky, S. and McEwen, M. and Kapsch, R.P. and Burns, D.T. and Andreo, P. and Sommier, L. and Teles, P. and Tikkanen, J. and Vijande, J. and Zink, K.} } @Article { SixOMLLJHBBLHYTYM2020, subid = {1577}, title = {What can we learn from N2O isotope data? - Analytics, processes and modelling}, journal = {Rapid Communications in Mass Spectrometry}, year = {2020}, month = {6}, day = {16}, volume = {34}, number = {20}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {14/e8858}, keywords = {nitrous oxide, isotopic composition, isotope ratio mass spectrometry, laser spectroscopy}, web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa:22957}, misc2 = {EMPIR 2016: Environment}, publisher = {John Wiley \& Sons}, language = {30}, DOI = {10.1002/rcm.8858}, stag_bib_extends_levelofaccess = {NA}, author = {Yu, Longfei and Harris, Eliza and Lewicka‐Szczebak, Dominika and Barthel, Matti and Blomberg, Margareta and Harris, Stephen J. and Johnson, Matthew S. and Lehmann, Moritz F. and Liisberg, Jesper and M{\"u}ller, Christoph and Ostrom, Nathaniel E. and Six, Johan and Toyoda, Sakae and Yoshida, Naohiro and Mohn, Joachim} } @Article { SetinaTIBBJVW2020, subid = {1519}, title = {A review on hot cathode ionisation gauges with focus on a suitable design for measurement accuracy and stability}, journal = {Vacuum}, year = {2020}, month = {6}, day = {10}, volume = {179}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, keywords = {Ionisation gauge, Hot cathode, Sensitivity, Secondary electrons, Electron stimulated desorption}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier}, address = {Munich}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109545}, stag_bib_extends_levelofaccess = {NA}, author = {Jousten, K. and Boineau, F. and Bundaleski, N. and Illgen, C. and Šetina, J. and Teodoro, O.M.N.D. and Vicar, M. and W{\"u}est, M.} } @Article { BossewCCCDEGPT2020, subid = {1837}, title = {Development of a Geogenic Radon HazardIndex—Concept, History, Experiences}, journal = {International Journal of Environmental Research and Public Health}, year = {2020}, month = {6}, day = {10}, volume = {17}, number = {11}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {4134}, keywords = {geogenic radon hazard index, geogenic radon potential, European map of geogenic radon}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 1660-4601}, DOI = {10.3390/ijerph17114134}, stag_bib_extends_levelofaccess = {NA}, author = {Bossew, P. and Cinelli, G. and Ciotoli, G. and Crowley, Q.G. and De Cort, M. and El{\'i}o Medina, J. and Gruber, V. and Petermann, E. and Tollefsen, T.} } @Article { PradyumnaLRTZJADGG2020, subid = {1574}, title = {Twin beam quantum-enhanced correlated interferometry for testing fundamental physics}, journal = {Communications Physics}, year = {2020}, month = {6}, volume = {3}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {104}, keywords = {Optical physicsQuantum metrologyQuantum optics}, web_url = {https://www.nature.com/articles/s42005-020-0368-5\#Bib1}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Nature Research}, address = {233 Spring St. New York NY 10013 United States}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-020-0368-5}, stag_bib_extends_levelofaccess = {NA}, author = {Pradyumna, S. T. and Losero, E. and Ruo-Berchera, I. and Traina, P. and Zucco, M. and Jacobsen, C. S. and Andersen, U. L. and Degiovanni, I. P. and Genovese, M. and Gehring, T.} } @Proceedings { BircherMKT2020, subid = {1758}, title = {METAS-CT: Metrological X-ray computed tomography at sub-micrometre precision}, journal = {Proceedings 20th euspen International Conference and Exhibition}, year = {2020}, month = {6}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {Industrial X-ray computed tomography, dimensional metrology, high-resolution, microtechnology, micro-parts, additive manufacturing}, web_url = {https://www.euspen.eu/knowledge-base/ICE20131.pdf}, misc2 = {EMPIR 2017: Industry}, event_place = {Online Conference}, event_name = {20th euspen International Conference and Exhibition}, event_date = {08-06-2020 to 12-06-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE20131.pdf}, author = {Bircher, B. and Meli, F. and K{\"u}ng, A. and Thalmann, R.} } @Article { BatistaTB2020, subid = {1478}, title = {Traceability of pulsed flow rates consisting of constant delivered volumes at given time interval}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {6}, volume = {73}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {101729}, keywords = {Traceability, pulsed flow rate, volume}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101729}, stag_bib_extends_levelofaccess = {NA}, author = {Bissig, H. and Tschannen, M. and de Huu, M} } @Article { deHuuTBSBMMNPR2020, subid = {1819}, title = {Design of gravimetric primary standards for field-testing of hydrogen refuelling stations}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {6}, volume = {73}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {101747}, keywords = {Hydrogen calibration, Hydrogen dispenser, Gravimetric method}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101747}, stag_bib_extends_levelofaccess = {NA}, author = {de Huu, M. and Tschannen, M. and Bissig, H. and Stadelmann, P. and B{\"u}ker, O. and MacDonald, M. and Maury, R. and Neuvonen, P.T. and Petter, H.T. and RASMUSSEN, K.} } @Article { ColauttiLTPPTNCWT2020, subid = {1882}, title = {A 3D Polymeric Platform for Photonic Quantum Technologies}, journal = {Advanced Quantum Technologies}, year = {2020}, month = {6}, volume = {3}, number = {7}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {2000004}, keywords = {direct laser writingintegrated opticsquantum emitters single molecules single photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.202000004}, stag_bib_extends_levelofaccess = {NA}, author = {Colautti, M. and Lombardi, P. and Trapuzzano, M. and Piccioli, F.S. and Pazzagli, S. and Tiribilli, B. and Nocentini, S. and Cataliotti, F.S. and Wiersma, D.S. and Toninelli, C.} } @Article { LucasCTDABLYSMPF2020, subid = {1611}, title = {Dynamic piezoelectric response of relaxor single crystal under electrically driven inter-ferroelectric phase transformations}, journal = {Applied Physics Letters}, year = {2020}, month = {6}, volume = {116}, number = {22}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {222903}, keywords = {-}, web_url = {https://livrepository.liverpool.ac.uk/3091334/}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0007820}, stag_bib_extends_levelofaccess = {NA}, author = {Lucas, C.A. and Cain, M.G. and Thompson, P.B.J. and Damjanovic, D. and Antonelli, L. and Blackmon, F. and Lofland, S.E. and Young, S. and Staruch, M. and Matis, B.R. and Patterson, E.A. and Finkel, P.} } @Article { MaZWDWLLWGLT2020, subid = {1899}, title = {Uncertainty Analysis for RadCalNet Instrumented Test Sites Using the Baotou Sites BTCN and BSCN as Examples}, journal = {Remote Sensing}, year = {2020}, month = {5}, day = {26}, volume = {12}, number = {11}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {1696}, keywords = {RadCalNet, Cal/Val, calibration, uncertainty, metrology, Baotou, CEOS, interoperability, BTCN, BSCN}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs12111696}, stag_bib_extends_levelofaccess = {NA}, author = {Ma, Lingling and Zhao, Yongguang and Woolliams, Emma R. and Dai, Caihong and Wang, Ning and Liu, Yaokai and Li, Ling and Wang, Xinhong and Gao, Caixia and Li, Chuanrong and Tang, Lingli} } @Article { CiobanuOTOZLI2020, subid = {1771}, title = {MetroMC research group: Computational physics in ionizing radiation metrology}, journal = {Romanian Journal of Physics}, year = {2020}, month = {5}, day = {25}, volume = {65}, number = {3-4}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {808}, keywords = {“MetroMC”, Monte Carlo, ionizing radiation metrology}, misc2 = {EMPIR 2016: Environment}, publisher = {Editura Academiei Romane}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://www.nipne.ro/rjp/2020_65_3-4/RomJPhys.65.808.pdf}, author = {Ciobanu, S. and Ormenisan, G. and Tugulan, L.C. and Olaru, C. and Zadehrafi, M. and Luca, A. and Ioan, M.R.} } @Article { MorevaBTSTFPBPDOG2020, subid = {1710}, title = {Practical Applications of Quantum Sensing: A Simple Method to Enhance the Sensitivity of Nitrogen-Vacancy-Based Temperature Sensors}, journal = {Physical Review Applied}, year = {2020}, month = {5}, day = {22}, volume = {13}, number = {5}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {054057}, keywords = {color centers, diamond, quantum sensing}, web_url = {https://arxiv.org/abs/1912.10887}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.13.054057}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Bernardi, E. and Traina, P. and Sosso, A. and Tchernij, S.D. and Forneris, J. and Picollo, F. and Brida, G. and Pastuović, Ž. and Degiovanni, I. P. and Olivero, P. and Genovese, M.} } @Article { MorevaBTSTFPBPDOG20200, subid = {1710}, title = {Practical Applications of Quantum Sensing: A Simple Method to Enhance the Sensitivity of Nitrogen-Vacancy-Based Temperature Sensors}, journal = {Physical Review Applied}, year = {2020}, month = {5}, day = {22}, volume = {13}, number = {5}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {054057}, keywords = {color centers, diamond, quantum sensing}, web_url = {https://arxiv.org/abs/1912.10887}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.13.054057}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Bernardi, E. and Traina, P. and Sosso, A. and Tchernij, S.D. and Forneris, J. and Picollo, F. and Brida, G. and Pastuović, Ž. and Degiovanni, I. P. and Olivero, P. and Genovese, M.} } @Article { YamakawaBATBSNKYD2020, subid = {2039}, title = {Hg isotopic composition and total Hg mass fraction in NIES Certified Reference Material No. 28 Urban Aerosols}, journal = {Analytical and Bioanalytical Chemistry}, year = {2020}, month = {5}, day = {18}, volume = {412}, number = {19}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {4483-4493}, keywords = {Hg isotopic composition, Certified Reference Material, Urban Aerosols}, misc2 = {EMPIR 2016: Environment}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-020-02691-9}, stag_bib_extends_levelofaccess = {NA}, author = {Yamakawa, A. and B{\'e}rail, S. and Amouroux, D. and Tessier, E. and Barre, J. and Sano, T. and Nagano, K. and Kanwal, S. and Yoshinaga, J. and Donard, O.F.X.} } @Article { KongJTLTM2020, subid = {2746}, title = {Measurement-induced, spatially-extended entanglement in a hot, strongly-interacting atomic system}, journal = {Nature Communications}, year = {2020}, month = {5}, day = {15}, volume = {11}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Sensing beyond QSL, entanglement, hot atoms}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-020-15899-1 |}, stag_bib_extends_levelofaccess = {NA}, author = {Kong, J. and Jim{\'e}nez-Mart{\'i}nez, R. and Troullinou, C. and Lucivero, V.G. and T{\'o}th, G. and Mitchell, M.W.} } @Article { BilousBBSvTPLP2020, subid = {1541}, title = {Electronic Bridge Excitation in Highly Charged Th229 Ions}, journal = {Physical Review Letters}, year = {2020}, month = {5}, day = {12}, volume = {124}, number = {19}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {highly charged Ionshigh-intensity optical laserHighly Charged 229Th Ions}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.124.192502}, stag_bib_extends_levelofaccess = {NA}, author = {Bilous, P.V. and Bekker, H. and Berengut, J.C. and Seiferle, B. and von der Wense, L. and Thirolf, P.G. and Pfeifer, T. and L{\'o}pez-Urrutia, J.R.C. and P{\'a}lffy, A.} } @Article { CouplandPBDLTSL2020, subid = {1523}, title = {Lens aberration compensation in interference microscopy}, journal = {Optics and Lasers in Engineering}, year = {2020}, month = {5}, volume = {128}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {106015}, keywords = {Lens aberration interference microscopy}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, address = {Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands}, language = {30}, ISSN = {0143-8166}, DOI = {10.1016/j.optlaseng.2020.106015}, stag_bib_extends_levelofaccess = {NA}, author = {Su, R. and Thomas, M. and Liu, M. and Drs, J. and Bellouard, Y. and Pruss, C. and Coupland, J. and Leach, R.} } @Article { AlveseSousaTNGBFPFBO2020, subid = {1468}, title = {New EMPIR project – Metrology for Drug Delivery}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {4}, volume = {72}, number = {Special Is}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {101716}, keywords = {Microflow, drug delivery, calibration, health}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101716}, stag_bib_extends_levelofaccess = {NA}, author = {Batista, E. and Furtado, A. and Pereira, J. and Ferreira, M. and Bissig, H. and Graham, E. and Niemann, A. and Timmerman, A. and Sousa, J.A. and Ogheard, F.} } @Article { OjalaBTPZTSGP2020, subid = {1496}, title = {Calculated beam quality correction factors for ionization chambers in MV photon beams}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {3}, day = {26}, volume = {65}, number = {7}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {075003}, keywords = {kQ factors, radiotherapy dosimetry, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab7107}, stag_bib_extends_levelofaccess = {NA}, author = {Tikkanen, J. and Zink, K. and Pimpinella, M. and Teles, P. and Borbinha, J. and Ojala, J. and Siiskonen, T. and Gom{\`a}, C. and Pinto, M.} } @Article { LucasTECSZ2020, subid = {1449}, title = {Magnetic and multiferroic properties of dilute Fe-doped BaTiO3 crystals}, journal = {APL Materials}, year = {2020}, month = {3}, volume = {8}, number = {3}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {031109}, keywords = {multiferroic, X-ray absorption spectroscopy, magnetic measurements}, web_url = {https://aip.scitation.org/doi/10.1063/5.0002863}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, language = {30}, ISSN = {2166-532X}, DOI = {10.1063/5.0002863}, stag_bib_extends_levelofaccess = {NA}, author = {Staruch, M. and ElBidweihy, H. and Cain, M.G. and Thompson, P. and Lucas, C.A. and Finkel, P.} } @Proceedings { TeniouJPA2020, subid = {1617}, title = {A Fast and Rigorous Assessment of the Specific Absorption Rate (SAR) for MIMO Cellular Equipment Based on Vector Near-Field Measurements}, journal = {2020 14th European Conference on Antennas and Propagation (EuCAP)}, year = {2020}, month = {3}, number = {2020 14th}, number2 = {16NRM07: Vector SAR: SAR measurement using vector probes}, pages = {1-5}, keywords = {SAR, RF Exposure, MIMO, Planar near field measurement, Vector field measurements, Active- Antenna Measurement}, web_url = {https://hal.archives-ouvertes.fr/hal-02954816}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Copenhagen}, event_name = {2020 14th European Conference on Antennas and Propagation (EuCAP)}, event_date = {15-03-2020 to 20-03-2020}, language = {30}, DOI = {10.23919/EuCAP48036.2020.9135506}, stag_bib_extends_levelofaccess = {NA}, author = {Teniou, M. and Jawad, O. and Pannetrat, S. and Aberbour, L.} } @Article { TangSLKNBMSCKMKBNMKKSSDPvM2020, subid = {1473}, title = {Clinical quantitative cardiac imaging for the assessment of myocardial ischaemia}, journal = {Nature Reviews Cardiology}, year = {2020}, month = {2}, day = {24}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, keywords = {cardiac imaging, myocardial ischaemia}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1759-5002, 1759-5010}, DOI = {10.1038/s41569-020-0341-8}, stag_bib_extends_levelofaccess = {NA}, author = {Dewey, M. and Siebes, M. and Kachelrie{\ss}, M. and Kofoed, K.F. and Maurovich-Horvat, P. and Nikolaou, K. and Bai, W. and Kofler, A. and Manka, R. and Kozerke, S. and Chiribiri, A. and Schaeffter, T. and Michallek, F. and Bengel, F. and Nekolla, S. and Knaapen, P. and Lubberink, M. and Senior, R. and Tang, M-X. and Piek, J.J. and van de Hoef, T. and Martens, J. and Schreiber, L.} } @Article { TxoperenaRLFERAPCCCCHMZK2020, subid = {1505}, title = {Towards standardisation of contact and contactless electrical measurements of CVD graphene at the macro-, micro- and nano-scale}, journal = {Scientific Reports}, year = {2020}, month = {2}, day = {21}, volume = {10}, number = {1}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, pages = {3223}, keywords = {Characterization and analytical techniques,Electronic properties and devices,Imaging techniques,Materials science,Nanoscience and technology,Physics,Graphene}, web_url = {https://www.nature.com/articles/s41598-020-59851-1}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-59851-1}, stag_bib_extends_levelofaccess = {NA}, author = {Melios, C. and Huang, N. and Callegaro, L. and Centeno, A. and Cultrera, A. and Cordon, A. and Panchal, V. and Arnedo, I. and Redo-Sanchez, A. and Etayo, D. and Fernandez, M. and Lopez, A. and Rozhko, S. and Txoperena, O. and Zurutuza, A. and Kazakova, O.} } @Article { MingottiPT2020, subid = {2346}, title = {Calibration Procedure to Test the Effects of Multiple Influence Quantities on Low-Power Voltage Transformers}, journal = {Sensors}, year = {2020}, month = {2}, day = {20}, volume = {20}, number = {4}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1172}, keywords = {accuracy, voltage transformer, influence quantities, calibration procedure, temperature, electric field, frequency, ratio error, phase displacement}, web_url = {https://www.mdpi.com/1424-8220/20/4/1172}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20041172}, stag_bib_extends_levelofaccess = {NA}, author = {Mingotti, A. and Peretto, L. and Tinarelli, R.} } @Article { WallerandTG2020, subid = {1424}, title = {Assessment of the mechanical errors of a prototype of an optical multilateration system}, journal = {Review of Scientific Instruments}, year = {2020}, month = {2}, day = {18}, volume = {91}, number = {2}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, pages = {025004}, keywords = {-}, web_url = {https://aip.scitation.org/doi/figure/10.1063/1.5132933}, misc2 = {EMPIR 2017: Industry}, publisher = {AIP Publishing}, address = {1305 Walt Whitman Road Suite 300 Suite 300 Melville NY 11747 United States}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5132933}, stag_bib_extends_levelofaccess = {NA}, author = {Guillory, J. and Truong, D. and Wallerand, J.-P.} } @Article { WallerandTG2020_2, subid = {1423}, title = {Assessment of the mechanical errors of a prototype of an optical multilateration system}, journal = {Review of Scientific Instruments}, year = {2020}, month = {2}, volume = {91}, number = {2}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {025004}, keywords = {Optical multilateration system, large volume metrology, laser tracker, absolute distance meter,}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5132933}, stag_bib_extends_levelofaccess = {NA}, author = {Guillory, J. and Truong, D. and Wallerand, J.-P.} } @Proceedings { BircherMT2020, subid = {1757}, title = {X-ray source tracking to compensate focal spot drifts for dimensional CT measurements}, journal = {Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020}, year = {2020}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {110}, keywords = {industrial CT, X-ray tube, focal spot drift, CT geometry compensation, dimensional metrology}, web_url = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id110.pdf}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {10th Conference on Industrial Computed Tomography (iCT 2020)}, event_date = {04-02-2020 to 07-02-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id110.pdf}, author = {Bircher, B. and Meli, F. and Thalmann, R.} } @Article { CaraFFDTGSH2020, subid = {1568}, title = {Directed Self-Assembly of Polystyrene Nanospheres by Direct Laser-Writing Lithography}, journal = {Nanomaterials}, year = {2020}, month = {2}, volume = {10}, number = {2}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {280}, keywords = {directed self-assembly; nanospheres lithography; colloidal nanospheres; directlaser-writing}, web_url = {https://www.researchgate.net/publication/339105418_Directed_Self-Assembly_of_Polystyrene_Nanospheres_by_Direct_Laser-Writing_Lithography/link/5e3d9bbd458515072d88c1ab/download}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, address = {Postfach Basel CH-4005 Switzerland}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano10020280}, stag_bib_extends_levelofaccess = {NA}, author = {Cara, Eleonora and Ferrarese Lupi, Federico and Fretto, Matteo and De Leo, Natascia and Tortello, Mauro and Gonnelli, Renato and Sparnacci, Katia and Hensey, Garry} } @Article { HatanoMKTIGFTHGGB2020, subid = {1394}, title = {Spectroscopic investigations of negatively charged tin-vacancy centres in diamond}, journal = {New Journal of Physics}, year = {2020}, month = {1}, day = {23}, volume = {22}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {013048}, keywords = {colour centres, diamond, tin-vacancy centre, single photons,Fourier-limited Emission lines,electron–Phonon scattering}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab6631/pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab6631}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}rlitz, J. and Herrmann, D. and Thiering, G. and Fuchs, P. and Gandil, M. and Iwasaki, T. and Taniguchi, T. and Kieschnick, M. and Meijer, J. and Hatano, M. and Gali, A. and Becher, C.} } @Article { LeviBTCLL2020, subid = {1397}, title = {Sideband-Enhanced Cold Atomic Source for Optical Clocks}, journal = {Physical Review Applied}, year = {2020}, month = {1}, volume = {13}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {014013}, keywords = {Optical Lattice Clock,cold atomic sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.13.014013}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1909.05810}, author = {Barbiero, M. and Tarallo, M.G. and Calonico, D. and Levi, F. and Lamporesi, G. and Ferrari, G.} } @Article { ChristensenJHTS2020, subid = {1498}, title = {Lasing on a narrow transition in a cold thermal strontium ensemble}, journal = {Physical Review A}, year = {2020}, month = {1}, volume = {101}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {superradiant laser, optical clock, ultra narrow laser}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.101.013819}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"a}ffer, S.A. and Tang, M. and Henriksen, M.R. and J{\o}rgensen, A.A. and Christensen, B.T.R.} } @Article { GuilloryTW2020, subid = {2005}, title = {Uncertainty assessment of a prototype of multilateration coordinate measurement system}, journal = {Precision Engineering}, year = {2020}, volume = {66}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {496-506}, keywords = {dimensional metrology, Large Volume Metrology, Absolute Distance Metre, coordinate measurement system, multilateration technique with self-calibration}, web_url = {https://doi.org/10.1016/j.precisioneng.2020.08.002}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://hal-cnam.archives-ouvertes.fr/hal-03190544}, author = {Guillory, J. and Truong, D. and Wallerand, J-P.} } @Article { PetriniMBTTCDG2020, subid = {1713}, title = {Is a Quantum Biosensing Revolution Approaching? Perspectives in NV‐Assisted Current and Thermal Biosensing in Living Cells}, journal = {Advanced Quantum Technologies}, year = {2020}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {2000066}, keywords = {color centers, diamond, biosensing}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, DOI = {10.1002/qute.202000066}, stag_bib_extends_levelofaccess = {NA}, author = {Petrini, G. and Moreva, E. and Bernardi, E. and Traina, P. and Tomagra, G. and Carabelli, V. and Degiovanni, I.P. and Genovese, M.} } @Article { BernardiMTPDFPDOG2020, subid = {1712}, title = {A biocompatible technique for magnetic field sensing at (sub)cellular scale using Nitrogen-Vacancy centers}, journal = {EPJ Quantum Technology}, year = {2020}, volume = {7}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {13}, keywords = {NV centers, Quantum sensing, Magnetic measurements}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1140/epjqt/s40507-020-00088-2}, stag_bib_extends_levelofaccess = {NA}, author = {Bernardi, E. and Moreva, E. and Traina, P. and Petrini, G. and Ditalia Tchernij, S. and Forneris, J. and Pastuović, Ž. and Degiovanni, I.P. and Olivero, P. and Genovese, M.} } @Article { BernardiMTPDFPDOG20200, subid = {1712}, title = {A biocompatible technique for magnetic field sensing at (sub)cellular scale using Nitrogen-Vacancy centers}, journal = {EPJ Quantum Technology}, year = {2020}, volume = {7}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {13}, keywords = {NV centers, Quantum sensing, Magnetic measurements}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1140/epjqt/s40507-020-00088-2}, stag_bib_extends_levelofaccess = {NA}, author = {Bernardi, E. and Moreva, E. and Traina, P. and Petrini, G. and Ditalia Tchernij, S. and Forneris, J. and Pastuović, Ž. and Degiovanni, I.P. and Olivero, P. and Genovese, M.} } @Article { OchoaBTC2020, subid = {1870}, title = {Challenges and opportunities for an efficiency boost of next generation Cu(In,Ga)Se2 solar cells: prospects for a paradigm shift}, journal = {Energy \& Environmental Science}, year = {2020}, volume = {13}, number = {7}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {2047-2055}, keywords = {CIGS, metrology}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {1754-5692, 1754-5706}, DOI = {10.1039/D0EE00834F}, stag_bib_extends_levelofaccess = {NA}, author = {Ochoa, M. and Buecheler, S. and Tiwari, A.N. and Carron, R.} } @Article { HertwigNOYFGTC2020, subid = {2016}, title = {ALD-ZnMgO and absorber surface modifications to substitute CdS buffer layers in co-evaporated CIGSe solar cells}, journal = {EPJ Photovoltaics}, year = {2020}, volume = {11}, number = {12}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {12}, keywords = {Thin film solar cells Cu(In,Ga)Se2 bufferZnMgO ALDsurface treatment}, misc2 = {EMPIR 2016: Energy}, publisher = {EDP Sciences}, language = {30}, ISSN = {2105-0716}, DOI = {10.1051/epjpv/2020010}, stag_bib_extends_levelofaccess = {NA}, author = {Hertwig, R. and Nishiwaki, S. and Ochoa, M. and Yang, S-C. and Feurer, T. and Gilshtein, E. and Tiwari, A.N. and Carron, R.} } @Article { LinYCWGCLXSHCFCTYC2020, subid = {1760}, title = {Perpendicular Magnetic Anisotropy and Dzyaloshinskii-Moriya Interaction at an Oxide/Ferromagnetic Metal Interface}, journal = {Physical Review Letters}, year = {2020}, volume = {124}, number = {21}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {217202}, keywords = {DMI, spin waves}, web_url = {https://arxiv.org/abs/2006.14268}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.124.217202}, stag_bib_extends_levelofaccess = {NA}, author = {Lin , W. and Yang, B. and Chen, A.P. and Wu, X. and Guo, R. and Chen, S. and Liu, L. and Xie, Q. and Shu, X. and Hui, Y. and Chow, G.M. and Feng, Y. and Carlotti, G. and Tacchi, S. and Yang, H. and Chen, J.} } @Proceedings { Tarallo2020, subid = {1482}, title = {Toward a quantum-enhanced strontium optical lattice clock at INRIM}, journal = {EPJ Web of Conferences}, year = {2020}, volume = {230}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {00011}, keywords = {optical clock, entanglement}, misc2 = {EMPIR 2017: Fundamental}, publisher = {EDP Sciences}, event_place = {Catania}, event_name = {fismat 2019}, event_date = {30-09-2019 to 04-10-2019}, language = {30}, ISSN = {2100-014X}, DOI = {10.1051/epjconf/202023000011}, stag_bib_extends_levelofaccess = {NA}, author = {Tarallo, M.G.} } @Article { HorenzTBNAGV2020, subid = {1716}, title = {A Study on the Analysis of Particle Size Distribution for Bimodal Model Nanoparticles by Electron Microscopy}, journal = {Microscopy and Microanalysis}, year = {2020}, volume = {26}, number = {S2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {2282}, keywords = {nanoparticles, size traceability, bi-modal distribution, silica, gold, electron microscoopy}, web_url = {https://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/study-on-the-analysis-of-particle-size-distribution-for-bimodal-model-nanoparticles-by-electron-microscopy/B9157A370AC198219A734770694340F3}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, address = {Cambridge}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927620021054}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}renz, C. and Tache, O. and Bartczak, D. and Nunez, S. and Abad Alvaro, I. and Goenaga-Infante, H. and Vasile-Dan Hodoroaba, V-D.} } @Article { TummonLKCCCAZSV2020, subid = {1472}, title = {Real-time pollen monitoring using digital holography}, journal = {Atmospheric Measurement Techniques}, year = {2020}, volume = {13}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {1539–1550}, keywords = {pollen monitoring, digital holography,}, web_url = {https://www.atmos-meas-tech.net/13/1539/2020/}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus Publications}, language = {30}, DOI = {10.5194/amt-13-1539-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Sauvageat , E. and Zeder, Y. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Konzelmann, T. and Lieberherr, G. and Tummon, F. and Vasilatou, K.} } @Article { HodoroabaCTMOMPM2020, subid = {1717}, title = {Towards 3D Understanding of Non-spherical Nanoparticles by Transmission Kikuchi Diffraction (TKD) for Improved Particle Size Distribution by Electron Microscopy}, journal = {Microscopy and Microanalysis}, year = {2020}, volume = {26}, number = {S2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {260}, keywords = {nanoparticles, 3D, Transmission Kikuchi Diffraction (TKD), TiO2, electron microscopy, size, shape}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, address = {Cambridge}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927620013999}, stag_bib_extends_levelofaccess = {NA}, author = {Hodoroaba, V.-D. and Cios, G. and Tokarski, T. and Mansfeld, U. and Ortel, E. and Mielke, J. and Pellegrino, F. and Maurino, V.} } @Article { NeyezhmakovPPTS2020, subid = {1860}, title = {Comparative analysis of quadrature formulas for the mean integral refractive index of air in high-precision ranging}, journal = {Modern achievements of geodesic science and industry}, year = {2020}, volume = {1(39)}, number = {2020}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {69-73}, keywords = {gradient method, mean integral indicator of atmospheric depressions, Earth's atmosphere}, web_url = {http://zgt.com.ua/wp-content/uploads/2021/01/\%D0\%A1\%D1\%82\%D0\%B0\%D1\%82\%D1\%82\%D1\%8F-\%D0\%9F\%D0\%9E\%D0\%A0\%D0\%86\%D0\%92\%D0\%9D\%D0\%AF\%D0\%9B\%D0\%AC\%D0\%9D\%D0\%98\%D0\%99-\%D0\%90\%D0\%9D\%D0\%90\%D0\%9B\%D0\%86\%D0\%97-\%D0\%9A\%D0\%92\%D0\%90\%D0\%94\%D0\%A0\%D0\%90\%D0\%A2\%D0\%A3\%D0\%A0\%D0\%9D\%D0}, misc2 = {EMPIR 2018: SI Broader Scope}, language = {130}, DOI = {10.33841/1819-1339-1-39-13}, stag_bib_extends_levelofaccess = {NA}, author = {Neyezhmakov, P. and Prokopov, O. and Panasenko, T. and Trevoho, I. and Shloma, A.} } @Article { TassoneMMPSN2020, subid = {2040}, title = {Modification of the EPA method 1631E for the quantification of total mercury in natural waters}, journal = {MethodsX}, year = {2020}, volume = {7}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {100987}, keywords = {EPA method 1631E, total mercury, waters}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {2215-0161}, DOI = {10.1016/j.mex.2020.100987}, stag_bib_extends_levelofaccess = {NA}, author = {Tassone, A. and Moretti, S. and Martino, M. and Pirrone, N. and Sprovieri, F. and Naccarato, A.} } @Article { JeneiPZTRTCSMD2019, subid = {1545}, title = {Waiting time distributions in a two-level fluctuator coupled to a superconducting charge detector}, journal = {Physical Review Research}, year = {2019}, month = {12}, day = {10}, volume = {1}, number = {3}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Waiting time distributions in a two-level fluctuator coupled to a superconducting charge detector}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/physrevresearch.1.033163}, stag_bib_extends_levelofaccess = {NA}, author = {Jenei, M. and Potanina, E. and Zhao, R. and Tan, K.Y. and Rossi, A. and Tanttu, T. and Chan, K.W. and Sevriuk, V. and M{\"o}tt{\"o}nen, M. and Dzurak, A.} } @Article { SliwczynskiKT2019, subid = {1471}, title = {Stability limitations of optical frequency transfer in telecommunication DWDM networks}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2019}, month = {12}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {1-1}, keywords = {optical frequency transfer, DWDM network, optical fiber, alien wavelength}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010, 1525-8955}, DOI = {10.1109/TUFFC.2019.2957176}, stag_bib_extends_levelofaccess = {NA}, author = {Śliwczyński, L. and Krehlik, P. and Turza, K.} } @Article { PanuJTS2019, subid = {1309}, title = {Dynamic calibration method for reactive gases}, journal = {Measurement Science and Technology}, year = {2019}, month = {12}, volume = {31}, number = {3}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {034001}, keywords = {evaporation, traceability, reference gas, gas generator, gas flow, reactivecompounds, mercury}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab4d68}, stag_bib_extends_levelofaccess = {NA}, author = {Sari, S. and Timo, R. and Jussi, H. and Panu, H.} } @Article { TrusheimFGBA2019, subid = {1315}, title = {Quantum nanophotonics with group IV defects in diamond}, journal = {Nature Communications}, year = {2019}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {5625}, keywords = {diamond, photonics, quantum optics, color centers, quantum technologies}, web_url = {https://www.nature.com/articles/s41467-019-13332-w}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-13332-w}, stag_bib_extends_levelofaccess = {NA}, author = {Bradac, C. and Gao, W. and Forneris, J. and Trusheim, M. E. and Aharonovich, I.} } @Article { GeislerNBHSRKWHTHMSU2019, subid = {1316}, title = {Determining the Thickness and Completeness of the Shell of Polymer Core–Shell Nanoparticles by X-ray Photoelectron Spectroscopy, Secondary Ion Mass Spectrometry, and Transmission Scanning Electron Microscopy}, journal = {The Journal of Physical Chemistry C}, year = {2019}, month = {11}, day = {26}, number2 = {17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses}, keywords = {Nanoparticles, core-shell, XPS, SIMS, T-SEM, polymer}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.9b09258}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, A. and Heinrich, T. and Tougaard, S. and Werner, W. S. M. and Hronek, M. and Kunz, V. and Radnik, J. and Stockmann, J. M. and Hodoroaba, V-D. and Benemann, S. and Nirmalananthan-Budau, N. and Gei{\ss}ler, D. and Sparnacci, K. and Unger, W. E. S } } @Article { BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019, subid = {2340}, title = {The Metrological Traceability, Performance and Precision of European Radon Calibration Facilities}, journal = {International Journal of Environmental Research and Public Health}, year = {2019}, month = {11}, day = {21}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, keywords = {radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.3390/ijerph182212150}, stag_bib_extends_levelofaccess = {NA}, author = {Beck, T.R. and Antohe, A. and Cardellini, F. and Cucoş, A. and Fialova, E. and Grossi, C. and Hening, K. and Jensen, J. and Kastratović, D. and Krivoš{\'i}k, M. and Lobner, P. and Luca, A. and Maringer, F.J. and Michielsen, N. and Otahal, P.P.S. and Quindos, L. and Rabago, D. and Sainz, C. and Sz{\"u}cs, L. and Teodorescu, T. and Tolinsson, C. and Tugulan, C.L. and Turtiainen, T. and Vargas, A. and Vosahlik, J. and Vukoslavovic, G. and Wiedner, H. and Wołoszczuk, K.} } @Article { SchneiderHHCFKRSTR2019, subid = {1362}, title = {Resolving the temporal evolution of line broadening in single quantum emitters}, journal = {Optics Express}, year = {2019}, month = {11}, day = {18}, volume = {27}, number = {24}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {35290}, keywords = {single quantum emitter, GaAs and In(Ga)As quantum dots}, web_url = {https://www.osapublishing.org/DirectPDFAccess/0872F4C8-F64C-1DD3-BF83A9359A9A78C7_423274/oe-27-24-35290.pdf?da=1\&id=423274\&seq=0\&mobile=no}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.035290}, stag_bib_extends_levelofaccess = {NA}, author = {Schimpf, C. and Reindl, M. and Klenovsk{\'y}, P. and Fromherz, T. and Covre Da Silva, S.F. and Hofer, J. and Schneider, C. and H{\"o}fling, S. and Trotta, R. and Rastelli, A.} } @Article { MingottiPT2019, subid = {1751}, title = {Effects of Multiple Influence Quantities on Rogowski-Coil-Type Current Transformers}, journal = {Transaction on Instrumentation and Measurement}, year = {2019}, month = {11}, day = {15}, volume = {69}, number = {7}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {8}, keywords = {automatic measurement system, multiple influence, passive current transformer, position, Rogowski coil, temperature, Standard tests}, web_url = {https://zenodo.org/record/4322652\#.X9jKvy1aY1I}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, language = {30}, ISSN = {1557-9662}, DOI = {10.5281/zenodo.4322652}, stag_bib_extends_levelofaccess = {NA}, author = {Mingotti, A. and Peretto, L. and Tinarelli, R.} } @Article { BinghamWSTMFZSRKH2019, subid = {1353}, title = {Formation of N{\'e}el-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy}, journal = {Physical Review B}, year = {2019}, month = {10}, day = {25}, volume = {100}, number = {14}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {144435}, keywords = {Skyrmions, DMI, spin waves}, web_url = {https://arxiv.org/abs/1910.04515}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.144435}, stag_bib_extends_levelofaccess = {NA}, author = {Saha, S. and Zelent, M. and Finizio, S. and Mruczkiewicz, M. and Tacchi, S. and Suszka, A. K. and Wintz, S. and Bingham, N. S. and Raabe, J. and Krawczyk, M. and Heyderman, L. J.} } @Article { KuckLDMCTLT2019_2, subid = {1444}, title = {A Molecule‐Based Single‐Photon Source Applied in Quantum Radiometry}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {10}, day = {22}, volume = {3}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1900083}, keywords = {quantum radiometrysingle moleculessingle‐photon detectorssingle‐photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900083}, stag_bib_extends_levelofaccess = {NA}, author = {Lombardi, P. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and L{\'o}pez, M. and K{\"u}ck, S. and Toninelli, C.} } @Article { LombardiTCMDLKT2019, subid = {1807}, title = {A Molecule‐Based Single‐Photon Source Applied in Quantum Radiometry}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {10}, day = {22}, volume = {3}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1900083}, keywords = {quantum radiometry single molecules single‐photon detectors single‐photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900083}, stag_bib_extends_levelofaccess = {NA}, author = {Lombardi, P. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and L{\'o}pez, M. and K{\"u}ck, S. and Toninelli, C.} } @Article { MarcqMHGFCBBTBMWW2019, subid = {1248}, title = {RadCalNet: A Radiometric Calibration Network for Earth Observing Imagers Operating in the Visible to Shortwave Infrared Spectral Range}, journal = {Remote Sensing}, year = {2019}, month = {10}, day = {16}, volume = {11}, number = {2401}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {20}, keywords = {RadCalNet, CEOS, radiometric calibration, SI-traceable, surface reflectance, network, instrument}, web_url = {https://doi.org/10.3390/rs11202401\&\#160;}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs11202401}, stag_bib_extends_levelofaccess = {NA}, author = {Bouvet, M. and Thome, K. and Berthelot, B. and Bialek, A. and Czapla-Myers, J. and Fox, N. and Goryl, P. and Henry, P. and Ma, L. and Marcq, S. and Meygret, A. and Wenny, B. and Woolliams, E.} } @Article { ToivonenK2019, subid = {1296}, title = {Dynamic Enhancement of Nitric Oxide Radioluminescence with Nitrogen Purge}, journal = {Scientific Reports}, year = {2019}, month = {9}, day = {25}, volume = {9}, number = {1}, number2 = {16ENV09: MetroDECOM II: In situ metrology for decommissioning nuclear facilities}, pages = {13884}, keywords = {Radioluminescence, nitric oxide, nitrogen purge}, web_url = {https://www.nature.com/articles/s41598-019-50396-6}, misc2 = {EMPIR 2016: Environment}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-50396-6}, stag_bib_extends_levelofaccess = {NA}, author = {Kerst, T. and Toivonen, J.} } @Proceedings { BagciHYTAGD2019, subid = {1325}, title = {Improvement of dynamic pressure standard for calibration of dynamic pressure transducers}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number = {2019}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, keywords = {dynamic pressure, measurement, calibration, drop mass, dynamic calibration machine}, misc2 = {EMPIR 2017: Industry}, publisher = {EDP Sciences}, address = {17 av. du Hoggar PA de Courtaboeuf BP 112 PA de Courtaboeuf BP 112 Les Ulis cedex A 91944 France}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201927009}, stag_bib_extends_levelofaccess = {NA}, author = {Durgut, Y. and Ganioglu, O. and Aydemir, B. and Turk, A. and Yilmaz, R. and Hamarat, A. and Bağcı, E.} } @Proceedings { CucciaSBLvAMCVSBPCT2019, subid = {1781}, title = {Development of standardized methods for the analysis of amines, terpenes and ammonia in biomethane}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, keywords = {biomethane, terpenes, amines, ammonia}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201906001}, stag_bib_extends_levelofaccess = {NA}, author = {Cuccia, L. and Sanz, B. and Ballestas Castro, D. and Li, J. and van der Veen, A.M.H. and Amico di Meane, E. and Moreno, S. and Culleton, L.P. and Vorin, D. and Senn{\'e}, C. and Bougueroua, F. and Pyr{\'e}e, L. and Courtois, Y. and Tastard, C.} } @Proceedings { BermbachSHTL2019, subid = {1294}, title = {Guards and Watchdogs in One-Way Synchronization with Delay-Related Authentication Mechanisms}, journal = {2019 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, year = {2019}, month = {9}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-6}, keywords = {Synchronization, Protocols, Servers, Cryptography, Clocks, Global navigation satellite system}, web_url = {https://doi.org/10.1109/ISPCS.2019.8886633}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Portland (Oregon) United States}, event_name = {International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication}, event_date = {22-09-2019 to 27-09-2019}, language = {30}, ISBN = {978-1-5386-7607-3, 978-1-5386-}, ISSN = {1949-0313, 1949-0305}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.17IND06.CA.20191126}, author = {Bermbach, R. and Sibold, D. and Heine, K. and Teichel, K. and Langer, M.} } @Proceedings { MarrowsKGDCCBSK2019, subid = {1428}, title = {Measuring Interfacial Dzyaloshinskii-Moriya Interaction: A Review}, journal = {Proceedings}, year = {2019}, month = {9}, volume = {26}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {41}, keywords = {Dzyaloshinskii-Moriya interaction}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, event_place = {Ferrara}, event_name = {XXXVII International Symposium on Dynamical Properties of Solids}, event_date = {08-09-2019 to 12-09-2019}, language = {30}, ISSN = {2504-3900}, DOI = {10.3390/proceedings2019026041}, stag_bib_extends_levelofaccess = {NA}, author = {Back, C. and Carlotti, G. and Casiraghi, A. and Durin, G. and Garcia-Sanchez, F. and Kuepferling, M. and Marrows, C. and Soares, G. and Tacchi, S.} } @Article { TacheTMPMMH2019, subid = {1409}, title = {Towards Accurate Analysis of Particle Size Distribution for Non-Spherically Shaped Nanoparticles as Quality Control Materials}, journal = {Microscopy and Microanalysis}, year = {2019}, month = {8}, day = {31}, volume = {25}, number = {Suppl. 2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {2328-2329}, keywords = {Imaging;Nanoparticles;Non-spherical;Particle size distribution;Reference material}, web_url = {https://www.cambridge.org/core/services/aop-cambridge-core/content/view/CD48E9298865410124E22837D8CF73A0/S1431927619012376a.pdf/towards_accurate_analysis_of_particle_size_distribution_for_nonspherically_shaped_nanoparticles_as_quality_control_materials.pd}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927619012376}, stag_bib_extends_levelofaccess = {NA}, author = {Mansfeld, U. and Pellegrino, F. and Maurino, V. and Marguet, S. and Testard, F. and Tache, O. and Hodoroaba, V.-D.} } @Proceedings { LehtonenHTSHM2019, subid = {1303}, title = {Measuring Losses of an Air-Core Shunt Reactor with an Advanced Loss Measuring System}, journal = {Proceedings of ISH 2019}, year = {2019}, month = {8}, day = {26}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {Reactor, loss measurement, voltage divider, loss measuring system}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3521194}, stag_bib_extends_levelofaccess = {NA}, author = {Havunen, J. and Suomalainen, E-P. and Tornberg, J. and H{\"a}llstr{\"o}m, J. and Lehtonen, T. and Mervi{\"o}, A.} } @Proceedings { VentreMDBCFPPRSTBASSGHBZFDKL2019, subid = {1200}, title = {Metrology for Inductive Charging of Electric Vehicles (MICEV)}, journal = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, year = {2019}, month = {8}, day = {19}, volume = {Electrical}, number = {2019 AEIT}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {6 pages}, keywords = {Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety}, web_url = {http://arxiv.org/abs/1908.11108}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Turin (Italy)}, event_name = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, event_date = {02-07-2019 to 04-07-2019}, language = {30}, ISBN = {978-8-8872-3743-6}, ISSN = {0018-9219}, DOI = {10.23919/EETA.2019.8804498}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Bottauscio, O. and Harmon, S. and Guilizzoni, R. and Schilling, F. and Schmidt, M. and Ankarson, P. and Bergsten, T. and Tammi, K. and Sainio, P. and Romero, J.B. and Puyal, E.L. and Pichon, L. and Freschi, F. and Cirimele, V. and Bauer, P. and Dong, J. and Maffucci, A. and Ventre, S. and Femia, N. and Di Capua, G. and Kuster, N. and Liorni, I.} } @Article { OrtolanoARCETCZSCC2019, subid = {1227}, title = {Mapping the conductivity of graphene with Electrical Resistance Tomography}, journal = {Scientific Reports}, year = {2019}, month = {7}, day = {23}, volume = {9}, number = {1}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, keywords = {graphene, electrical resistance tomography, conductivity, terahertz spectroscopy}, web_url = {https://doi.org/10.1038/s41598-019-46713-8}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-46713-8}, stag_bib_extends_levelofaccess = {NA}, author = {Cultrera, A. and Serazio, D. and Zurutuza, A. and Centeno, A. and Txoperena, O. and Etayo, D. and Cordon, A. and Redo-Sanchez, A. and Arnedo, I. and Ortolano, M. and Callegaro, L.} } @Article { SOCHOROVARLLKFDCCBBT2019, subid = {1285}, title = {Activity measurements and determination of nuclear decay data of 166Ho in the MRTDosimetry project}, journal = {Applied Radiation and Isotopes}, year = {2019}, month = {7}, day = {20}, volume = {153}, number = {November 2}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {1-11}, keywords = {Ho166, Activity standardization, gamma-spectrometry, Half-life measurements, Molecular radiotherapy, MRTDosimetry}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2019.108826}, stag_bib_extends_levelofaccess = {NA}, author = {Bobin, C. and BOUCHARD, J. and CHISTE, V. and COLLINS, S. and Dry{\'a}k, P. and FENWICK, A. and Keightley, J. and L{\'e}py, M.C. and Lourenco, V. and Robinson, A. and Sochorov{\'a}, J. and THIAM, C.} } @Thesis { Tampellini2019, subid = {1228}, title = {Coherent fibre-optic link: applications in Time and Frequency Metrology, Geodesy, Radioastronomy and Seismology}, year = {2019}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {Time and Frequency metrology; frequency dissemination; optical fibres}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Politecnico di Torino}, address = {Torino}, school = {Politecnico di Torino}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://iris.polito.it/retrieve/handle/11583/2742522/258655/Thesis_Tampellini.pdf}, author = {Tampellini, A.} } @Article { Turrion2019, subid = {1221}, title = {Theoretical evaluation of the impact of finite intervals in the measurement of the bidirectional reflectance distribution function}, journal = {Journal of Coatings Technology and Research}, year = {2019}, month = {7}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {1-10}, keywords = {Reflection BSDF, BRDF, and BTDF Scattering measurements Metrology}, web_url = {https://link.springer.com/article/10.1007/s11998-019-00241-2}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1547-0091, 1935-3804}, DOI = {10.1007/s11998-019-00241-2}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A} } @Article { KeyerMHtL2019, subid = {1319}, title = {Faulty Readings of Static Energy Meters Caused by Conducted Electromagnetic Interference from a Water Pump}, journal = {Renewable Energy and Power Quality Journal}, year = {2019}, month = {7}, volume = {17}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {15-19}, keywords = {Static Meter, Smart Meter, Electronic Meter, Conducted Interference, Electromagnetic Compatibility}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {AEDERMACP (European Association for the Development of Renewable Energies and Power Quality)}, language = {30}, ISSN = {2172-038X}, DOI = {10.24084/repqj17.205}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Hartman, T. and Moonen, N. and Keyer, C. and Leferink, F.} } @Article { MurugandBvAtH2019, subid = {1816}, title = {Measurement challenges for hydrogen vehicles}, journal = {International Journal of Hydrogen Energy}, year = {2019}, month = {7}, volume = {44}, number = {35}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {19326-19333}, keywords = {Hydrogen; Fuel cell; Vehicles; ISO 14687; Metrology; Measurement; Flow metering; Quality control}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2019.03.190}, stag_bib_extends_levelofaccess = {NA}, author = {Murugan, A. and de Huu, M. and Bacquart, T. and van Wijk, J. and Arrhenius, K. and te Ronde, I. and Hemfrey, D.} } @Article { GandonLegerTCMC2019, subid = {1278}, title = {Towards An Optimization Of Urban Lighting Through A Combined Approach Of Lighting And Road Building Activities}, journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE}, year = {2019}, month = {6}, day = {24}, number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting}, keywords = {Road photometry, Road lighting design, Gonioreflectometer,16NRM02}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {International Commission on Illumination, CIE}, language = {30}, DOI = {10.25039/x46.2019.PP23}, stag_bib_extends_levelofaccess = {NA}, author = {Muzet, V. and Colomb, M. and Toinette, M. and Gandon-Leger, P. and Christory, J.P.} } @Article { PoikonenLGKKTDFPKI2019, subid = {1201}, title = {Validation of the fisheye camera method for spatial non-uniformity corrections in luminous flux measurements with integrating spheres}, journal = {Metrologia}, year = {2019}, month = {6}, day = {18}, volume = {56}, number = {4}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {045002}, keywords = {fisheye camera method, integrating sphere, luminous flux, spatial correction, angular intensity distribution, photometry, measurement uncertainty}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {-}, DOI = {10.1088/1681-7575/ab17fe}, stag_bib_extends_levelofaccess = {NA}, author = {Kokka, A. and Pulli, T. and Ferrero, A. and Dekker, P. and Thorseth, A. and Kliment, P. and Klej, A. and Gerloff, T. and Ludwig, K. and Poikonen, T. and Ikonen, E.} } @Article { HannNFSTK2019, subid = {1196}, title = {FI-ICP-TOFMS for quantification of biologically essential trace elements in cerebrospinal fluid – high-throughput at low sample volume}, journal = {The Analyst}, year = {2019}, month = {6}, day = {11}, volume = {144}, number = {15}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {4653-4660}, keywords = {cerebrospinal fluid, FI-ICP-TOFMS, quantification of biologically essential trace elements}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2019/AN/C9AN00039A\#!divAbstract}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0003-2654, 1364-5528}, DOI = {10.1039/C9AN00039A}, stag_bib_extends_levelofaccess = {NA}, author = {Theiner, S. and Schoeberl, A. and Fischer, L. and Neumayer, S. and Hann, S. and Koellensperger, G.} } @Article { ThorwarthDKP2019, subid = {1141}, title = {A finite element method for the determination of the relative response of ionization chambers in MR-linacs: simulation and experimental validation up to 1.5 T}, journal = {Physics in Medicine and Biology}, year = {2019}, month = {6}, day = {10}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, keywords = {MRgRT, reference dosimetry, magnetic field}, web_url = {https://doi.org/10.1088/1361-6560/ab2837}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ab2837}, stag_bib_extends_levelofaccess = {NA}, author = {Pojtinger, S. and Kapsch, R.P. and Dohm, O.S. and Thorwarth, D.} } @Article { PottieLATMQFCX2019, subid = {1117}, title = {Two-Branch Fiber Link for International Clock Networks}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {2195-2200}, keywords = {Optical fiber links, phase lock loop, phase measurement, two-way noise compensation, ultrastable frequencytransfer}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2886865}, stag_bib_extends_levelofaccess = {NA}, author = {Xu, D. and Cantin, E. and Frank, F. and Quintin, N. and Meynadier, F. and Tuckey, P. and Amy-Klein, A. and Lopez, O. and Pottie, P.E.} } @Article { TeodoroFBS2019, subid = {1265}, title = {3D-Simulation of a Bayard Alpert ionisation gauge using SIMION program}, journal = {Vacuum}, year = {2019}, month = {6}, volume = {164}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {300-307}, keywords = {Vacuum measurementIonisation gaugeSimulationGauge sensitivity}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2019.03.039}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, R. and Bundaleski, N. and Fonseca, A.L. and Teodoro, O.} } @Article { KorpelainenBDS2019, subid = {1297}, title = {Tip wear and tip breakage in high-speed atomic force microscopes}, journal = {Ultramicroscopy}, year = {2019}, month = {6}, volume = {201}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {28-37}, keywords = {Atomic force microscopy (AFM), High-speed AFM, Tip wear, Tip breakage, Tip characterization, Tip-sample interaction}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2019.03.013}, stag_bib_extends_levelofaccess = {NA}, author = {Strahlendorff, T. and Dai, G. and Bergmann, D. and Tutsch, R.} } @Article { ZhangTPM2019, subid = {2311}, title = {Use of COMTRADE Fault Current Data to Test Inductive Current Transformers}, journal = {2019 II Workshop on Metrology for Industry 4.0 and IoT (MetroInd4.0 \& IoT)}, year = {2019}, month = {6}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, keywords = {current transformers, fault current, distorted signals}, web_url = {https://zenodo.org/record/3603834}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/METROI4.2019.8792871}, stag_bib_extends_levelofaccess = {NA}, author = {Zhang, J. and Tinarelli, R. and Peretto, L. and Mingotti, A.} } @Article { UrsinTSFC2019, subid = {1349}, title = {Hong-Ou-Mandel interferometry on a biphoton beat note}, journal = {npj Quantum Information}, year = {2019}, month = {5}, day = {24}, volume = {5}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {quantum metrology, Hong-Ou-Mandel}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2056-6387}, DOI = {10.1038/s41534-019-0161-z}, stag_bib_extends_levelofaccess = {NA}, author = {Chen, Y. and Fink, M. and Steinlechner, F. and Torres, J.P. and Ursin, R.} } @Article { LeferinktMH2019, subid = {1385}, title = {Fast Magnetic Emission Tests for Continuous Measurements Around an Equipment Under Test}, journal = {2019 ESA Workshop on Aerospace EMC (Aerospace EMC)}, year = {2019}, month = {5}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {IEEE Keywords Position measurement, Time measurement, Time-frequency analysis, Magnetic field measurement, Electromagnetic interference INSPEC: Controlled Indexing electromagnetic interference, position measurement, time-domain analysis INSPEC: Non-Controlled Indexing continuous measurements, fast magnetic emission tests, continuous positional measurement, maximum emission, maximum interference, measurement positions, time domain electromagnetic interference analyzers, EMI test receiver, long measurement time, EUT, radiated electromagnetic interference emission}, web_url = {https://research.utwente.nl/en/publications/fast-magnetic-emission-tests-for-continuous-measurements-around-a}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.23919/AeroEMC.2019.8788950}, stag_bib_extends_levelofaccess = {NA}, author = {Hartman, T. and Moonen, N. and ten Have, B. and Leferink, F.} } @Article { TibertoCCBMF2019, subid = {1266}, title = {Infuence of shape, size and magnetostatic interactions on the hyperthermia properties of permalloy nanostructures}, journal = {Scientific Reports}, year = {2019}, month = {4}, day = {29}, volume = {9}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {6591}, keywords = {Magnetic nanostructures, Hysteresis losses, Micromagnetic modelling}, web_url = {https://www.nature.com/articles/s41598-019-43197-4}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322 (online)}, DOI = {10.1038/s41598-019-43197-4}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Manzin, A. and Barrera, G. and Celegato, F. and Co{\"i}sson, M. and Tiberto, P.} } @Article { XuLLALAGMWTLATSPDA2019, subid = {1116}, title = {High-precision methanol spectroscopy with a widely tunable SI-traceable frequency-comb-based mid-infrared QCL}, journal = {Optica}, year = {2019}, month = {4}, volume = {6}, number = {4}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {411}, keywords = {Diode lasers; Laser beams; Laser sources; Optical components; Saturation spectroscopy; Tunable lasers;}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.6.000411}, stag_bib_extends_levelofaccess = {NA}, author = {Santagata, R. and Tran, D.B.A. and Argence, B. and Lopez, O. and Tokunaga, S.K. and Wiotte, F. and Mouhamad, H. and Goncharov, A. and Abgrall, M. and Le Coq, Y. and Alvarez-Martinez, H. and Le Targat, R. and Lee, W.K. and Xu, D. and Pottie, P.E. and Darqui{\'e}, B. and Amy-Klein, A.} } @Article { DarquieSPXATAWTLMAGLLAL2019, subid = {1116}, title = {High-precision methanol spectroscopy with a widely tunable SI-traceable frequency-comb-based mid-infrared QCL}, journal = {Optica}, year = {2019}, month = {4}, volume = {6}, number = {4}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {411}, keywords = {optical Fiber, optical frequency transfer}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.6.000411}, stag_bib_extends_levelofaccess = {NA}, author = {Santagata, R. and Tran, D.B.A. and Argence, B. and Lopez, O. and Tokunaga, S.K. and Wiotte, F. and Mouhamad, H. and Goncharov, A. and Abgrall, M. and Le Coq, Y. and Alvarez-Martinez, H. and Le Targat, R. and Lee, W.K. and Xu, D. and Pottie, P.E. and Darqui{\'e}, B. and Amy-Klein, A.} } @Article { BuechelerTSALWCW2019, subid = {1241}, title = {Time-resolved photoluminescence on double graded Cu(In,Ga)Se2 – Impact of front surface recombination and its temperature dependence}, journal = {Science and Technology of Advanced Materials}, year = {2019}, month = {4}, volume = {20}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {313-323}, keywords = {time-resolved photoluminescence}, misc2 = {EMPIR 2016: Energy}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1468-6996, 1878-5514}, DOI = {10.1080/14686996.2019.1586583}, stag_bib_extends_levelofaccess = {NA}, author = {Weiss, T.P. and Carron, R. and Wolter, M.H. and L{\"o}ckinger, J. and Avancini, E. and Siebentritt, S. and Buecheler, S. and Tiwari, A.N.} } @Article { MarquesTUWdLLLGHA2019, subid = {1369}, title = {Topology Driven g-Factor Tuning in Type-II Quantum Dots}, journal = {Physical Review Applied}, year = {2019}, month = {4}, volume = {11}, number = {4}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {044011}, keywords = {quantum dots, optoelectronics, spin-orbit coupling, Aharonov-Bohm effect}, web_url = {https://arxiv.org/abs/1710.08828}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.11.044011}, stag_bib_extends_levelofaccess = {NA}, author = {Llorens, J.M. and Lopes-Oliveira, V. and L{\'o}pez-Richard, V. and de Oliveira, E.R. Cardozo and Wewi{\'o}r, L. and Ulloa, J.M. and Teodoro, M.D. and Marques, G.E. and Garc{\'i}a-Crist{\'o}bal, A. and Hai, G.-Q. and Al{\'e}n, B.} } @Article { TiwariBCFBW2019, subid = {1240}, title = {Bulk and surface recombination properties in thin film semiconductors with different surface treatments from time-resolved photoluminescence measurements}, journal = {Scientific Reports}, year = {2019}, month = {3}, day = {29}, volume = {9}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, keywords = {thin filmsemiconductor}, misc2 = {EMPIR 2016: Energy}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-41716-x}, stag_bib_extends_levelofaccess = {NA}, author = {Weiss, T.P. and Bissig, B. and Feurer, T. and Carron, R. and Buecheler, S. and Tiwari, A.N.} } @Article { KoellenspergerNST2019, subid = {1195}, title = {FI-ICP-TOFMS for high-throughput and low volume multi-element analysis in environmental and biological matrices}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2019}, month = {3}, day = {28}, volume = {34}, number = {6}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {1272-1278}, keywords = {low volume multi-element analysis, FI-ICP-TOFMS, analysis in environmental and biological matrices}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2019/JA/C9JA00022D\#!divAbstract}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/C9JA00022D}, stag_bib_extends_levelofaccess = {NA}, author = {Theiner, S. and Schoeberl, A. and Neumayer, S. and Koellensperger, G.} } @Proceedings { ThalmannMBK2019, subid = {1030}, title = {CT machine geometry changes under thermal load}, journal = {Nondestructive Testing}, year = {2019}, month = {3}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {23681}, keywords = {CT machine geometry, thermal influences, geometry measurement system, metrology}, web_url = {http://www.ndt.net/?id=23681}, misc2 = {EMPIR 2017: Industry}, publisher = {NDT.net}, event_place = {Padova}, event_name = {9th Conference on Industrial Computed Tomography (iCT) 2019}, event_date = {13-02-2019 to 15-02-2019}, language = {30}, ISSN = {1435-4934}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2019/papers/iCT2019_Full_paper_47.pdf}, author = {Thalmann, R. and Meli, F. and Bircher, B.A. and K{\"u}ng, A.} } @Proceedings { ThalmannMBK2019_2, subid = {1029}, title = {CT geometry determination using individual radiographsof calibrated multi-sphere standards}, journal = {Nondestructive Testing}, year = {2019}, month = {3}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {23677}, keywords = {CT machine geometry, correction, multi-sphere standard, metrology}, web_url = {https://www.ndt.net/search/docs.php3?showForm=off\&id=23677}, misc2 = {EMPIR 2017: Industry}, publisher = {NDT.net}, event_place = {Padova}, event_name = {9th Conference on Industrial Computed Tomography (iCT) 2019}, event_date = {13-02-2019 to 15-02-2019}, language = {30}, ISSN = {1435-4934}, stag_bib_extends_levelofaccess = {NA}, author = {Thalmann, R. and Meli, F. and Bircher, B.A. and K{\"u}ng, A.} } @Article { SafronovaPTLSHP2019, subid = {1051}, title = {Optical clock comparison for Lorentz symmetry testing}, journal = {Nature}, year = {2019}, month = {3}, volume = {567}, number = {7747}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {204-208}, keywords = {optical clock, Lorentz symmetry violation, ytterbium, ion trap}, web_url = {https://arxiv.org/abs/1809.10742\#}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0028-0836, 1476-4687}, DOI = {10.1038/s41586-019-0972-2}, stag_bib_extends_levelofaccess = {NA}, author = {Sanner, C. and Huntemann, N. and Lange, R. and Tamm, C. and Peik, E. and Safronova, M.S. and Porsev, S.G.} } @Article { KurlyandskayaSCMBACT2019, subid = {944}, title = {Specific loss power measurements by calorimetric and thermal methods on \(\gamma\)-Fe2O3 nanoparticles for magnetic hyperthermia}, journal = {Journal of Magnetism and Magnetic Materials}, year = {2019}, month = {3}, volume = {473}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {403-409}, keywords = {Magnetic hyperthermia, Fe-oxide, Magnetic nanoparticles}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-8853}, DOI = {10.1016/j.jmmm.2018.10.107}, stag_bib_extends_levelofaccess = {NA}, author = {Co{\"i}sson, M. and Barrera, G. and Appino, C. and Celegato, F. and Martino, L. and Safronov, A.P. and Kurlyandskaya, G.V. and Tiberto, P.} } @Inbook { SanderTK2019, subid = {1131}, title = {Optically Pumped Magnetometers for MEG}, year = {2019}, month = {2}, day = {21}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {1-12}, keywords = {Optically pumped magnetometer, Magnetoencephalography, Superconducting quantum interference device, Magnetocardiography, Multichannel, Electron spin resonance, Microelectromechanical system, Alkali-metal vapor cell, Atomic magnetometer, Optical magnetometer}, misc2 = {EMPIR 2015: Health}, publisher = {Springer International Publishing}, booktitle = {Magnetoencephalography}, language = {30}, ISBN = {978-3-319-62657-4}, DOI = {10.1007/978-3-319-62657-4_49-1}, stag_bib_extends_levelofaccess = {NA}, author = {Knappe, S. and Sander, T. and Trahms, L.} } @Article { ThevenotSDP2019, subid = {1143}, title = {The ampere and the electrical units in the quantum era}, journal = {Comptes Rendus Physique}, year = {2019}, month = {1}, volume = {20}, number = {1-2}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {92-128}, keywords = {Quantum electrical standards, Quantum hall devices, Small current traceability, Cryogenic Current Comparators, Quantum metrology triangle, SI redefinition, Ampere, base units, programmable quantum current generator, quantum calibrator}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {1631-0705}, DOI = {10.1016/j.crhy.2019.02.003}, stag_bib_extends_levelofaccess = {NA}, author = {Poirier, W. and Djordjevic, S. and Schopfer, F. and Thevenot, O.} } @Article { ThevenotSDP20190, subid = {1143}, title = {The ampere and the electrical units in the quantum era}, journal = {Comptes Rendus Physique}, year = {2019}, month = {1}, volume = {20}, number = {1-2}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {92-128}, keywords = {Quantum electrical standards, Quantum hall devices, Small current traceability, Cryogenic Current Comparators, Quantum metrology triangle, SI redefinition, Ampere, base units, programmable quantum current generator, quantum calibrator}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {1631-0705}, DOI = {10.1016/j.crhy.2019.02.003}, stag_bib_extends_levelofaccess = {NA}, author = {Poirier, W. and Djordjevic, S. and Schopfer, F. and Thevenot, O.} } @Article { OliveroDFGRBLKTMCKGD2019, subid = {1007}, title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range}, journal = {Metrologia}, year = {2019}, month = {1}, volume = {56}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {015016}, keywords = {colour centers, single-photon source, metrology for quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf6c8}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.} } @Article { OliveroDFGRBLKTMCKGD20190, subid = {1007}, title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range}, journal = {Metrologia}, year = {2019}, month = {1}, volume = {56}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {015016}, keywords = {colour centers, single-photon source, metrology for quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf6c8}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.} } @Article { OliveroDFGRBLKTMCKGD20191, subid = {1007}, title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range}, journal = {Metrologia}, year = {2019}, month = {1}, volume = {56}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {015016}, keywords = {colour centers, single-photon source, metrology for quantum technologies}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf6c8}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.} } @Proceedings { SpasovaBNOSCTHZSAV2019, subid = {1490}, title = {A new EMPIR Project “MetForTC” for Developing Traceable Measurement Capabilities for Monitoring Thermocouple Performance}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, volume = {-}, number = {2019}, number2 = {18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance}, pages = {5/18006}, keywords = {EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple}, misc2 = {EMPIR 2018: Research Potential}, publisher = {EDP Sciences}, event_place = {Paris, France}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201918006}, stag_bib_extends_levelofaccess = {NA}, author = {Arifovic, N. and Sestan, D. and Zvizdić, D. and Hozic, N. and Turz{\'o}-Andr{\'a}s, E. and Čohodarević, S. and Strnad, R. and Opel, K. and Neagu, D. and Bordianu, C. and Spasova, S. and Vukičević, T.} } @Article { AkramMNBKKO2019, subid = {1056}, title = {Pulsation of InGaAs photodiodes in liquid helium for driving Josephson arrays in ac voltage realization}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2019}, volume = {29}, number = {7}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {1200308}, keywords = {Photodiodes, Integrated circuits, Josephson junctions, Optical distortion, Junctions, Bit rate, Optical pulses}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2019.2901573}, stag_bib_extends_levelofaccess = {NA}, author = {Karlsen, B. and Kieler, O. and Behr, R. and Tuan Nguyen, T.A. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.A.} } @Article { TorresSLU, subid = {1396}, title = {Temperature-Controlled Entangled-Photon Absorption Spectroscopy}, journal = {ArXiv quantum physics}, year = {2019}, volume = {arxiv1902.}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1-8}, keywords = {Spectroscopy, entangled photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Cornell University}, language = {1}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1901.02605}, author = {Torres, J. and Svozilik, J. and Leon-Montiels, R. and U'Ren, A.} } @Proceedings { SPINELLICTVDKWMDDD2019, subid = {1405}, title = {EURAMET EMPIR 18HLT06 RaCHy Project: Radiotherapy coupled with Hyperthermia (Induced by HITU)}, journal = {unavailable}, year = {2019}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {1032-1036}, keywords = {External beam radiotherapy, EBRT, HITU, Ultrasound, Hyperthermia}, web_url = {http://publications.rwth-aachen.de/record/767416}, misc2 = {EMPIR 2018: Health}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik}, event_place = {Aachen, Germany}, event_name = {23rd International Congress on Acoustics : integrating 4th EAA Euroregio}, event_date = {09-09-2019 to 13-09-2019}, language = {30}, ISBN = {978-3-939296-15-7}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.18154/RWTH-CONV-238838}, author = {SPINELLI, A. and CACCIA, B. and TER HAAR, G. and VAN RHOON, G. and de Pooter, J. and Karab{\"o}ce, B. and Wilkens, V. and MILORO, P. and Durando, G. and DENKOWA, A. and DIJKEMA, R.} } @Proceedings { SiboldTH2018, subid = {1049}, title = {Delayed authentication and delayed measurement application in one-way synchronization}, journal = {Proceedings of: 2018 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, year = {2018}, month = {11}, day = {22}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-6}, keywords = {time synchronization, Network Time Security (NTS), Time Security, security, authentication, integrity, Network Time Protocol (NTP)}, web_url = {https://doi.org/10.1109/ISPCS.2018.8543083}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Geneva, Switzerland}, event_name = {2018 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, event_date = {30-09-2018 to 05-10-2018}, language = {30}, ISBN = {978-1-5386-4263-4}, ISSN = {1949-0313}, DOI = {10.7795/EMPIR.17IND06.CA.20190410A}, stag_bib_extends_levelofaccess = {NA}, author = {Sibold, D. and Teichel, K. and Hildermeier, G.} } @Proceedings { TeichelH2018, subid = {1050}, title = {Experimental Evaluation of Attacks on TESLA-Secured Time Synchronization Protocols}, journal = {Security Standardisation Research}, year = {2018}, month = {11}, day = {21}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {37-55}, keywords = {Time synchronization protocols, TESLA, Authentication, Experimental attack analysis, ASTS, TinySeRSync}, web_url = {https://doi.org/10.1007/978-3-030-04762-7_3}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer International Publishing}, event_place = {Darmstadt, Germany}, event_name = {International Conference on Research in Security Standardisation}, event_date = {26-11-2018 to 27-11-2018}, language = {30}, ISBN = {978-3-030-04761-0, 978-3-030-0}, ISSN = {0302-9743, 1611-3349}, DOI = {10.7795/EMPIR.17IND06.CA.20190410B}, stag_bib_extends_levelofaccess = {NA}, author = {Teichel, K. and Hildermeier, G.} } @Article { JaksiMODPCMTSSKDHLDGF2018, subid = {1009}, title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond}, journal = {ACS Photonics}, year = {2018}, month = {11}, day = {12}, volume = {5}, number = {12}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4864-4871}, keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.8b01013}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Herzig, T. and K{\"u}pper, J. and Damin, A. and Santonocito, S. and Signorile, M. and Traina, P. and Moreva, E. and Celegato, F. and Pezzagna, S. and Degiovanni, I. P. and Olivero, P. and Jakšić, M. and Meijer, J. and Genovese, P. M. and Forneris, J.} } @Article { JaksiMODPCMTSSKDHLDGF20180, subid = {1009}, title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond}, journal = {ACS Photonics}, year = {2018}, month = {11}, day = {12}, volume = {5}, number = {12}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {4864-4871}, keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.8b01013}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Herzig, T. and K{\"u}pper, J. and Damin, A. and Santonocito, S. and Signorile, M. and Traina, P. and Moreva, E. and Celegato, F. and Pezzagna, S. and Degiovanni, I. P. and Olivero, P. and Jakšić, M. and Meijer, J. and Genovese, P. M. and Forneris, J.} } @Thesis { Teodoro2018, subid = {1263}, title = {Investigation and Characterization of materials towards building ionization vacuum gauges}, year = {2018}, month = {11}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, keywords = {IISEYIonization gaugeXPSWork Function}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {FCT/UNL}, address = {Lisbon}, school = {Faculty of Sciences and Technology, Nova University of Lisbon}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/10362/52578}, author = {Teodoro, Orlando} } @Article { JakubowskiLKNPTRES2018, subid = {937}, title = {Gadolinium in human brain sections and colocalization with other elements}, journal = {Neurology - Neuroimmunology Neuroinflammation}, year = {2018}, month = {10}, day = {19}, volume = {6}, number = {1}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {e515}, keywords = {Gadolinium, Gadolinium-based contrast agents, Human brain, MRI, LA-ICP-MS, Iron, Copper, Phosphorus}, web_url = {http://nn.neurology.org/content/6/1/e515/}, misc2 = {EMPIR 2015: Health}, publisher = {Ovid Technologies (Wolters Kluwer Health)}, language = {30}, ISSN = {2332-7812}, DOI = {10.1212/NXI.0000000000000515}, stag_bib_extends_levelofaccess = {NA}, author = {El-Khatib, A.H. and Radbruch, H. and Trog, S. and Neumann, B. and Paul, F. and Koch, A. and Linscheid, M.W. and Jakubowski, N. and Schellenberger, E.} } @Article { KuosmanenTHWV2018, title = {Uncertainty analysis of phase and amplitude of harmonic components of bearing inner ring four-point roundness measurement}, journal = {Precision Engineering}, year = {2018}, month = {10}, volume = {54}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {118-130}, keywords = {Monte-Carlo simulation, Phase uncertainty, Harmonic component uncertainty, Uncertainty evaluation, Bearing excitation, Odd and even harmonic components, Four-point method, Three-point method}, web_url = {https://www.sciencedirect.com/science/article/pii/S0141635918302368}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2018.05.008}, stag_bib_extends_levelofaccess = {NA}, author = {Kuosmanen, P. and Tammi, K. and Hemming, B. and Widmaier, T. and Viitala, R.} } @Article { TarletonHD2018, subid = {932}, title = {Consistent determination of geometrically necessary dislocation density from simulations and experiments}, journal = {International Journal of Plasticity}, year = {2018}, month = {10}, volume = {109}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {18-42}, keywords = {density}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0749-6419}, DOI = {10.1016/j.ijplas.2018.05.001}, stag_bib_extends_levelofaccess = {NA}, author = {Das, S. and Hofmann, F. and Tarleton, E.} } @Article { RuttTTHLHILS2018, subid = {1122}, title = {Manipulation of random telegraph signals in a silicon nanowire transistor with a triple gate}, journal = {Nanotechnology}, year = {2018}, month = {9}, day = {25}, volume = {29}, number = {47}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {475201}, keywords = {random telegraph signal, silicon nanowire, quantum dot, MOSFET}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/aadfa6/meta\#back-to-top-target}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/aadfa6}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, F. and Ibukuro, K. and Husain, M.H. and Li, Z. and Hillier, J. and Tomita, I. and Tsuchiya, Y. and Rutt, H. and Saito, S.} } @Article { ZibordiT2018, subid = {960}, title = {Non-linear response of a class of hyper-spectral radiometers}, journal = {Metrologia}, year = {2018}, month = {9}, day = {21}, volume = {55}, number = {5}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {747-758}, keywords = {Non-linearity, Hyperspectral radiometry, Ocean colour}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/aadd7f/pdf}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aadd7f}, stag_bib_extends_levelofaccess = {NA}, author = {Talone, M. and Zibordi, G.} } @Article { HisamotoRHLASTYTLSK2018, subid = {595}, title = {Quantum Dipole Effects in a Silicon Transistor under High Electric Fields}, journal = {Journal of the Physical Society of Japan}, year = {2018}, month = {9}, day = {15}, volume = {87}, number = {9}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {094801}, keywords = {Si, CMOS, transistor, quantum dipole, Heisenberg model}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Physical Society of Japan}, language = {30}, ISSN = {0031-9015, 1347-4073}, DOI = {10.7566/jpsJ.87.094801}, stag_bib_extends_levelofaccess = {NA}, author = {Saito, S. and Li, Z. and Yoshimoto, H, and Tomita, I. and Tsuchiya, Y. and Sasago, Y. and Arimoto, H. and Liu, F. and Husain, M.K. and Hisamoto, D. and Rutt, H.N. and Kurihara, S.} } @Proceedings { CarabelliDPDFTMGR2018, subid = {1414}, title = {Color centres in diamond from single photon sources to ODMR in cells}, journal = {Quantum Photonic Devices 2018}, year = {2018}, month = {9}, day = {11}, volume = {10733}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1073304}, keywords = {Diamond,Color centers,Confocal microscopy,Electroluminescence,Single photon}, web_url = {https://iris.unito.it/handle/2318/1685641\#.XjvhgWhKhPY}, misc2 = {EMPIR 2017: Fundamental}, publisher = {SPIE}, event_place = {San Diego, California, United States}, event_name = {SPIE NanoScience + Engineering}, event_date = {19-08-2018 to 23-08-2018}, language = {30}, DOI = {10.1117/12.2323102}, stag_bib_extends_levelofaccess = {NA}, author = {Genovese, M. and Moreva, E. and Traina, P. and Forneris, J. and Ditalia Tchernij, S. and Picollo, F. and Degiovanni, I.P. and Carabelli, V. and Olivero, P.} } @Article { YangBJCJTS2018, title = {Individualized magnetoencephalography using optically pumped magnetometers with an anatomy derived sensor holder}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2018}, month = {9}, volume = {63}, number = {s1}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {240}, keywords = {OPM, SQUID, SQUID-MEG, signal-to-noise ratio}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Walter de Gruyter GmbH}, address = {Berlin}, language = {30}, ISSN = {1862-278X, 0013-5585}, DOI = {10.1515/bmt-2018-6045}, stag_bib_extends_levelofaccess = {NA}, author = {Yang, T. and Br{\"u}hl, R. and Jodko-Władzińska, A. and Cotic Smole, P. and Jazbinšek, V. and Trahms, L. and Sander-Th{\"o}mmes, T.} } @Article { SieversYSHGBTCBF2018, subid = {996}, title = {Excitation and coherent control of magnetization dynamics in magnetic tunnel junctions using acoustic pulses}, journal = {Applied Physics Letters}, year = {2018}, month = {8}, day = {13}, volume = {113}, number = {7}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, keywords = {Excitation, Coherent control, Magnetization dynamics, magnetic tunnel junctions, acoustic pulses}, web_url = {https://arxiv.org/abs/1804.10503}, misc2 = {EMPIR 2015: SI Broader Scope}, language = {30}, DOI = {10.1063/1.5037780}, stag_bib_extends_levelofaccess = {NA}, author = {Yang, H.F. and Garcia-Sanchez, F. and Hu, X.K. and Sievers, S. and B{\"o}hnert, T. and Costa, J.D. and Tarequzzaman, M. and Ferreira, R. and Bieler, M. and Schumacher, H.W.} } @Article { MullejansTPS2018, title = {Uncertainty budget assessment of temperature coefficient measurements performed via intra-laboratory comparison between various facilities for PV device calibration}, journal = {Solar Energy}, year = {2018}, month = {8}, volume = {170}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {293-300}, keywords = {Temperature coefficients uncertainty, Temperature-dependent spectral mismatch, Photovoltaics, Intercomparison}, web_url = {https://reader.elsevier.com/reader/sd/F3B29C1ED5EA17BAFB18D68D072A007E7E1838829B884A59F5C7E5535FACF846A0BBB5E76DB2DBC50641745278F0FF2E\#pf1}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2018.04.062}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}llejans, H. and Trentadue, G. and Pavanello, D. and Salis, E.} } @Article { JelezkoDNAEBGJSMTFDGO2018, subid = {1010}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept}, journal = {Physical Review Applied}, year = {2018}, month = {7}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance}, web_url = {https://arxiv.org/abs/1706.07935}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.10.014024}, stag_bib_extends_levelofaccess = {NA}, author = {Forneris, J. and Ditalia Tchernij, S. and Traina, P. and Moreva, E. and Skukan, N. and Jakšić, M. and Grilj, V. and Bosia, F. and Enrico, E. and Amato, G. and Degiovanni, I.P. and Naydenov, B. and Jelezko, F. and Genovese, M. and Olivero, P.} } @Article { JelezkoDNAEBGJSMTFDGO20180, subid = {1010}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept}, journal = {Physical Review Applied}, year = {2018}, month = {7}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.10.014024}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1706.07935}, author = {Forneris, J. and Ditalia Tchernij, S. and Traina, P. and Moreva, E. and Skukan, N. and Jakšić, M. and Grilj, V. and Bosia, F. and Enrico, E. and Amato, G. and Degiovanni, I.P. and Naydenov, B. and Jelezko, F. and Genovese, M. and Olivero, P.} } @Article { XuerebGMLMTCC2018, subid = {852}, title = {Optical frequency transfer over submarine fiber links}, journal = {Optica}, year = {2018}, month = {7}, day = {25}, volume = {5}, number = {8}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {893}, keywords = {optical fiber, optical frequency transfer}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.5.000893}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Tampellini, A. and Mura, A. and Levi, F. and Marra, G. and Galea, P. and Xuereb, A. and Calonico, D.} } @Article { Tzelepis2018_2, title = {Distributed Current Sensing Technology for protection and Fault LocationApplications in HVDC networks}, journal = {The Journal of Engineering}, year = {2018}, month = {7}, day = {18}, volume = {-}, number = {-}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {1-6}, keywords = {Multi terminal direct Current, Differential protection, Travelling waves, Distributed sensing}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institution of Engineering and Technology (IET)}, language = {30}, ISSN = {2051-3305}, DOI = {10.1049/joe.2018.0219}, stag_bib_extends_levelofaccess = {NA}, author = {Tzelepis, D.} } @Article { SchaeffterTFSKWPW2018, subid = {942}, title = {Improved sensitivity and limit-of-detection using a receive-only coil in magnetic particle imaging}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {7}, volume = {63}, number = {13}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {13NT02}, keywords = {magnetic nanoparticles, magnetic particle imaging, magnetic measurements}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aacb87}, stag_bib_extends_levelofaccess = {NA}, author = {Paysen, H. and Wells, J. and Kosch, O. and Steinhoff, U. and Franke, J. and Trahms, L. and Schaeffter, T. and Wiekhorst, F.} } @Article { UngerDTSK2018, subid = {560}, title = {Surface characterisation of Escherichia coli under various conditions by near-ambient pressure XPS}, journal = {Surface and Interface Analysis}, year = {2018}, month = {7}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {1-5}, keywords = {bacteria, E.coli, NAP-XPS}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/sia.6480}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.6480}, stag_bib_extends_levelofaccess = {NA}, author = {Kjaervik, M. and Schwibbert, K. and Dietrich, P. and Thissen, A. and Unger, W.E.S.} } @Proceedings { DambrineTPH2018, subid = {891}, title = {Quantitative Error Analysis in Near-Field Scanning Microwave Microscopy}, journal = {2018 International Conference on Manipulation, Automation and Robotics at Small Scales (MARSS)}, year = {2018}, month = {7}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Near-field , microwave, microscopy}, web_url = {https://hal.archives-ouvertes.fr/hal-01913677}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Nagoya - Japan}, event_name = {2018 International Conference on Manipulation, Automation and Robotics at Small Scales (MARSS)}, event_date = {04-07-2018 to 08-07-2018}, language = {30}, DOI = {10.1109/MARSS.2018.8481160}, stag_bib_extends_levelofaccess = {NA}, author = {Haddadi, K. and Polovodov, P. and Theron, D. and Dambrine, G.} } @Article { LassmannT2018, subid = {1164}, title = {Characterization of Noise and Resolution for Quantitative 177Lu SPECT/CT with xSPECT Quant}, journal = {Journal of Nuclear Medicine}, year = {2018}, month = {7}, volume = {60}, number = {1}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {50-59}, keywords = {image reconstruction; radiobiology/dosimetry; SPECT/CT; calibration; ordered-subset conjugate gradient minimization (OSCGM); quantitative Lu-177 SPECT}, web_url = {http://jnm.snmjournals.org/content/60/1/50.long}, misc2 = {EMPIR 2015: Health}, publisher = {Society of Nuclear Medicine}, language = {30}, ISSN = {0161-5505, 2159-662X}, DOI = {10.2967/jnumed.118.211094}, stag_bib_extends_levelofaccess = {NA}, author = {Tran-Gia, J. and Lassmann, M.} } @Article { LudwigSKSDGTNPFJBPKRI2018, subid = {900}, title = {Development of white LED illuminants for colorimetry and recommendation of white LED reference spectrum for photometry}, journal = {Metrologia}, year = {2018}, month = {6}, day = {28}, volume = {55}, number = {4}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {526-534}, keywords = {Photometry, colorimetry, illuminant, reference spectrum, photometer, calibration, uncertainty}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aacae7}, stag_bib_extends_levelofaccess = {NA}, author = {Kokka, A. and Poikonen, T. and Blattner, P. and Jost, S. and Ferrero, A. and Pulli, T. and Ngo, M. and Thorseth, A. and Gerloff, T. and Dekker, P. and Stuker, F. and Klej, A. and Ludwig, K. and Schneider, M. and Reiners, T. and Ikonen, E.} } @Article { YuWMGDCBBTCOGM2018, subid = {955}, title = {Preliminary assessment of stable nitrogen and oxygen isotopic composition of USGS51 and USGS52 nitrous oxide reference gases and perspectives on calibration needs}, journal = {Rapid Communications in Mass Spectrometry}, year = {2018}, month = {6}, day = {26}, volume = {32}, number = {15}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {1207-1214}, keywords = {N2O, reference material, isotope delta value, USGS51, USGS52}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/rcm.8257}, misc2 = {EMPIR 2016: Environment}, publisher = {Wiley}, language = {30}, ISSN = {0951-4198}, DOI = {10.1002/rcm.8157}, stag_bib_extends_levelofaccess = {NA}, author = {Ostrom, N.E. and Gandhi, H. and Coplen, T.B. and Toyoda, S. and B{\"o}hlke, J.K. and Brand, W.A. and Casciotti, K.L. and Dyckmans, J. and Giesemann, A. and Mohn, J. and Mohn, J. and Well, R. and Yu, L.} } @Article { TettamanziKDRMHTRK2018, subid = {828}, title = {Gigahertz Single-Electron Pumping Mediated by Parasitic States}, journal = {Nano Letters}, year = {2018}, month = {6}, day = {19}, volume = {18}, number = {7}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {4141-4147}, keywords = {silicon electron pump}, web_url = {https://arxiv.org/abs/1803.00791}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1530-6984, 1530-6992}, DOI = {10.1021/acs.nanolett.8b00874}, stag_bib_extends_levelofaccess = {NA}, author = {Rossi, A. and Klochan, J. and Timoshenko, J. and Hudson, F.E. and M{\"o}tt{\"o}nen, M. and Rogge, S. and Dzurak, A.S. and Kashcheyevs, V. and Tettamanzi, G.C.} } @Article { RadivojeviTSD2018, subid = {756}, title = {An in situ temperature calibration of a guarded hot plate apparatus}, journal = {Thermal Science International Scientific Journal}, year = {2018}, month = {6}, day = {17}, volume = {On line fi}, number2 = {14RPT05: Eura-Thermal: Developing traceable capabilities in thermal metrology}, pages = {176-186}, keywords = {Thermal Conductivity, Guarded Hot Plate Method, Metrology, in situ temperature calibration}, misc2 = {EMPIR 2014: Research Potential}, publisher = {Dr. Vukman Bakić}, language = {30}, ISSN = {2334-7163}, DOI = {10.2298/TSCI180425176S}, stag_bib_extends_levelofaccess = {NA}, author = {Stepanic, N. and Terzic, M. and Radivojević, D. and Raković, D.} } @Article { ThorwarthKDP2018, subid = {839}, title = {Ionization chamber correction factors for MR-linacs}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {6}, volume = {63}, number = {11}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {11NT03}, keywords = {MRgRT, reference dosimetry}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aac4f2}, stag_bib_extends_levelofaccess = {NA}, author = {Pojtinger, S. and Dohm, O.S. and Kapsch, R.P. and Thorwarth, D.} } @Proceedings { PousASTOC2018, subid = {765}, title = {FFT-based time domain solution to power frequency issue of CS101 testing for military and aerospace equipment}, journal = {2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility (EMC/APEMC)}, year = {2018}, month = {5}, day = {14}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {177-182}, keywords = {Aerospace, CS101, EMC, Immunity, Military, Time Domain}, web_url = {http://rfmw.cmi.cz/documents/papers/Cakir_FFT_TDS_CS101.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Singapore}, event_name = {2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility}, event_date = {14-05-2018 to 18-05-2018}, language = {30}, ISBN = {978-1-5090-5997-3}, DOI = {10.1109/ISEMC.2018.8393762}, stag_bib_extends_levelofaccess = {NA}, author = {\c{C}akır, S. and Ozturk, M. and Tektas, B. and Şen, O. and Acak, S. and Pous, M.} } @Article { GenoveseDBTVLGAP2018, subid = {532}, title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement}, journal = {Scientific Reports}, year = {2018}, month = {5}, volume = {8}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-25156-7}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Gramegna, M. and Lussana, R. and Villa, F. and Tosi, A. and Brida, G. and Degiovanni, I.P. and Genovese, M.} } @Article { GenoveseDBTVLGAP20180, subid = {532}, title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement}, journal = {Scientific Reports}, year = {2018}, month = {5}, volume = {8}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-25156-7}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Gramegna, M. and Lussana, R. and Villa, F. and Tosi, A. and Brida, G. and Degiovanni, I.P. and Genovese, M.} } @Article { MihelicTDDR2018, title = {Comparison of the uncertainties of several European low-dose calibration facilities}, journal = {Journal of Instrumentation}, year = {2018}, month = {4}, day = {27}, volume = {13}, number = {04}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {P04023-P04023}, keywords = {detector alignment and calibration methods, dosimetry concepts and apparatus, gamma detectors}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/13/04/P04023}, stag_bib_extends_levelofaccess = {NA}, author = {Mihelic, M. and Toni, M.P. and D{\'i}az, N.A.C. and Dombrowski, H. and R{\"o}ttger, A.} } @Article { BoothTDFNMD2018_2, title = {Advanced fault location in MTDC networks utilising optically-multiplexed current measurements and machine learning approach}, journal = {International Journal of Electrical Power \& Energy Systems}, year = {2018}, month = {4}, volume = {97}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {319-333}, keywords = {Fault location, Multi-terminal direct current, Travelling waves, Optical sensors, Machine learning, Pattern recognition}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0142-0615}, DOI = {10.1016/j.ijepes.2017.10.040}, stag_bib_extends_levelofaccess = {NA}, author = {Booth, C. and Tzelepis, D. and Dysko, A. and Fusiek, G. and Niewczas, P. and Mirsaeidi, S. and Dong, X.} } @Article { TabandehBSRCM2018, title = {Development of a low frost-point generator operating at sub-atmospheric pressure}, journal = {Measurement Science and Technology}, year = {2018}, month = {3}, day = {16}, volume = {29}, number = {5}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {054002}, keywords = {hygrometry, humidity generator, frost point, upper-air sensors}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aaa785}, stag_bib_extends_levelofaccess = {NA}, author = {Tabandeh, S. and Beltramino, G. and Smorgon, D. and Rosso, L. and Cuccaro, R. and Mana, G.} } @Article { PaleckiOMLLJIHHGDTPdTVM2018_2, title = {Towards a global land surface climate fiducial reference measurements network}, journal = {International Journal of Climatology}, year = {2018}, month = {3}, volume = {38}, number = {6}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {2760-2774}, keywords = {climate, metrology, essential climate variables, climate change}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley}, language = {30}, ISSN = {0899-8418}, DOI = {10.1002/joc.5458}, stag_bib_extends_levelofaccess = {NA}, author = {Palecki, M. and Oakley, T. and Merlone, A. and Lawrimore, J. H. and Lister, D. H. and Jones, P. D. and Ingleby, N. B. and Hausfather, Z. and Harrigan, S. and Goodison, B. and Diamond, H. J. and Thorne, P. W. and Peterson, T. C. and de Podesta, M. and Tassone, C. and Venema, V. and Mana, G.} } @Article { CalonicoPTVR2018, subid = {589}, title = {Phase noise cancellation in polarisation-maintaining fibre links}, journal = {Review of Scientific Instruments}, year = {2018}, month = {3}, volume = {89}, number = {3}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {033103}, keywords = {frequency metrology, optical fibre links}, web_url = {http://arxiv.org/abs/1807.10818}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5016514}, stag_bib_extends_levelofaccess = {NA}, author = {Rauf, B. and V{\'e}lez L{\'o}pez, M. C. and Thoumany, P. and Pizzocaro, M. and Calonico, D.} } @Article { GilmoreTSH2018, subid = {559}, title = {SIMS of Organic Materials—Interface Location in Argon Gas Cluster Depth Profiles Using Negative Secondary Ions}, journal = {Journal of The American Society for Mass Spectrometry}, year = {2018}, month = {2}, day = {21}, volume = {29}, number = {4}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {774-785}, keywords = {SIMS}, web_url = {https://link.springer.com/article/10.1007\%2Fs13361-018-1905-2}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer US}, language = {30}, ISSN = {1044-0305, 1879-1123}, DOI = {10.1007/s13361-018-1905-2}, stag_bib_extends_levelofaccess = {NA}, author = {Havelund, R. and Seah, M. P. and Tiddia, M. and Gilmore, I. S.} } @Proceedings { TunnermannESLW2018, subid = {906}, title = {Measurement and removal of cladding light in high power fiber systems}, journal = {Proceeding of the SPIE}, year = {2018}, month = {2}, day = {20}, volume = {10513}, number2 = {waveguides and applications}, pages = {105130U}, keywords = {Fiber laser, high power laser, cladding light, fiber characterization, fiber system measurement, fiber laser measurement, double clad fiber}, web_url = {https://www.spiedigitallibrary.org/conference-proceedings-of-spie/10513/2288266/Measurement-and-removal-of-cladding-light-in-high-power-fiber/10.1117/12.2288266.full?SSO=1}, misc2 = {EMPIR 2014: Industry}, publisher = {SPIE}, event_place = {San Francisco}, event_name = {Components and Packaging for Laser Systems IV}, event_date = {30-01-2018 to 01-02-2018}, language = {30}, DOI = {10.1117/12.2288266}, stag_bib_extends_levelofaccess = {NA}, author = {Walbaum, T. and Liem, A. and Schreiber, T. and Eberhardt, R. and T{\"u}nnermann, A.} } @Article { CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018, subid = {812}, title = {Geodesy and metrology with a transportable optical clock}, journal = {Nature Physics}, year = {2018}, month = {2}, day = {12}, volume = {14}, number = {5}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {437-441}, keywords = {optical fiber, optical frequency transfer}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-017-0042-3}, stag_bib_extends_levelofaccess = {NA}, author = {Costanzo, G.A. and Zucco, M. and Barbieri, P. and Tampellini, A. and Bregolin, F. and Rauf, B. and Pizzocaro, M. and Thoumany, P. and Margolis, H.S. and Zampaolo, M. and Rolland, A. and Baynes, F.N. and Timmen, L. and Denker, H. and Voigt, C. and Lisdat, C. and H{\"a}fner, S. and Sterr, U. and Vogt, S. and Koller, S. and Grotti, J. and Clivati, C. and Levi, F. and Calonico, D.} } @Article { StevenSRPGGGHPTB2018, title = {A calibration procedure for a traceable contamination analysis on medical devices by combined X-ray spectrometry and ambient spectroscopic techniques}, journal = {Journal of Pharmaceutical and Biomedical Analysis}, year = {2018}, month = {2}, volume = {150}, number = {1}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {308-317}, keywords = {XRF; Reference-free; N,N’-ethylene-bis (stearamide); Vibrational spectroscopy; Medical device}, web_url = {https://www.sciencedirect.com/science/article/abs/pii/S0731708517310609}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0731-7085}, DOI = {10.1016/j.jpba.2017.12.007}, stag_bib_extends_levelofaccess = {NA}, author = {Steven, R. and Seim, C. and Rossi, A. and Portesi, C. and Gunning, P. and Green, F. and Giovannozzi, A.M. and Hornemann, A. and Pollakowski-Herrmann, B. and Tyler, B. and Beckhoff, B.} } @Article { PeikTLHS2018, subid = {558}, title = {Autobalanced Ramsey Spectroscopy}, journal = {Physical Review Letters}, year = {2018}, month = {1}, day = {30}, volume = {120}, number = {5}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {053602}, keywords = {atomic clock, atomic spectroscopy, light shift}, web_url = {https://www.ptb.de/cms/en/ptb/fachabteilungen/abt4/fb-44/44-literatur.html\#c8360}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.120.053602}, stag_bib_extends_levelofaccess = {NA}, author = {Sanner, C. and Huntemann, N. and Lange, R. and Tamm, C. and Peik, E.} } @Article { SaitoTTHSYHLSL2018, subid = {596}, title = {Random telegraph noise from resonant tunnelling at low temperatures}, journal = {Scientific Reports}, year = {2018}, month = {1}, day = {10}, volume = {8}, number = {1}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Random telegraph noise, Quantum dot, transistor}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-18579-1}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Yoshimoto, H. and Sasago, Y. and Hisamoto, D. and Tomita, I. and Tsuchiya, Y. and Saito, S.} } @Article { SliwczynskiKT2018, subid = {527}, title = {Long haul time and frequency distribution in different DWDM systems}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2018}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {1-1}, keywords = {time and frequency transfer, DWDM network, optical fiber, alien wavelength}, web_url = {https://ieeexplore.ieee.org/document/8340172/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2018.2827178}, stag_bib_extends_levelofaccess = {NA}, author = {Turza, K. and Krehlik, P. and Śliwczyński, L.} } @Article { StoicaTS2018, subid = {1103}, title = {Biphasic pKa Values}, journal = {Croatica Chemica Acta}, year = {2018}, volume = {91}, number = {4}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {599-602}, keywords = {acid strength, base strength, nonaqueous solvents, membranes, two-phase equilibria.}, web_url = {https://hrcak.srce.hr/215675}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Croatian Chemical Society}, language = {30}, ISSN = {0011-1643, 1334-417X}, DOI = {10.5562/cca3405}, stag_bib_extends_levelofaccess = {NA}, author = {Selberg, S. and Tshepelevitsh, S. and Leito, I.} } @Article { CouplandLTS2017, subid = {420}, title = {Effects of defocus on the transfer function of coherence scanning interferometry}, journal = {Optics Letters}, year = {2017}, month = {12}, day = {21}, volume = {43}, number = {1}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {82}, keywords = {Imaging systems , Interferometry, Metrology , Calibration , Microscopy, Aberrations}, web_url = {https://www.osapublishing.org/ol/fulltext.cfm?uri=ol-43-1-82}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.43.000082}, stag_bib_extends_levelofaccess = {NA}, author = {Su, R. and Thomas, M. and Leach, R. and Coupland, J.} } @Article { TakasuBBCJYKTT2017, subid = {775}, title = {Beyond-Born-Oppenheimer effects in sub-kHz-precision photoassociation spectroscopy of ytterbium atoms}, journal = {Physical Review A}, year = {2017}, month = {12}, volume = {96}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {063405}, keywords = {photoassociation, spectroscopy, ytterbium,}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.96.063405}, stag_bib_extends_levelofaccess = {NA}, author = {Borkowski, M. and Buchachenko, A.A. and Ciuryło, R. and Julienne, P.S. and Yamada, H. and Kikuchi, Y. and Takahashi, K. and Takahashi, Y. and Takasu, Y.} } @Article { SassiLGWTMPLBPDCESK2017, title = {Preparation and analysis of zero gases for the measurement of trace VOCs in air monitoring}, journal = {Atmospheric Measurement Techniques Discussions}, year = {2017}, month = {11}, day = {28}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {1-17}, keywords = {zero gas, VOC measurements}, web_url = {https://www.atmos-meas-tech-discuss.net/amt-2017-412/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8610}, DOI = {10.5194/amt-2017-412}, stag_bib_extends_levelofaccess = {NA}, author = {Sassi, G. and Lecuna, M. and Ghorafi, Y. and Wortmann, R. and Tensing, E. and Michl, K. and Plass-Duelmer, C. and Li, J. and Baldan, A. and Persijn, S. and Demichelis, A. and Claude, A. and Englert, J. and Sassi, M.P. and Kubistin, D.} } @Article { EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017, subid = {602}, title = {First patients treated with a 1.5 T MRI-Linac: clinical proof of concept of a high-precision, high-field MRI guided radiotherapy treatment}, journal = {Physics in Medicine \& Biology}, year = {2017}, month = {11}, day = {14}, volume = {62}, number = {23}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {L41-L50}, keywords = {MRgRT, Radiotherapy, MRI}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aa9517}, stag_bib_extends_levelofaccess = {NA}, author = {Raaymakers, B W and J{\"u}rgenliemk-Schulz, I M and Bol, G H and Glitzner, M and Kotte, A N T J and van Asselen, B and de Boer, J C J and Bluemink, J J and Hackett, S L and Moerland, M A and Woodings, S J and Wolthaus, J W H and van Zijp, H M and Philippens, M E P and Tijssen, R and Kok, J G M and de Groot-van Breugel, E N and Kiekebosch, I and Meijers, L T C and Nomden, C N and Sikkes, G G and Doornaert, P A H and Eppinga, W S C and Kasperts, N and Kerkmeijer, L G W and Tersteeg, J H A and Brown, K J and Pais, B and Woodhead, P and Lagendijk, J J W} } @Article { vanderVeenGUTBG2017, title = {Validation and sensitivity evaluation of the ID-GC-TOF-MS method for determination of PAHs in biogas}, journal = {Journal of Chemical Metrology}, year = {2017}, month = {11}, volume = {11}, number = {2}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {78-85}, keywords = {PAH; biogas; biomethane; thermal desorption; isotope dilution; GC-TOF-MS}, tags = {EnG}, web_url = {http://www.acgpubs.org/JCM/2017/Volume\%2011/Issue\%201/11-JCM_2017-11-01.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {ACG Publications}, language = {30}, ISSN = {1307-6183}, DOI = {10.25135/jcm.11.17.11.01}, stag_bib_extends_levelofaccess = {NA}, author = {van der Veen, A. and Goren, A.C. and Un, I. and Tarhan, T. and Bilsel, G. and Gokcen, T.} } @Article { QuinceyVTSPMMHWBWWSN2017, subid = {956}, title = {Mobility particle size spectrometers: Calibration procedures and measurement uncertainties}, journal = {Aerosol Science and Technology}, year = {2017}, month = {10}, day = {26}, volume = {52}, number = {2}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {146-164}, keywords = {aerosol metrology , mobility particle size spectrometers , calibration, measurement uncertainties}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, language = {30}, ISSN = {0278-6826, 1521-7388}, DOI = {10.1080/02786826.2017.1387229}, stag_bib_extends_levelofaccess = {NA}, author = {Wiedensohler, A. and Wiesner, A. and Weinhold, K. and Birmili, W. and Hermann, M. and Merkel, M. and M{\"u}ller, T. and Pfeifer, S. and Schmidt, A. and Tuch, T. and Velarde, F. and Quincey, P. and Seeger, S. and Nowak, A.} } @Article { TunnermannESHLWSSPB2017, subid = {388}, title = {Measuring thermal load in fiber amplifiers in the presence of transversal mode instabilities}, journal = {Optics Letters}, year = {2017}, month = {10}, day = {18}, volume = {42}, number = {21}, number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {4311-4314}, keywords = {Fiber optics amplifiers and oscillators, Thermal effects, Fiber properties, High power lasers}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-42-21-4311}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society of America}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.42.004311}, stag_bib_extends_levelofaccess = {NA}, author = {Beier, F. and Pl{\"o}tner, M. and Sattler, B. and Stutzki, F. and Walbaum, T. and Liem, A. and Haarlammert, N. and Schreiber, T. and Eberhardt, R. and T{\"u}nnermann, A.} } @Article { WehmannLSTVASFNLZSHW2017, title = {Study of 3D-growth conditions for selective area MOVPE of high aspect ratio GaN fins with non-polar vertical sidewalls}, journal = {Journal of Crystal Growth}, year = {2017}, month = {10}, volume = {476}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {90-98}, keywords = {Crystal morphology, Metalorganic vapor phase epitaxy, Gallium compounds, Nitrides, Light emitting diodes}, web_url = {http://www.sciencedirect.com/science/article/pii/S0022024817305146}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0022-0248}, DOI = {10.1016/j.jcrysgro.2017.08.021}, stag_bib_extends_levelofaccess = {NA}, author = {Wehmann, H-H and Lugauer, H-J and Stra{\ss}burg, M. and Trampert, A. and Varghese, T. and Avramescu, A. and Schimpke, T. and F{\"u}ndling, S. and Nicolai, L. and Ledig, J. and Zhou, H. and Steib, F. and Hartmann, J. and Waag, A} } @Article { CalonicoMLCT2017_2, subid = {367}, title = {Effect of a timebase mismatch in two-way optical frequency transfer}, journal = {Metrologia}, year = {2017}, month = {10}, volume = {54}, number = {6}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {805-809}, keywords = {optical fiber, optical frequency transfer}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa8a41}, stag_bib_extends_levelofaccess = {NA}, author = {Tampellini, A. and Clivati, C. and Levi, F. and Mura, A. and Calonico, D.} } @Article { BogucarskaPdJASSSKSTv2017, title = {New high-throughput measurement systems for radioactive wastes segregation and free release}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {nuclear decommissioning, radioactive waste, free release, clearance level}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.09.043}, stag_bib_extends_levelofaccess = {NA}, author = {Bogucarska, T. and Pedersen, B. and De Felice, P. and Jerome, S. and Arnold, D. and Skala, L. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Tzika, F. and Van Ammel, R.} } @Article { AntonanzasTorresGPLRTHKGU2017, title = {Extensive validation of CM SAF surface radiation products over Europe}, journal = {Remote Sensing of Environment}, year = {2017}, month = {9}, volume = {199}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {171-186}, keywords = {Satellite-based models, Global horizontal irradiance, CM SAF, Solar radiation data, Pyranometer}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0034-4257}, DOI = {10.1016/j.rse.2017.07.013}, stag_bib_extends_levelofaccess = {NA}, author = {Antonanzas-Torres, F. and Gottschalg, R. and Palmer, D. and Lindfors, A. and Riihel{\"a}, A. and Trentmann, J. and Huld, T. and Koubli, E. and Gracia-Amillo, A.M. and Urraca, R.} } @Article { GrigoryevaGUTTKHAWKS2017, subid = {1175}, title = {Thermodynamic Temperature of High-Temperature Fixed Points Traceable to Blackbody Radiation and Synchrotron Radiation}, journal = {International Journal of Thermophysics}, year = {2017}, month = {8}, day = {16}, volume = {38}, number = {10}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, keywords = {Absolute radiometry, Blackbody radiation, Cryogenic substitution radiometer, Filter radiometer, High-temperature fixed points, Irradiance mode, Primary radiation standards, Ratio radiometry, Synchrotron radiation, Thermodynamic temperature}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2273-z}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}hmer, M. and Anhalt, K. and Hollandt, J. and Klein, R. and Taubert, R. D. and Thornagel, R. and Ulm, G. and Gavrilov, V. and Grigoryeva, I. and Khlevnoy, B. and Sapritsky, V.} } @Article { DegiovanniAPRLVTGBCVG2017, subid = {334}, title = {Determining the quantum expectation value by measuring a single photon}, journal = {Nature Physics}, year = {2017}, month = {8}, day = {14}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {4}, keywords = {Protective Measurements, Weak Measurements}, web_url = {https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf;}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/nphys4223}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Rebufello, E. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { StrohMHSSCSLT2017, title = {A low-energy set-up for gamma-ray spectrometry of NORM tailored to the needs of a secondary smelting facility}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, volume = {126}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {296-299}, keywords = {210Pb, 210Po, Metallurgy, Industry, Gamma-ray spectrometry, Naturally occurring radionuclides}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.12.048}, stag_bib_extends_levelofaccess = {NA}, author = {Stroh, H. and Marissens, G. and Hult, M. and Schreurs, S. and Schroeyers, W. and Croymans, T. and Schreurs, I.V. and Lutter, G. and Tzika, F.} } @Article { LodewyckTBEBV2017, subid = {400}, title = {A noise-immune cavity-assisted non-destructive detection for an optical lattice clock in the quantum regime}, journal = {New Journal of Physics}, year = {2017}, month = {8}, volume = {19}, number = {8}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {083002}, keywords = {optical clock, frequency stability, optical lattice clock, non-destructive detection, spin squeezing}, web_url = {http://iopscience.iop.org/1367-2630/19/8/083002}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/aa7c84}, stag_bib_extends_levelofaccess = {NA}, author = {Lodewyck, J. and Targat, R.L. and Bilicki, S. and Eismann, U. and Bookjans, E. and Vallet, G.} } @Article { BoudotdYTCBA2017, title = {High-contrast sub-Doppler absorption spikes in a hot atomic vapor cell exposed to a dual-frequency laser field}, journal = {New Journal of Physics}, year = {2017}, month = {7}, day = {25}, volume = {19}, number = {7}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {073028}, keywords = {Counterpropagating light waves, saturation spectroscopy, dark resonances, diode-lasers; d-1 line, d1 line, d2 line}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/aa7258}, stag_bib_extends_levelofaccess = {NA}, author = {Boudot, R. and de Clercq, E. and Yudin, V. and Taichenachev, A. and Coget, G. and Brazhnikov, D. and Abdel Hafiz, M.} } @Article { HenriksenCST2017, subid = {404}, title = {Dynamics of bad-cavity-enhanced interaction with cold Sr atoms for laser stabilization}, journal = {Physical Review A}, year = {2017}, month = {7}, day = {24}, volume = {96}, number = {1}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {013847}, keywords = {laser stabilisation, atom-cavity dynamics}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.96.013847}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/pdf/1704.08245.pdf}, author = {Sch{\"a}ffer, S. A. and Christensen, B. T. R. and Henriksen, M. R. and Thomsen, J. W.} } @Article { RajteriTF2017, title = {LEDs: Sources and Intrinsically Bandwidth-Limited Detectors}, journal = {Sensors}, year = {2017}, month = {7}, day = {20}, volume = {17}, number = {7}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {1673}, keywords = {LED; light emitting diode; photodetector; radiometer; LED detector}, web_url = {http://www.mdpi.com/1424-8220/17/7/1673}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s17071673}, stag_bib_extends_levelofaccess = {NA}, author = {Rajteri, M. and Taralli, E. and Filippo, R.} } @Article { MasowskiLCCBAPMNNlLKBKMZCPBT2017, subid = {402}, title = {Fibre-optic delivery of time and frequency to VLBI station}, journal = {Astronomy \& Astrophysics}, year = {2017}, month = {7}, volume = {603}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {A48}, keywords = {high angular resolution instrumentation, interferometers}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {EDP Sciences}, language = {30}, ISSN = {0004-6361, 1432-0746}, DOI = {10.1051/0004-6361/201730615}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Buczek, L. and Kołodziej, J. and Lipiński, M. and Śliwczyński, Ł. and Nawrocki, J. and Nogaś, P. and Marecki, A. and Pazderski, E. and Ablewski, P. and Bober, M. and Ciuryło, R. and Cygan, A. and Lisak, D. and Masłowski, P. and Morzyński, P. and Zawada, M. and Campbell, R. M. and Pieczerak, J. and Binczewski, A. and Turza, K.} } @Proceedings { SliwczynskiKBBT2017, subid = {443}, title = {Time and frequency transfer in modern DWDM telecommunication networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/fcs.2017.8088894}, stag_bib_extends_levelofaccess = {NA}, author = {Turza, K. and Binczewski, A. and Bogacki, W. and Krehlik, P. and Śliwczyński, L.} } @Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017, subid = {477}, title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fibre, network, clock, time, dissemination, service}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/FCS.2017.8089004}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Dostal, J. and Radil, J. and Smotlacha, V. and Velc, R. and Vojtech, J. and Campanella, M. and Calonico, D. and Clivati, C. and Levi, F. and Č{\'i}p, O. and Rerucha, S. and Holzwarth, R. and Lessing, M. and Camargo, F. and Desruelle, B. and Lautier-Gaud, J. and English, E.L. and Kronj{\"a}ger, J. and Whibberley, P. and Pottie, P.E. and Tavares, R. and Tuckey, P. and John, F. and Snajder, M. and Stefl, J. and Nogaś, P. and Urbaniak, R. and Binczewski, A. and Bogacki, W. and Turza, K. and Grosche, G. and Schnatz, H. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.} } @Proceedings { LeCoqANDTAALTSLXLP2017, subid = {446}, title = {Frequency comb-assisted QCL stabilization for high resolution molecular spectroscopy}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/FCS.2017.8088928}, stag_bib_extends_levelofaccess = {NA}, author = {Santagata, R. and Tran, D.B.A. and Lopez, O. and Argence, B. and Tokunaga, S.K. and Darqui{\'e}, B. and Amy-Klein, A. and Nicolodi, D. and Abgrall, M. and Le Coq, Y. and Le Targat, R. and Xu, D. and Lee, W.K. and Pottie, P.E.} } @Article { RuhlBTRFUPKHKHU2017, subid = {848}, title = {Enhancing the sensitivity of nano-FTIR spectroscopy}, journal = {Optics Express}, year = {2017}, month = {7}, volume = {25}, number = {14}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {16574}, keywords = {Instrumentation, measurement, and metrology; Near-field microscopy}, web_url = {https://www.osapublishing.org/DirectPDFAccess/158D237A-A0E8-5960-84426107CE1CBCF4_369006/oe-25-14-16574.pdf?da=1\&id=369006\&seq=0\&mobile=no}, misc2 = {EMPIR 2015: Health}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.25.016574}, stag_bib_extends_levelofaccess = {NA}, author = {Hermann, P. and K{\"a}stner, B. and Hoehl, A. and Kashcheyevs, V. and Patoka, P. and Ulrich, G. and Feikes, J. and Ries, M. and Tydecks, T. and Beckhoff, B. and Ruhl, E. and Ulm, G.} } @Article { PoglianoST2017_2, title = {Asynchronous Phase Comparator for Characterization of Devices for PMUs Calibrator}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {6}, volume = {66}, number = {6}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1139-1145}, keywords = {Analog–digital conversion, measurement standards, phase comparators,phasor measurement units (PMUs),resistive voltage dividers (RVDs)}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2648598}, stag_bib_extends_levelofaccess = {NA}, author = {Pogliano, U. and Serazio, D. and Trinchera, B.} } @Article { HerkommerRHSKTRGSTSFGR2017, subid = {412}, title = {Single Quantum Dot with Microlens and 3D-Printed Micro-objective as Integrated Bright Single-Photon Source}, journal = {ACS Photonics}, year = {2017}, month = {6}, volume = {4}, number = {6}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1327-1332}, keywords = {3D direct laser writing; 3D lithography; micro-objective; semiconductor quantum dot; single-photon source}, web_url = {http://pubs.acs.org/doi/ipdf/10.1021/acsphotonics.7b00253}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.7b00253}, stag_bib_extends_levelofaccess = {NA}, author = {Fischbach, S. and Schlehahn, A. and Thoma, A. and Srocka, N. and Gissibl, T. and Ristok, S. and Thiele, S. and Kaganskiy, A. and Strittmatter, A. and Heindel, T. and Rodt, S. and Herkommer, A. and Giessen, H. and Reitzenstein, S.} } @Article { BoothGOVNNFDT2017, title = {Single-Ended Differential Protection in MTDC Networks Using Optical Sensors}, journal = {IEEE Transactions on Power Delivery}, year = {2017}, month = {6}, volume = {32}, number = {3}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {1605-1615}, keywords = {HVDC protection, multi-terminal direct current, modular multi-level converters, optical sensors.}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-8977, 1937-4208}, DOI = {10.1109/TPWRD.2016.2645231}, stag_bib_extends_levelofaccess = {NA}, author = {Booth, C.D. and Gordon, N. and Orr, P. and Vozikis, D. and Niewczas, P. and Nelson, J. and Fusiek, G. and Dysko, A. and Tzelepis, D.} } @Proceedings { BurgerTMC2017, subid = {851}, title = {Modelling of standard and specialty fibre-based systems using finite element methods}, journal = {Proc. SPIE}, year = {2017}, month = {5}, day = {17}, volume = {10683}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1068336}, keywords = {Finite element modelling, modal distribution, specialty fibres}, web_url = {http://arxiv.org/abs/1807.10811}, misc2 = {EMPIR 2014: Industry}, event_place = {Strasbourg}, event_name = {Fiber Lasers and Glass Photonics: Materials through Applications}, event_date = {22-04-2018 to 26-04-2018}, language = {30}, DOI = {10.1117/12.2307372}, stag_bib_extends_levelofaccess = {NA}, author = {Castagna, N. and Morel, J. and Testa, L. and Burger, S.} } @Article { CarmeleRBSSSGSSvTHKR2017, subid = {234}, title = {A bright triggered twin-photon source in the solid state}, journal = {Nature Communications}, year = {2017}, month = {4}, volume = {8}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {14870}, keywords = {Quantum dots, Quantum optics, Single photons and quantum effects .}, web_url = {https://www.nature.com/articles/ncomms14870}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms14870}, stag_bib_extends_levelofaccess = {NA}, author = {Heindel, T. and Thoma, A. and von Helversen, M. and Schmidt, M. and Schlehahn, A. and Gschrey, M. and Schnauber, P. and Schulze, J. -H. and Strittmatter, A. and Beyer, J. and Rodt, S. and Carmele, A. and Knorr, A. and Reitzenstein, S.} } @Article { HusainLTYBSSTKFH2017, subid = {30}, title = {Single Carrier Trapping and De-trapping in Scaled Silicon Complementary Metal-Oxide-Semiconductor Field-Effect Transistors at Low Temperatures}, journal = {Semiconductor Science and Technology}, year = {2017}, month = {3}, day = {24}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Coulomb blockade, MOSFETs, Carrier Trapping and De-trapping, quantum dots}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0268-1242, 1361-6641}, DOI = {10.1088/1361-6641/aa6910}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Zuo and Husain, Muhammad and Yoshimoto, Hiroyuki and Tani, Kazuki and Sasago, Yoshitaka and Hisamoto, Digh and Fletcher, Jonathan and Kataoka, Masaya and Tsuchiya, Yoshishige and Saito, Shinichi} } @Article { MottonenVPTGKL2017, title = {Microwave Admittance of Gold-Palladium Nanowires with Proximity-Induced Superconductivity}, journal = {Advanced Electronic Materials}, year = {2017}, month = {3}, volume = {3}, number = {6}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {1600227}, keywords = {proximity Josephson junction, microwave admittance}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/aelm.201600227/abstract}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {2199-160X}, DOI = {10.1002/aelm.201600227}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"o}tt{\"o}nen, M. and Virtanen, P. and Partanen, M. and Tan, K.Y. and Govenius, J. and Kokkoniemi, R. and Lake, R.E.} } @Proceedings { LiSLHZYTSHTFKS2017, subid = {1123}, title = {Random-telegraph-noise by resonant tunnelling at low temperatures}, journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, year = {2017}, month = {2}, day = {28}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Random-telegraph-noise, charge trap, low temperatures}, web_url = {https://eprints.soton.ac.uk/418401/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Toyama}, event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, event_date = {28-02-2017 to 02-03-2017}, language = {30}, DOI = {10.1109/EDTM.2017.7947569}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Zeimpekis, I. and Yoshimoto, H. and Tani, K. and Sasago, Y. and Hisamoto, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.} } @Proceedings { LiSBFKHTLS2017, subid = {1124}, title = {Transport properties in silicon nanowire transistors with atomically flat interfaces}, journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, year = {2017}, month = {2}, day = {28}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {narrow channel effect, silicon nanowire, SOI, TMAH, self-limiting oxidation}, web_url = {https://eprints.soton.ac.uk/402316/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Toyama}, event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, event_date = {28-02-2017 to 02-03-2017}, language = {30}, DOI = {10.1109/EDTM.2017.7947561}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, F. and Husain, M.K. and Li, Z. and Sotto, M.S.H. and Burt, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.} } @Article { IbraimETZHHHM2017, title = {Tracking nitrous oxide emission processes at a suburban site with semicontinuous, in situ measurements of isotopic composition}, journal = {Journal of Geophysical Research: Atmospheres}, year = {2017}, month = {2}, volume = {122}, number = {3}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {1850-1870}, keywords = {nitrous oxide, isotopic composition}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {2169-897X}, DOI = {10.1002/2016JD025906}, stag_bib_extends_levelofaccess = {NA}, author = {Ibraim, E. and Emmenegger, L. and Tuzson, B. and Zellweger, C. and H{\"u}glin, C. and Henne, S. and Harris, E. and Mohn, J.} } @Article { deClercqGBFMCTY2017, title = {High-Performance Coherent Population Trapping Clock with Polarization Modulation}, journal = {Physical Review Applied}, year = {2017}, month = {1}, day = {25}, volume = {7}, number = {1}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, keywords = {Frequency standards, atomic clock, ramsey fringes, dark-line, vapor, laser spectroscopy}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.7.014018}, stag_bib_extends_levelofaccess = {NA}, author = {de Clercq, E. and Gu{\'e}randel, S. and Boudot, R. and Fran\c{c}ois, B. and Micalizio, S. and Calosso, C.E. and Tricot, F. and Yun, P.} } @Article { CalonicoLCCMBRTP2017, subid = {111}, title = {Absolute frequency measurement of the 1S0 – 3P0 transition of 171Yb}, journal = {Metrologia}, year = {2017}, month = {1}, day = {20}, volume = {54}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {102-112}, keywords = {optical lattice clock, SI second, frequency metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa4e62}, stag_bib_extends_levelofaccess = {NA}, author = {Pizzocaro, M and Thoumany, P and Rauf, B and Bregolin, F and Milani, G and Clivati, C and Costanzo, G.A. and Levi, F and Calonico, D} } @Article { , title = {Spectroscopic thermometry for long-distance surveying}, journal = {Applied Optics}, year = {2017}, month = {1}, day = {6}, volume = {56}, number = {2}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {239-246}, keywords = {long-distance surveying, laser absorption spectroscopy, refractive index compensation}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-56-2-239}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {OSA Publishing}, address = {Washington}, language = {30}, ISSN = {1559-128X (print), 2155-3165 (online)}, DOI = {10.1364/AO.56.000239}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tomberg, T. and Fordell, T. and Jokela, J. and Merimaa, M. and Hieta, T.} } @Article { TengenN2017, title = {Uncertainty assessment in geodetic network adjustment by combining GUM and Monte-Carlo-simulations}, journal = {Journal of Applied Geodesy}, year = {2017}, month = {1}, volume = {11}, number = {2}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {GUM Analysis, Geodetic Network Adjustment, Quality Assessment, Monte-Carlo Simulations, Local Tie}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {1862-9024, 1862-9016}, DOI = {10.1515/jag-2016-0017}, stag_bib_extends_levelofaccess = {NA}, author = {Tengen, D. and Niemeier, W.} } @Article { SchubertHSMTGW2017, title = {Angle Dependence of Solar Cells and Modules: The Role of Cell Texturization}, journal = {IEEE Journal of Photovoltaics}, year = {2017}, month = {1}, volume = {7}, number = {1}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {19-24}, keywords = {photovoltaic}, web_url = {http://ieeexplore.ieee.org/document/7600397/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2614120}, stag_bib_extends_levelofaccess = {NA}, author = {Schubert, M.C. and Hohl-Ebinger, J. and Steinkemper, H. and Muller, B. and Tucher, N. and Geisemeyer, I. and Warta, W.} } @Proceedings { PokatilovPNETLICDYNPVTC2017_2, subid = {1152}, title = {EMPIR project TracePQM: Traceability routes for electrical power quality measurements}, journal = {18th International Congress of Metrology}, year = {2017}, number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements}, pages = {8}, keywords = {power quality; metrology; power; traceability; measurement}, misc2 = {EMPIR 2015: Research Potential}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {18th International Congress of Metrology}, event_date = {19-09-2017 to 21-09-2017}, language = {30}, DOI = {10.1051/metrology/201704001}, stag_bib_extends_levelofaccess = {NA}, author = {Nov{\'a}kov{\'a} Zachovalov{\'a}, V. and Yovcheva, A. and Diaz de Aguilar, J. and Caballero Santos, R. and Ilić, D. and Lončarević, J. and Trinchera, B. and Ellingsberg, K. and Ndilimabaka, H. and Philominraj, A. and Pokatilov, A. and Power, O. and Voljc, B. and Tarasso, V. and \c{C}aycı, H.} } @Proceedings { RoskeTL2017, title = {Practical applications of an enhanced uncertainty model for build-up systems}, journal = {IMEKO-TC3-2017}, year = {2017}, number2 = {SIB63: Force: Force traceability within the meganewton range}, keywords = {Transfer standard, force measurement, buildup system}, web_url = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-012.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Helsinki Finland}, event_name = {IMEKO 23rd TC3, 13th TC5 and 4th TC22 International Conference}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-012.pdf}, author = {R{\"o}ske, D. and Tegtmeier, F. and Lang, W.} } @Article { BuismanTGF2017_2, subid = {813}, title = {Vector-corrected nonlinear multi-port IQ-mixer characterization using modulated signals}, journal = {IEEE}, year = {2017}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Microwave measurement, Nonlinear distortion, Mixers, Frequency-domain analysis, Time-domain analysis}, web_url = {https://research.chalmers.se/publication/248288/file/248288_Fulltext.pdf}, misc2 = {EMPIR 2014: Industry}, language = {30}, DOI = {10.1109/MWSYM.2017.8058888}, stag_bib_extends_levelofaccess = {NA}, author = {Gustafsson, S. and Thorsell, M. and Buisman, K. and Fager, C.} } @Article { GenoveseBYTDM2016, subid = {233}, title = {Quantifying backflash radiation to prevent zero-error attacks in quantum key distribution}, journal = {Light: Science \& Applications}, year = {2016}, month = {12}, volume = {6}, number = {6}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {e16261}, keywords = {Backflash, Quantum Key Distribution, Single-photon avalanche diode, Zero-error attack}, web_url = {http://www.nature.com/lsa/journal/v6/n6/full/lsa2016261a.html}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/lsa.2016.261}, stag_bib_extends_levelofaccess = {NA}, author = {Meda, A. and Degiovanni, I.P. and Tosi, A. and Yuan, Z. and Brida, G. and Genovese, M.} } @Article { VandervorstDPFLTHVBTFCS2016, subid = {158}, title = {Understanding Physico-Chemical Aspects in the Depth Profiling of Polymer:Fullerene Layers}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {12}, volume = {120}, number = {49}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {28074-28082}, keywords = {ToF-SIMS, GCIB, Ar cluster, quantification, depth profiling, organics, solar cells, polymer, fullerenes}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b09911}, stag_bib_extends_levelofaccess = {NA}, author = {Surana, S. and Conard, T. and Fleischmann, C. and Tait, J.G. and Bastos, J.P. and Voroshazi, E. and Havelund, R. and Turbiez, M. and Louette, P. and Felten, A. and Poleunis, C. and Delcorte, A. and Vandervorst, W.} } @Article { GorenBTZSMPRFAF2016, title = {Towards tributyltin quantification in natural water at the Environmental Quality Standard level required by the Water Framework Directive}, journal = {Talanta}, year = {2016}, month = {11}, volume = {160}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {499-511}, keywords = {ICP-MS, Isotope Dilution, Limit of quantification, Metrological traceability, Tributyltin, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0039-9140}, DOI = {10.1016/j.talanta.2016.07.056}, stag_bib_extends_levelofaccess = {NA}, author = {Goren, A.C. and B{\'i}lsel, M. and Tun\c{c}, M. and Zuliani, T. and Sčančar, J. and Milačič, R. and Philipp, R. and Richter, J. and Fettig, I. and Alasonati, E. and Fisicaro, P.} } @Article { YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016, subid = {321}, title = {Versailles Project on Advanced Materials and Standards Interlaboratory Study on Measuring the Thickness and Chemistry of Nanoparticle Coatings Using XPS and LEIS}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {10}, day = {27}, volume = {120}, number = {42}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {24070-24079}, keywords = {VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory}, web_url = {https://spiral.imperial.ac.uk/handle/10044/1/40824}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b06713}, stag_bib_extends_levelofaccess = {NA}, author = {Belsey, N.A. and Cant, D. and Cant, D.J.H. and Minelli, C. and Araujo, J.R. and Bock, B. and Br{\"u}ner, P. and Castner, D.G. and Ceccone, G. and Counsell, J.D.P. and Dietrich, P.M. and Engelhard, M.H. and Fearn, S. and Galhardo, C.E. and Kalbe, H. and Kim, J.W. and Lartundo-Rojas, L. and Luftman, H.S. and Nunney, T.S. and Pseiner, J. and Smith, E.F. and Spampinato, V. and Sturm, J.M. and Thomas, A.G. and Treacy, J.P.W. and Veith, L. and Wagstaffe, M. and Wang, H. and Wang, M. and Wang, Y.C. and Werner, W. and Yang, L.} } @Article { VilllaLCDBGLAPTZG2016, subid = {231}, title = {Measuring Incompatible Observables by Exploiting Sequential Weak Values}, journal = {Physical Review Letters}, year = {2016}, month = {10}, day = {20}, volume = {117}, number = {17}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {170402}, keywords = {Weak Measurements, Optical tests of quantum theory, Weak Values}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.170402}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.117.170402}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Levi, M. P. and Gramegna, M. and Brida, G. and Degiovanni, I. P. and Cohen, E. and Lussana, R. and Villa, F. and Tosi, A. and Zappa, F. and Genovese, M.} } @Article { YoshidaWDKLSGIHTGMB2016, title = {Reassessment of the NH4NO3thermal decomposition technique for calibration of the N2O isotopic composition}, journal = {Rapid Communications in Mass Spectrometry}, year = {2016}, month = {10}, day = {20}, volume = {30}, number = {23}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2487-2496}, keywords = {thermal decomposition, isotopic composition}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0951-4198}, DOI = {10.1002/rcm.7736}, stag_bib_extends_levelofaccess = {NA}, author = {Yoshida, N. and Werner, R.A. and Decock, C. and Kuhn, T. and Lehmann, M.F. and Schleppi, P. and Geilmann, H. and Ibraim, E. and Harris, E. and Toyoda, S. and Gutjahr, W. and Mohn, J. and Brand, W.A.} } @Article { BrabanCEFBLPHTPMPVWvTNP2016, title = {A metrological approach to improve accuracy and reliability of ammonia measurements in ambient air}, journal = {Measurement Science and Technology}, year = {2016}, month = {10}, volume = {27}, number = {11}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {115012}, keywords = {ammonia in ambient air, traceability, reference gas standards, optical transfer standard, validation and testing infrastructure}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, address = {Bristol, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/27/11/115012}, stag_bib_extends_levelofaccess = {NA}, author = {Braban, Christine F and Cassidy, Nathan and Ebert, Volker and Ferracci, Valerio and Balslev-Harder, David and Leuenberger, Daiana and Pascale, C{\'e}line and Hieta, Tuomas and Tiebe, Carlo and Peltola, Jari and Martin, Nicholas A and Persijn, Stefan and Vaittinen, Olavi and Wirtz, Klaus and van Wijk, Janneke and Twigg, Marsailidh M and Niederhauser, Bernhard and Pog{\'a}ny, Andrea} } @Article { CobbenNNT2016, title = {Application of non-intrusive polynomial chaos expansion in probabilistic power flow with truncated random variables}, journal = {2016 International Conference on Probabilistic Methods Applied to Power Systems (PMAPS)}, year = {2016}, month = {10}, number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics}, keywords = {ordinary least squares, Uncertainty quantification, Probabilistic power flow, Polynomial chaos expansion, Truncated Normal distribution}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, DOI = {10.1109/PMAPS.2016.7764175}, stag_bib_extends_levelofaccess = {NA}, author = {Cobben, J. F. G. and Nguyen, P. H. and Ni, F. and Tang, J.} } @Article { DeLeoCVSMTFB2016, subid = {161}, title = {4-Nitrobenzene Grafted in Porous Silicon: Application to Optical Lithography}, journal = {Nanoscale Research Letters}, year = {2016}, month = {9}, day = {29}, volume = {11}, number = {436}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {1-10}, keywords = {Porous silicon, Optical lithography, 4-Nitrobenzenediazonium, grafting, Improved chemical resistance}, web_url = {https://nanoscalereslett.springeropen.com/articles/10.1186/s11671-016-1654-8}, misc2 = {EMPIR 2014: Industry}, publisher = {SpringerOpen}, address = {London}, language = {30}, ISSN = {1556-276X}, DOI = {10.1186/s11671-016-1654-8}, stag_bib_extends_levelofaccess = {NA}, author = {Tiddia, M.V. and Mula, G. and Sechi, E. and Vacca, A. and Cara, E. and De Leo, N. and Fretto, M. and Boarino, L.} } @Article { MartiUGKKTD2016, title = {Experimental determination of the effective attenuation length of palladium 3d 5/2 photoelectrons in a magnetron sputtered Pd nanolayer}, journal = {Surface and Interface Analysis}, year = {2016}, month = {9}, day = {15}, volume = {49}, number = {5}, number2 = {IND15: SurfChem: Traceable quantitative surface chemical analysis for industrial applications}, pages = {464-468}, keywords = {XPS, electron effective attenuation length, Pd 3d}, web_url = {https://onlinelibrary.wiley.com/doi/abs/10.1002/sia.6141}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.6141}, stag_bib_extends_levelofaccess = {NA}, author = {Marti, K. and Unger, W.E.S. and Gross, T. and Krumrey, M. and Kalbe, H. and Treu, D. and Dietrich, P.M.} } @Proceedings { , title = {Proficiency Testing for Conducted Immunity with a new Round Robin Test Device}, journal = {International Symposium and Exhibition on Electromagnetic Compatibility Proceedings}, year = {2016}, month = {9}, day = {10}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-100}, keywords = {Electromagnetic Compatibility (EMC), IEC 61000- 4-6, EN ISO 17025, EN ISO 17043, proficiency testing, round robin, test device, conducted immunity, common mode, disturbance signal, Coupling-Decoupling Network (CDN), inter-laboratory comparison, Equipment under Test (EUT), Auxiliary Equipment (AE).}, web_url = {http://www.emceurope.org/2016/index.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Wroclaw / Poland}, event_name = {EMC Europe 2016 Wroclaw International Symposium and Exhibition on Electromagnetic Compatibility}, event_date = {05-09-2016 to 09-09-2016}, language = {30}, ISBN = {978-1-4799-6615-8}, ISSN = {2158-110X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tas, Emrah and Cakir, Soydan and Cetintas, Mustafa and Hamouz, Pavel and Isbring, Thomas and Kokalj, Miha and Lopez, Daniel and Lundgren, Urban and Mandaris, Dwi and Pinter, Borut and Poriz, Martin and Pous, Marc and Pythoud, Fr{\'e}d{\'e}ric and Sen, Osman and Silva, Ferran and Svaboda, Marek and Trincaz, Braise and Zhao, Dongsheng} } @Proceedings { , title = {GTEM cell as an alternative method for radiated immunity tests: A comparison with an anechoic chamber}, journal = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, year = {2016}, month = {9}, day = {9}, volume = {2016}, number = {2016}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {251-256}, keywords = {Alternative Test Methods, EMC, GTEM cell, Anechoich chamber, radiated immunity}, web_url = {http://ieeexplore.ieee.org/document/7739215/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Wroclaw}, event_name = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, event_date = {05-09-2016 to 09-09-2016}, language = {30}, ISBN = {978-1-5090-1416-3}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2016.7739215}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SALHI, Mohammed and \c{C}akır, Soydan and \c{C}ınar, Mehmet and TEKTAŞ, Bahadır and \c{C}etintaş, Mustafa} } @Proceedings { , title = {Improvements in alternative radiated emission test methods with surface wire}, journal = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, year = {2016}, month = {9}, day = {9}, volume = {2016}, number = {2016}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {799-804}, keywords = {Surface Wire, Alternative, Emission, On-Site, Radiated}, web_url = {http://ieeexplore.ieee.org/document/7739212/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Wroclaw}, event_name = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, event_date = {05-09-2016 to 09-09-2016}, language = {30}, ISBN = {-}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2016.7739212}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {TEKTAŞ, Bahadır and Şen, Osman and \c{C}akır, Soydan and \c{C}etintaş, Mustafa} } @Proceedings { , title = {Methodology for testing a parameter-free fault locator for transmission lines}, journal = {Electric Power Systems Research}, year = {2016}, month = {9}, day = {1}, volume = {138}, number = {n/a}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {92 - 98}, keywords = {Fault location; Line parameters; ATPDraw; Parameter-free; Transmission line; Protection}, web_url = {http://www.sciencedirect.com/science/article/pii/S037877961630013X}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elesvier}, address = {Amsterdam}, event_place = {Cavtat, Croatia,}, event_name = {Special Issue: Papers from the 11th International Conference on Power Systems Transients (IPST)}, event_date = {15-06-2015 to ‐18-6-2015}, language = {30}, ISBN = {n/a}, ISSN = {N/A}, DOI = {10.1016/j.epsr.2016.02.007}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-9-1}, author = {Popov, M and Parmar, S and Rietveld, G and Preston, G and Radojevic, Z and Terzija, V} } @Article { TsaidPA2016, title = {Tuneable on-demand single-photon source in the microwave range}, journal = {Nature Communications}, year = {2016}, month = {8}, day = {22}, volume = {7}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {12588}, keywords = {Microwave photonics, Quantum information, Single photons and quantum effects}, web_url = {http://www.nature.com/articles/ncomms12588}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms12588}, stag_bib_extends_levelofaccess = {NA}, author = {Tsai, J. S. and de Graaf, S. E. and Peng, Z. H. and Astafiev, O. V.} } @Proceedings { , title = {Characterization of HMDS treated CVD Graphene}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {16}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Chemical vapor deposition (CVD), Hexame-thyldisilazane (HMDS), Copper (Cu), CVD graphene (CVDG)}, web_url = {http://ieeexplore.ieee.org/document/7540498/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540498}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Thodkar, K. and Sch{\"o}nenberger, C. and Calame, M. and L{\"u}{\"o}nd, F. and Overney, F. and Jeanneret, B.} } @Proceedings { , title = {Fabrication of graphene quantum Hall resistance standard in a cryogen-freee table-top system}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Epitaxial layers, Graphene, measurement standards, microfabrication, quantum hall effect}, web_url = {http://ieeexplore.ieee.org/document/7540516/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540516}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {He, H. and Janssen, T.J.B.M. and Rozhko, S. and Tzalenchuk, A. and Lara-Avila, S. and Yakimova, R. and Kubatkin, S.} } @Proceedings { , title = {Towards a cryogen-free table-top primary resistance standard}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {quantum Hall effect, graphene, primary resistance metrology, cryogenic current comparators.}, web_url = {http://ieeexplore.ieee.org/document/7540654/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540654}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Rhozhko, S. and Williams, J.M. and Ireland, J. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Tzalenchuk, A.} } @Article { SvecSSRPNMLKJGFFDMAHBTTVW2016_2, title = {60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {8}, volume = {114}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {167-172}, keywords = {Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.05.014}, stag_bib_extends_levelofaccess = {NA}, author = {Svec, A. and Solc, J. and Silva, L. and Reis, M. and Peyres, V. and Nečemer, M. and Moser, H. and Luca, A. and Klemola, S. and Javornik, A. and Garc{\'i}a-Tora{\~n}o, E. and Ferreux, L.. and Fazio, A. and Dry{\'a}k, P. and Marroyo, B.C. and Arnold, D. and Hult, M. and Burda, O. and Tzika, F. and Tyminski, Z. and Vodenik, B. and W{\"a}tjen, U.} } @Article { , title = {Giant quantum Hall plateaus generated by charge transfer in epitaxial graphene}, journal = {Nature: Scientific Reports}, year = {2016}, month = {7}, day = {26}, volume = {6}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {30296}, keywords = {graphene, measurement, QHE,}, web_url = {http://www.nature.com/articles/srep30296?WT.feed_name=subjects_physical-sciences}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Scientific reports}, language = {30}, DOI = {10.1038/srep30296}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Alexander-Webber, J.A. and Huang, J. and Maude, D.K. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.} } @Article { MottonenTLG2016, title = {Detection of Zeptojoule Microwave Pulses Using Electrothermal Feedback in Proximity-Induced Josephson Junctions}, journal = {Physical Review Letters}, year = {2016}, month = {7}, day = {15}, volume = {117}, number = {3}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {030802}, keywords = {microwave detector}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.030802}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.117.030802}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"o}tt{\"o}nen, M. and Tan, K. Y. and Lake, R. E. and Govenius, J.} } @Article { , title = {High resolution kilometric range optical telemetry in air by radio frequency phase measurement}, journal = {Review of Scientific Instruments}, year = {2016}, month = {7}, day = {12}, volume = {87}, number = {2016}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {075101}, keywords = {telemeter, ADM, laser tracker}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/87/7/10.1063/1.4954180}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.4954180}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Guillory, J. and Šm{\'i}d, R. and Garcia-M{\'a}rquez, J. and Truong, D. and Alexandre, C. and Wallerand, J.-P.} } @Article { MerimaaWWMJGKNTLHLGP2016, title = {Frequency Comparison of171Yb+Ion Optical Clocks at PTB and NPL via GPS PPP}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2016}, month = {7}, volume = {63}, number = {7}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {981-985}, keywords = {Frequency transfer, GPS precise point positioning (PPP), optical clock}, web_url = {https://ieeexplore.ieee.org/document/7398135/keywords}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2016.2524988}, stag_bib_extends_levelofaccess = {NA}, author = {Merimaa, M. and Wallin, A. and Whibberley, P. B. and Margolis, H. S. and Jones, J. M. and Godun, R. M. and King, S. A. and Nisbet-Jones, P. B. R. and Tamm, C. and Lipphardt, B. and Huntemann, N. and Leute, J. and Gill, P. and Peik, E.} } @Article { KielerMNBO2016, title = {Packaging of fiber-coupled module for Josephson junction array voltage standards}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, keywords = {Optical fibers, Photodiodes, Silicon, Cryogenics, Bonding, Stress, Flip-chip devices}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, DOI = {10.1109/CPEM.2016.7540561}, stag_bib_extends_levelofaccess = {NA}, author = {Kieler, O. and Malmbekk, H. and Tuan Nguyen, T.A. and Bardalen, E. and Ohlckers, P.} } @Article { , title = {Decoy-state quantum key distribution with a leaky source}, journal = {New Journal of Physics}, year = {2016}, month = {6}, day = {20}, volume = {18}, number = {June 2016}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {065008}, keywords = {quantum key distribution, device-independent quantum key distribution, quantum communication, security analysis, information leakage, Trojan horse attacks}, web_url = {http://iopscience.iop.org/journal/1367-2630}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, address = {Bristol (UK)}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/18/6/065008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Tamaki, K. and Curty, M. and Lucamarini, M.} } @Article { , title = {Novel multi-feature bar design for machine tools geometric errors identification}, journal = {Precision Engineering}, year = {2016}, month = {6}, day = {18}, volume = {46}, number = {--}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {323–338}, keywords = {New material standard, Reversal technique, Calibration, Geometric errors, Machine tools}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier Inc.}, address = {Elsevier Inc.}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2016.06.002}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Viprey, FB and Nouira, HN and Lavernhe, SL and Tournier, CT} } @Proceedings { OliveiraNKRVNHHT2016, title = {Geometric and Reflectance Signature Characterization of Complex Canopies using Hyperspectral Stereoscopic Images from UAV and Terrestrial Platforms}, journal = {ISPRS - International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences}, year = {2016}, month = {6}, day = {17}, volume = {XLI-B7}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {77-82}, keywords = {Hyperspectral, Radiometry, Photogrammetry, Geometry, Matching, Uncertainty}, web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B7/77/2016/isprs-archives-XLI-B7-77-2016.pdf}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, address = {Gottingen}, event_place = {Prague, Czech Republic}, event_name = {XXIII ISPRS Congress}, event_date = {12-07-2016 to 19-07-2016}, language = {30}, ISSN = {2194-9034}, DOI = {10.5194/isprsarchives-XLI-B7-77-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Oliveira, R. and N{\"a}si, R. and Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Nevalainen, O. and Hakala, T. and Honkavaara, E. and Tommaselli, A.} } @Article { , title = {Alternative radiated emission measurements at close distance in industry}, journal = {International Journal of RF and Microwave Computer-Aided Engineering}, year = {2016}, month = {5}, day = {31}, volume = {26}, number = {4}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {294-303}, keywords = {Alternative; close distance; emission; on-site; radiated}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/mmce.20977/epdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wiley Online Library}, address = {USA}, language = {30}, ISSN = {-}, DOI = {10.1002/mmce.20977}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Şen, Osman and TEKTAŞ, Bahadır and \c{C}akır, Soydan and \c{C}etintaş, Mustafa} } @Article { , title = {Fundamentals of multiplexing with digital PCR}, journal = {Biomolecular Detection and Quantification}, year = {2016}, month = {5}, day = {27}, volume = {10}, number = {Special issue on dPCR}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {15-23}, keywords = {dPCR, Digital PCR, Duplex, Higher order multiplexing, Multiplexing}, web_url = {http://www.sciencedirect.com/science/article/pii/S2214753516300092}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {2214-7535}, DOI = {10.1016/j.bdq.2016.05.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S2214753516300092}, author = {Whale, AS and Huggett, JF and Tzonev, S} } @Article { , title = {State of the Art of Tactile Micro Coordinate Metrology}, journal = {Appied Sciences}, year = {2016}, month = {5}, day = {16}, volume = {6}, number = {150}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, pages = {1-13}, keywords = {micro coordinate metrology, tactile probe, calibration, performance verification}, web_url = {http://www.mdpi.com/2076-3417/6/5/150}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {MDPI AG}, address = {Basel}, language = {30}, ISSN = {ISSN 2076-3417}, DOI = {10.3390/app6050150}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Thalmann, R. and Meli, F. and K{\"u}ng, A.} } @Article { ZappaTVLLAPGBDG2016, subid = {232}, title = {Experiment Investigating the Connection between Weak Values and Contextuality}, journal = {Physical Review Letters}, year = {2016}, month = {5}, volume = {116}, number = {18}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {180401}, keywords = {Quantum Foundations, Quantum Nonlocality, Weak Values, Weak Measurements}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.116.180401}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Levi, M. P. and Lussana, R. and Villa, F. and Tosi, A. and Zappa, F. and Gramegna, M. and Brida, G. and Degiovanni, I. P. and Genovese, M.} } @Article { , title = {Towards joint reconstruction of noise and losses in quantum channels}, journal = {Quantum Measurements and Quantum Metrology}, year = {2016}, month = {4}, day = {21}, volume = {3}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {27–31}, keywords = {Quantum Communication, Quantum Metrology, Calibration}, web_url = {https://www.degruyter.com/view/j/qmetro}, misc2 = {EMPIR 2014: Industry}, publisher = {DE GRUYTER OPEN}, address = {Warsaw (Poland)}, language = {30}, ISSN = {2299-114X}, DOI = {10.1515/qmetro-2016-0005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.degruyter.com/downloadpdf/j/qmetro.2016.3.issue-1/qmetro-2016-0005/qmetro-2016-0005.pdf}, author = {Piacentini, F. and Avella, A. and Traina, P. and Lolli, L. and Taralli, E. and Monticone, E. and Rajteri, M. and Fukuda, D. and Degiovanni, I. P. and Brida, G.} } @Proceedings { , title = {JRP SIB60 “Metrology for Long Distance Surveying”-a concise survey on major project results}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {March 30-April 1, 2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pollinger, F. and Bauch, A. and Leute, J. and Meiners-Hagen, K. and Mildner, J. and Guillory, J. and Wallerand, J.-P. and Jokela, J. and Kallio, U. and Koivula, H. and Lahtinen, S. and Poutanen, M. and Astrua, M. and Francese, C. and Zucco, M. and Eusebio, L. and Marques, F. and Pires, C. and Saraiva, F. and Pelligrino, O. and Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M. and Kupko, V. and Neyezhmakov, P. and Bergstrand, S. and van den Berg, S.A. and Kersten, T. and Krawinkel, T.} } @Proceedings { , title = {Spectroscopic Inline Thermometry}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {Submission 69}, keywords = {EMRP JRP SIB60 Surveying, refractive index of air, air temperature, laser spectroscopy}, web_url = {www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_69.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {FIG}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {30-03-2016 to 01-04-2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_69.pdf}, author = {Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M.} } @Proceedings { , title = {Towards Kilometric Distance Measurements with Air Refractive Index Compensation}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {Submission 27}, keywords = {Kilometric distance, optical telemetry, two-wavelength telemetry, absolute distance meter.}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {FIG}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {30-03-2016 to 01-04-2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf}, author = {Guillory, J. and Wallerand, J.-P. and Truong, D. and Šm{\'i}d, R. and Alexandre, C.} } @Article { , title = {Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150044}, keywords = {high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150044}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0044}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wooliams, E.R and Anhalt, K and Ballico, M and Bloembergen, P and Bourson, F and Briaudeau, S and Campos, J and Cox, M.G and del Campo, D and Dong, W and Dury, M.R and Gavrilov, V and Grigoryeva, I and Hernanz, M.L and Jahan, F and Khlevnoy, B and Khromchenko, V and Lowe, D.H and Lu, X and Machin, G and Mantilla, J.M and Martin, M.J and McEvoy, H.C and Rougie, B and Saldi, M and Salim, S.G.R and Sasajima, N and Taubert, D.R and Todd, A.D.W and Van den Bossche, R} } @Article { , title = {DABAM: an open-source database of x-ray mirrors metrology}, journal = {Journal of Synchrotron Radiation}, year = {2016}, month = {3}, day = {24}, volume = {23}, number = {23}, number2 = {SIB58: Angles: Angle metrology}, pages = {665-678}, keywords = {X-ray mirror; metrology; database; Python; statistics.}, web_url = {http://scripts.iucr.org/cgi-bin/paper?S1600577516005014}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IUCr Journals}, address = {Chester CH1 2HU, England}, language = {30}, ISSN = {1600-5775}, DOI = {10.1107/S1600577516005014}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sanchez del Rio, M and Bianchi, D and Cocco, D and Glass, M and Idir, M and Metz, J and Raimondi, L and Rebuffi, L and Reininger, R and Shi, X and Siewert, F and Spielmann-Jaeggi, S and Takacs, P and Tomasset, M and Tonnessen, T and Tonnessenivo, A and Yashchuk, VV} } @Article { NadvornikNSNNOJTKWJ2016, title = {Long-range and high-speed electronic spin-transport at a GaAs/AlGaAs semiconductor interface}, journal = {Scientific Reports}, year = {2016}, month = {3}, day = {16}, volume = {6}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {22901}, keywords = {Long-range and high-speed electronic spin-transport at a GaAs/AlGaAs semiconductor interface}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Nature}, address = {233 Spring St., New York NY 10013, USA}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep22901}, stag_bib_extends_levelofaccess = {NA}, author = {N{\'a}dvorn{\'i}k, L. and Němec, P. and Skoromets, V. and Němec, H. and Nov{\'a}k, V. and Olejn{\'i}k, K. and Janda, T. and Troj{\'a}nek, F. and Kužel, P. and Wunderlich, J. and Jungwirth, T.} } @Article { KovarSLTMSHSS2016, title = {Distribution of radionuclides in an iron calibration standard for a free release measurement facility}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {96-100}, keywords = {246 kg reference standard, free release measurement facility, Distribution of radionuclides, iron calibration}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804315302396}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.11.010}, stag_bib_extends_levelofaccess = {NA}, author = {Kov{\'a}ř, P. and Šur{\'a}ň, J. and Lutter, G. and Tzika, F. and Marissens, G. and Stroh, H. and Hult, M. and Skala, L. and Sud, J.} } @Article { , title = {The kelvin redefinition and its mise en pratique}, journal = {Phiolosophical Transactions of the Royal Society A}, year = {2016}, month = {2}, day = {22}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150037}, keywords = {International System of Units, kelvin, mise en pratique, temperature, temperature scale, thermodynamic temperature}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150037}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1098/rsta.2015.0037}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Fellmuth, B and Fischer, J and Machin, G and Picard, S and Steur, P.P.M and Tamura, O and White, D.R and Yoon, H} } @Thesis { , title = {Laser-Based Thermometry over Long Distances}, year = {2016}, month = {2}, day = {15}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {temperature, thermometry, spectroscopy, refractive index of air}, web_url = {http://urn.fi/URN:NBN:fi:aalto-201603291512}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, school = {Aalto University School of Electrical Engineering}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Tomberg, T.} } @Article { , title = {A deep etching mechanism for trenchbridging silicon nanowires}, journal = {Nanotechnology}, year = {2016}, month = {2}, day = {8}, volume = {27 (2016) 095303}, number = {2016}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {8 pp}, keywords = {silicon nanowire, deep reactive ion etching, transmission electron microscopy, MEMS \& NEMS}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing Ltd.}, address = {London}, language = {30}, DOI = {10.1088/0957-4484/27/9/095303}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tasdemir, Z. and Wollschl{\"a}ger, N. and {\"O}sterle, W. and Leblebici, Y. and Erdem Alaca, B.} } @Article { , title = {Traceable atomic force microscopy of high-quality solvent-free crystals of [6,6]-phenyl-C61-butyric acid methyl ester}, journal = {Appliced Physics Letters}, year = {2016}, month = {2}, day = {4}, volume = {108}, number = {(2016)}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {053303}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.4941227}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lazzerini, G.M. and Patern{\`o}, G.M. and Tregnago, G. and Treat, N. and Stingelin, N. and Yacoot, A. and Cacialli, F.} } @Article { TammLSHP2016, title = {Single-Ion Atomic Clock with3\(\times\)10−18Systematic Uncertainty}, journal = {Physical Review Letters}, year = {2016}, month = {2}, volume = {116}, number = {6}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, keywords = {Atomic Clock}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.116.063001}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.116.063001}, stag_bib_extends_levelofaccess = {NA}, author = {Tamm, C. and Lipphardt, B. and Sanner, C. and Huntemann, N. and Peik, E.} } @Article { SawalNPGZRBTGSGACFEERBP2016, title = {An interlaboratory comparison on whole water samples}, journal = {Accreditation and Quality Assurance}, year = {2016}, month = {1}, day = {29}, volume = {21}, number = {2}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {121-129}, keywords = {Water Framework Directive, Interlaboratory comparison, Whole water sample, Suspended particulate matter, Polycyclic aromatic hydrocarbons, Polybrominated diphenyl ethers, Tributlyltin}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-1775, 1432-0517}, DOI = {10.1007/s00769-015-1190-8}, stag_bib_extends_levelofaccess = {NA}, author = {Sawal, G. and Nousiainen, M. and Pr{\"o}frock, D. and Gago, A.G. and Zuliani, T. and Rodr{\'i}guez-Cea, A. and Binici, B. and Tun\c{c}, M. and Gokcen, T. and Swart, C. and Gantois, F. and Alasonati, E. and Cabillic, J. and Fettig, I. and Emteborg, H. and Elordui-Zapatarietxe, S. and Richter, J. and Buzoianu, M. and Philipp, R.} } @Article { , title = {A fiber-coupled quantum-dot on a photonic tip}, journal = {APPLIED PHYSICS LETTERS}, year = {2016}, month = {1}, day = {8}, volume = {108}, number = {1}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {011112-5}, keywords = {quantum-dot, fiber-coupling}, web_url = {http://scitation.aip.org/content/aip/journal/apl}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publishing LLC}, address = {Melville, NY}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4939264}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Cadeddu, D. and Teissier, J. and Braakman, F. and Gregersen, N. and Stepanov, P. and G{\'e}rard, J.M. and Claudon, J. and Warburton, R. J. and Poggio, M. and Munsch, M.} } @Article { , title = {Electron beam controlled covalent attachment of small organic molecules to graphene}, journal = {Nanoscale}, year = {2016}, month = {1}, day = {4}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {2711-2719}, keywords = {graphene, polyaromatic molecules, measurement}, web_url = {http://pubs.rsc.org/en/content/articlehtml/2016/nr/c5nr07539d}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {The Royal Society of Chemistry}, language = {30}, DOI = {10.1039/C5NR07539D}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Markevich, A. and Kurasch, S. and Lehtinen, O. and Reimer, O. and Feng, X. and M{\"u}llen, K. and Turchanin, A. and Khlobystov, A. N. and Kaiser, U. and Besley, E.} } @Proceedings { , title = {A mercury optical lattice clock at LNE-SYRTE}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {1}, day = {1}, volume = {723}, number = {n/a}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {012017}, keywords = {optical lattice clock}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012017/meta}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Bristol}, event_place = {Potsdam, Germany}, event_name = {8th Symposium on Frequency Standards and Metrology}, event_date = {12 - 16 October 2015}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1088/1742-6596/723/1/012017}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {De Sarlo, L and Favier, M and Tyumenev, R and Bize, S} } @Article { , title = {Strain-rate and temperature dependent material properties of Agar and Gellan Gum used in biomedical applications}, journal = {Journal of the mechanical behavior of biomedical materials}, year = {2016}, month = {1}, volume = {53}, number = {January 2016}, number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials}, pages = {119-130}, keywords = {Hydrogels, Relaxation time, Strain-rate-dependence, Temperature-dependence, Young׳s modulus}, web_url = {http://www.sciencedirect.com/science/article/pii/S1751616115002829}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, language = {30}, ISSN = {1751-6161v}, DOI = {10.1016/j.jmbbm.2015.08.011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Schiavi, AS and Cuccaro, RC and Troia, AT} } @Techreport { TerauchiKSBWWADGAAHUWSJKKFSBSS2016, subid = {415}, title = {Final report of CCQM-K129 'Measurement of Mole Fractions of Cu, In, Ga and Se in Cu(In,Ga)Se2 Films}, journal = {Metrologia}, year = {2016}, month = {1}, volume = {53}, number = {1A}, number2 = {14SIP05: TF-STANDARD: Developing a Standard for Valid Methodology for the Characterisation of Functional Alloy Thin Films}, pages = {08011-08011}, keywords = {CIGS, Cu(In,Ga)Se2, mole fractions, key comparison CCQM-K129}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1A/08011\&\#10;https://www.bipm.org/utils/common/pdf/final_reports/QM/K129/CCQM-K129.pdf}, misc2 = {EMPIR 2014: Support for Impact}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/1A/08011}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, A.S. and Kim, K.J. and Jang, J.S. and Suh, J.K. and Wirth, T. and Unger, W. and Hodoroaba, V.D. and Araujo, J.R. and Archanjo, B.S. and Galhardo, C.E. and Damasceno, J. and Achete, C.A. and Wang, H. and Wang, M. and Bennett, J. and Simon, D. and Kurokawa, A. and Terauchi, S. and Fujimoto, T. and Streeck, C. and Beckhoff, B. and Spencer, S. and Shard, A.} } @Article { , title = {Quantum and Classical Characterization of Single/Few Photon Detectors}, journal = {Quantum Matter}, year = {2016}, volume = {4}, number = {3}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {1-13}, keywords = {Quantum Tomography, Quantum Information, Single Photon Detectors, POVM}, web_url = {http://www.aspbs.com/qm.html}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {2164-7615}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mingolla, M. G. and Piacentini, F. and Avella, A. and Gramegna, M. and Lolli, L. and Meda, A. and Ruo Berchera, I. and Taralli, E. and Traina, P. and Rajteri, M. and Brida, G. and Degiovanni, I. P. and Genovese, M.} } @Proceedings { , title = {Tests on waveform synthesis in a new cryocooler setup}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, volume = {10.1109/CPEM.2016.7540563}, number = {10.1109/CPEM.2016.7540563}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {voltage measurement, coaxial cables, cooling, cryogenics, Josephson effect, measurement standards}, web_url = {http://ieeexplore.ieee.org/abstract/document/7540563/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa}, event_name = {CPEM16}, event_date = {10-15 July 2016}, language = {30}, ISBN = {978-1-4673-9134-4, 978-1-4673-9135-1, 978-1-4673-9132-0}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540563}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SOSSO, A and Trinchera, B and Durandetto, P and Monticone, E and Kieler, O and Behr, R and Kohlmann, J} } @Article { , title = {Characterization of a Josephson array for pulse-driven voltage standard in a cryocooler}, journal = {Measurement}, year = {2016}, volume = {95}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {77–81}, keywords = {Josephson effect; Quantum voltage standard; Quantum waveform synthesis; Measurement techniques; Measurement uncertainty; Precision measurements; Uncertainty}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116305425}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {Amsterdam, The Netherlands}, language = {30}, ISSN = {http://dx.doi.org/10.1016/j.measurement.2016.09.039}, DOI = {10.1016/j.measurement.2016.09.039}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SOSSO, A and Durandetto, P and Trinchera, B and Kieler, O and Behr, R and Kohlmann, J} } @Article { , title = {The influence of some relevant metallic impurities in the triple point of mercury temperature}, journal = {Metrologia}, year = {2016}, volume = {53}, number = {1}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {51-60}, keywords = {Triple point of mercury, ITS-90, impurities, uncertainty, liquidus slope, phase change, phase diagram}, web_url = {http://iopscience.iop.org/0026-1394/53/1/51}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, Bureau International des Poids et Mesures}, address = {Bristol}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/0026-1394/53/1/51}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tabacaru, C. and del Campo, D. and G{\'o}mez, E. and Garc{\'i}a Izquierdo, C. and Welna, A. and Kalemci, M. and Pehlivan, {\"O}} } @Article { AlacaOLHWT2016, subid = {922}, title = {Determination of the Elastic Behavior of Silicon Nanowires within a Scanning Electron Microscope}, journal = {Journal of Nanomaterials}, year = {2016}, volume = {2016}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {1-6}, keywords = {Elastic Behavior of Silicon Nanowires}, web_url = {https://www.hindawi.com/journals/jnm/2016/4905838/}, misc2 = {EMPIR 2014: Industry}, publisher = {Hindawi Limited}, language = {30}, ISSN = {1687-4110, 1687-4129}, DOI = {10.1155/2016/4905838}, stag_bib_extends_levelofaccess = {NA}, author = {Wollschl{\"a}ger, N. and Tasdemir, Z. and H{\"a}usler, I. and Leblebici, Y. and {\"O}sterle, W. and Alaca, B.E.} } @Proceedings { , title = {HIFU scattering by the ribs: constrained optimisation with a complex surface impedance boundary condition}, journal = {Journal of Physics Conference Series}, year = {2016}, volume = {498}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {36-46}, keywords = {HIFU, ribs, modelling}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/498/1/012004/pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Institute of Physics}, address = {London}, event_place = {Frejus, France}, event_name = {Anglo-French Physical Acoustics Conference}, event_date = {16-01-2013 - 18-01-2013}, language = {30}, ISSN = {1742-6588}, DOI = {10.1088/1742-6596/498/1/012004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gelat, P and ter Haar, G and Saffari, N} } @Article { , title = {Telling it like it is}, journal = {Journal of Therapeutic Ultrasound}, year = {2016}, volume = {1}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {4}, keywords = {ultrasound, dose, exposure, reporting}, web_url = {http://jtultrasound.biomedcentral.com/articles/10.1186/2050-5736-1-4}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {BioMed Central}, address = {London, UK}, language = {30}, ISSN = {2050-5736}, DOI = {10.1186/2050-5736-1-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaw, A and ter Haar, G} } @Article { , title = {Towards a dosimetric framework for therapeutic ultrasound}, journal = {International Journal of Hyperthermia}, year = {2016}, volume = {31}, number = {2}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {182-192}, keywords = {High intensity focused ultrasound, modelling, quality assurance, thermal ablation, ultrasound}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Taylor and Francis}, address = {Abingdon, UK}, language = {30}, ISSN = {0265-6736}, DOI = {10.3109/02656736.2014.997311}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaw, A and ter Haar, G and Haller, J and Wilkens, V} } @Article { , title = {Equipment, measurement and dose—a survey for therapeutic ultrasound}, journal = {Journal of Therapeutic Ultrasound}, year = {2016}, volume = {4}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {7}, keywords = {Therapeutic ultrasound, Dosimetry, Exposimetry, Survey}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {BioMed Central}, address = {London}, language = {30}, ISSN = {2050-5736}, DOI = {10.1186/s40349-016-0051-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaw, A and Martin, E and Haller, J and ter Haar, G} } @Article { , title = {A comparison of irradiance responsivity and thermodynamic temperature measurement between PTB and NIM}, journal = {AIP Conference Proceedings}, year = {2016}, volume = {1552}, number = {728}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {728-733}, keywords = {Comparison; Filter radiometer; Irradiance responsivity; Thermodynamic temperature measurement}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821404}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Scitation}, address = {Melville}, language = {30}, ISSN = {0094-243X}, DOI = {10.1063/1.4821404}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lu, X and Anhalt, K and Taubert, R D and Yuan, Z} } @Article { , title = {Experimental determination of (p, \(\rho\), T) data for binary mixtures of methane and helium}, journal = {Journal of Chemical Thermodynamics}, year = {2016}, volume = {96}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {1–11}, keywords = {methane; helium; natural gas thermodynamic characterization; density; single-sinker densimeter; GERG-2008 equation of state}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0021-9614}, DOI = {10.1016/j.jct.2015.12.006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hern{\'a}ndez-G{\'o}mez, R. and Tuma, D. and Segovia, J.J. and Chamorro, C.R.} } @Article { , title = {Accurate experimental (p, \(\rho\), T) data and virial coefficients for the (methane and helium) binary system}, journal = {Journal of Chemical Thermodynamics}, year = {2016}, volume = {101}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {168-179}, keywords = {methane; helium; natural gas thermodynamic characterization; density; single-sinker densimeter; GERG-2008 equation of state}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0021-9614}, DOI = {10.1016/j.jct.2016.05.024}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hern{\'a}ndez-G{\'o}mez, R. and Tuma, D. and Villama{\~n}{\'a}n, R. and Chamorro, C.R.} } @Proceedings { , title = {Comparison of the frequency dependence of capacitance ratios between LNE and PTB}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, keywords = {Impedance bridge, Josephson array, Josephson impedance bridge}, web_url = {http://ieeexplore.ieee.org/document/7540585/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540585}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Hagen, T and Th{\'e}venot, O and S{\'e}ron, O and Khan, S and Palafox, L and Behr, R} } @Article { , title = {Development of a programmable small capacitance standard at LNE}, journal = {Conference on Precision Electromagnetic Measurements Digest 2016}, year = {2016}, volume = {2016}, number = {2016}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {388-389}, keywords = {Capacitance measurements, multiplexer, small capacitance standard, capacitance bridge}, web_url = {https://www.eiseverywhere.com/retrieveupload.php?c3VibWlzc2lvbl8xMjc4NzJfNzkxODg4LnBkZiplc2VsZWN0}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {CPEM}, address = {Ottawa}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540611}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {KHAN, Mohammad Saif khan and Seron, Olivier Seron and Thuillier, Ga{\"e}l Thuillier and Th{\'e}venot, Olivier Th{\'e}venot} } @Article { , title = {Reassessing changes in diurnal temperature range: A new data set and characterization of data biases}, journal = {Journal of Geophysical Research: Atmospheres}, year = {2016}, volume = {121}, number = {10}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {5115–5137}, keywords = {diurnal temperature range, data set, reassessment}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/2015JD024583/abstract}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley}, address = {Hoboken}, language = {30}, ISSN = {2169-897X}, DOI = {10.1002/2015JD024583}, extern = {1}, stag_bib_extends_fe_group = {79,59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Thorne, P W and Menne, M J and Williams, C N and Rennie, J J and Lawrimore, J H and Vose, R S and Petersono, T C and Durre, I and Davy, R and Esau, I and Klein-Tank, A M G and Merlone, A} } @Article { PetricevicSMT2016, subid = {315}, title = {Development of a single-sided guarded hot plate apparatus for thermal conductivity measurements}, journal = {Thermal Science}, year = {2016}, volume = {20}, number = {suppl. 1}, number2 = {14RPT05: Eura-Thermal: Developing traceable capabilities in thermal metrology}, pages = {321-329}, keywords = {thermal conductivity, ceramics, polymers, rubbers, glasses, biological materials, guarded hot plate method}, web_url = {http://www.doiserbia.nb.rs/img/doi/0354-9836/2016/0354-98361500226T.pdf}, misc2 = {EMPIR 2014: Research Potential}, publisher = {National Library of Serbia}, language = {30}, ISSN = {0354-9836, 2334-7163}, DOI = {10.2298/TSCI151009226T}, stag_bib_extends_levelofaccess = {NA}, author = {Terzic, M. and Milosevic, N. and Stepanic, N. and Petricevic, S.} } @Article { DeStefanoCPFVTMDFM2015, title = {Characterization of a microDiamond detector in high-dose-per-pulse electron beams for intra operative radiation therapy}, journal = {Physica Medica}, year = {2015}, month = {12}, volume = {31}, number = {8}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {897-902}, keywords = {Intra operative radiation therapy, Electron beam dosimetry, High dose-per-pulse radiation therapy, Synthetic diamond dosimeters}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2015.06.008}, stag_bib_extends_levelofaccess = {NA}, author = {De Stefano, S. and Ciccotelli, A. and Pimpinella, M. and Falco, M.D. and Verona-Rinati, G. and Tonnetti, A. and Marinelli, M. and Di Venanzio, C. and Felici, G. and Marangoni, F.} } @Proceedings { SperlingPTRPJBR2015, title = {Multiple Transfer Standard for characterisation of sphere test setups}, journal = {Proceedings of the CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, year = {2015}, month = {11}, day = {26}, volume = {1}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {1-5}, keywords = {LED standard, multiple standard, characterisation sphere setup}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Commission Internationale de L'Eclairage}, address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A, 1010 Vienna, Austria}, event_place = {Braunschweig, Germany}, event_name = {CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, event_date = {26-11-2015 to 26-11-2015}, language = {30}, ISBN = {978-3-902842-28-2}, stag_bib_extends_levelofaccess = {NA}, author = {Sperling, A. and Penda, S. and Taddeo, M. and Revtova, E. and Poikonen, T. and Jordan, W. and Blattner, P. and Renoux, D.} } @Article { , title = {Thermoelectric properties of currently available Au/Pt thermocouples related to the valid reference function}, journal = {Int. J. Metrol. Qual. Eng.}, year = {2015}, month = {11}, day = {23}, volume = {6}, number = {3}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {303}, keywords = {Au/Pt thermocouple, reference function, temperature scale}, web_url = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Dr. A. CHARKI}, address = {EDP Sciences - France 17, Avenue du Hoggar Parc d'Activit{\'e} de Courtabœuf BP 112 91944 Les Ulis Cedex A France}, language = {30}, DOI = {10.1051/ijmqe/2015016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, author = {Edler, F. and Arifovic, N. and Atance, G. and Dinu, C. and Elliott, C. J. and Izquierdo, C. G. and Hodzic, N. and Kalisz, S. and Pearce, J.V. and Simic, S. and Strnad, R. and Taubert, D.} } @Article { , title = {Analysis of thermal radiation in ion traps for optical frequency standards}, journal = {Metrologia}, year = {2015}, month = {11}, day = {12}, volume = {52}, number = {6}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {842-856}, keywords = {blackbody radiation shift, ion traps, optical atomic clocks, ion clocks, thermal and high frequency finite element method modelling}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/6/842}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, BIPM}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/52/6/842}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Doležal, M and Balling, P and Nisbet-Jones, P B R and King, S A and Jones, J M and Klein, H A and Gill, P and Lindvall, T and Wallin, A E and Merimaa, M and Tamm, C and Sanner, C and Huntemann, N and Scharnhorst, N and Leroux, I D and Schmidt, P O and Burgermeister, T and Mehlst{\"a}ubler, T E and Peik, E} } @Proceedings { , title = {Primary Standard in Micro Flow for Traceability in Steady and Pulsating Flow Regime}, year = {2015}, month = {11}, day = {2}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Micro-flow, liquid, dynamic gravimetric calibration, pulsating flow}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Arlington, Virginia, USA}, event_name = {International Symposium of Fluid Flow Measurement}, event_date = {April 14 to 17, 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bissig, H and Tschannen, M and de Huu, M} } @Proceedings { , title = {MICRO FLOW STANDARD FOR STEADY AND PULSATING FLOW}, year = {2015}, month = {11}, day = {2}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {micro flow, traceability, drug delivery}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {University of Freiburg, Germany}, event_name = {2nd International Conference on MicroFluidic Handling Systems}, event_date = {October 8 - 10, 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-1-1}, author = {Bissig, H and Tschannen, M and de Huu, M} } @Proceedings { , title = {MICRO FLOW FACILITY FOR TRACEABILITY IN STEADY AND PULSATING FLOW}, year = {2015}, month = {11}, day = {2}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Micro flow, liquid, dynamic gravimetric calibration, pulsating flow}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Paris, France}, event_name = {16th International Flow Measurement Conference, FLOMEKO 2013}, event_date = {September 24 - 26, 2013}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-1-1}, author = {Bissig, H and Tschannen, M and de Huu, M} } @Article { , title = {Self-Compensating Networks for Four-Terminal-Pair Impedance Definition in Current Comparator Bridges}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {11}, day = {2}, volume = {65}, number = {5}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {1149 - 1155}, keywords = {Bridge circuits, Impedance, Windings, Standards, Current measurement, Frequency measurement, Uncertainty}, web_url = {http://ieeexplore.ieee.org/document/7314919/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {---}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2490898}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7314919/}, author = {Callegaro and D'Elia and Kucera and Ortolano and Pourdanesh and Trinchera} } @Article { , title = {Correlated Emission Lasing in Harmonic Oscillators Coupled via a Single Three-Level Artificial Atom}, journal = {PHYSICAL REVIEW LETTERS}, year = {2015}, month = {11}, volume = {115}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {223603}, keywords = {Lasing Artificial atom Decoherence Three-level atom Harmonic oscillator}, web_url = {http://journals.aps.org/prl/pdf/10.1103/PhysRevLett.115.223603}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {PHYSICAL REVIEW LETTERS}, language = {30}, DOI = {10.1103/PhysRevLett.115.223603}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Peng, Z. H. and Liu, Yu-xi and Peltonen, J. T. and Yamamoto, T. and Tsai, J.S. and Astafiev, O.V.} } @Article { OliveroGSGMEDBBAMTF2015, subid = {563}, title = {Electrical stimulation of non-classical photon emission from diamond color centers by means of sub-superficial graphitic electrodes}, journal = {Scientific Reports}, year = {2015}, month = {10}, day = {29}, volume = {5}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {15901}, keywords = {Single Photon Sources, NV centers}, web_url = {https://www.nature.com/articles/srep15901}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep15901}, stag_bib_extends_levelofaccess = {NA}, author = {Forneris, J. and Traina, P. and Monticone, D.G. and Amato, G. and Boarino, L. and Brida, G. and Degiovanni, I.P. and Enrico, E. and Moreva, E. and Grilj, V. and Skukan, N. and Jakšić, M. and Genovese, M. and Olivero, P.} } @Article { , title = {One-step large-scale deposition of salt-free DNA origami nanostructures}, journal = {Scientific Reports}, year = {2015}, month = {10}, day = {23}, volume = {5}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {15634}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Nature Publishing Group}, language = {30}, DOI = {10.1038/srep15634}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Linko, V. and Shen, B. and Tapio, K. and Toppari, J. and Kostianen, M and Tuukkanen, S.} } @Article { , title = {Sudden stress relaxation in compound semiconductor thin films triggered by secondary phase segregation}, journal = {Physical Review B}, year = {2015}, month = {10}, day = {12}, volume = {92}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {155310}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, stress relaxation, recrystallization, grain growth, in-situ, XRD, XRF}, web_url2 = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.155310}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Physical Society}, address = {College Park}, language = {30}, ISSN = {2469-9969}, DOI = {10.1103/PhysRevB.92.155310}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mainz, R. and Rodriguez-Alvarez, H. and Klaus, M. and Thomas, D. and Lauche, J. and Weber, A. and Heinemann, M. D. and Brunken, S. and Greiner, D. and Kaufmann, C. A. and Unold, T. and Schock, H.-W. and Genzel, C.} } @Article { , title = {Highly directive and Gaussian far-field emission from “giant” photonic trumpets}, journal = {APPLIED PHYSICS LETTERS}, year = {2015}, month = {10}, day = {6}, volume = {107}, number = {14}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {141106-4}, keywords = {photonic antennas; photonic wire; quantum dot}, web_url = {http://scitation.aip.org/content/aip/journal/apl}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publishing}, address = {Melville, NY}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4932574}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stepanov, P. and Delga, A. and Gregersen, N. and Peinke, E. and Munsch, M. and Teissier, J. and M{\o}rk, J. and Richard, M. and Bleuse, J. and G{\'e}rard, J.M. and Claudon, J.} } @Article { , title = {Simultaneous dynamic electrical and structural measurements of functional materials}, journal = {Review of Scientific Instruments}, year = {2015}, month = {10}, day = {5}, volume = {83}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {103901}, keywords = {Piezoelectric fields, Interferometers, Ferroelectric materials, Polarization, Diffractometers}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/86/10/10.1063/1.4931992}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {0034-6748}, DOI = {10.1063/1.4931992}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vecchini, CV and Thompson, PT and Stewart, MS and Muniz-Piniella, AMP and McMitchell, SRCM and Wooldridge, JW and Lepadatu, SL and Bouchenoire, LB and Brown, SB and Wermeille, DW and Bikondoa, OB and Lucas, CAL and Hase, TH and Lesourd, ML and Dontsov, DD and Cain, MGC} } @Proceedings { , title = {Metrology for ammonia in ambient air–concept and first results of the EMRP project MetNH3}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {2015}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {07003}, keywords = {ammonia, reference gas mixture, reference gas generator, dilution, absolute spectroscopic measurements, sampling, gas cylinders}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07003/metrology_metr2015_07003.html}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {EDP Sciences - Web of Conferences}, address = {Les Ulis Cedex}, event_place = {Paris, France}, event_name = {17th International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/201507003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pog{\'a}ny, A. and Balslev-Harder, D. and Braban, C. F. and Cassidy, N. and Ebert, V. and Ferracci, V. and Hieta, T. and Leuenberger, D. and L{\"u}ttschwager, N. and Martin, N. and Pascale, C. and Tiebe, C. and Twigg, M. M. and Vaittinen, O. and van Wijk, J. and Wirtz, K. and Niederhauser, B.} } @Proceedings { , title = {Scatterometric characterization of diffractive optical elements}, journal = {Proceedings of SPIE}, year = {2015}, month = {9}, day = {10}, volume = {9173}, number = {-}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {91730I}, keywords = {scatterometry, diffractive optical elements}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1901269}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {SPIE}, address = {Bellingham}, event_place = {San Diego}, event_name = {SPIE Optics+Photonics 2014}, event_date = {17-21 August, 2014}, language = {30}, ISBN = {9781628412000}, ISSN = {0277-786X}, DOI = {10.1117/12.2061699}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Saastamoinen, Toni and Husu, Hannu and Laukkanen, Janne and Siitonen, Samuli and Turunen, Jari and Lassila, Antti} } @Proceedings { , title = {A new Conducted Immunity Test Device for Inter-Laboratory Comparisons}, journal = {IEEE International Symposium on Electromagnetic Compatibility and EMC Europe Proceedings}, year = {2015}, month = {8}, day = {22}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {855-860}, keywords = {Electromagnetic Compatibility (EMC), IEC 61000-4-6, round robin, immunity, common mode, conducted, current clamp, Radio Frequency (RF) meter, Coupling-Decoupling Network (CDN), inter-laboratory comparison, Equipment under Test (EUT).}, web_url = {http://conference.vde.com/emc2015/Pages/default.aspx}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Dresden / Germany}, event_name = {IEEE International Symposium on Electromagnetic Compatibility and EMC Europe}, event_date = {16-08-2015 to 22-08-2015}, language = {30}, ISBN = {978-1-4799-6615-8}, ISSN = {2158-110X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tas, Emrah and Pythoud, Fr{\'e}d{\'e}ric} } @Article { , title = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system}, journal = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system}, year = {2015}, month = {8}, day = {19}, volume = {2}, number = {3}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {035015}, keywords = {graphene, Quantum Hall, cryogen-free, measurement}, web_url = {http://iopscience.iop.org/2053-1583/2/3/035015/video/abstract}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/2/3/035015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Rozhko, S. and Antonov, I. and Tzalenchuk, A. and Williams, J. M. and Melhem, Z. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R.} } @Article { , title = {A determination of the molar gas constant R by acoustic thermometry in helium}, journal = {Metrologia}, year = {2015}, month = {8}, day = {19}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S274-S304}, keywords = {molar gas constant, Boltzmann constant, acoustic gas thermometry, acoustic resonators, kelvin, speed of sound, helium}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S274/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing - Bureau International des Poids et Mesures}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/52/5/S274}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-19}, author = {Gavioso, R M and Madonna Ripa, D and Steur, P P M and Gaiser, C and Truong, D and Guianvarc'h, C and Tarizzo, P and Stuart, F M and Dematteis, R} } @Article { , title = {Improved electronic measurement of the Boltzmann constant by Johnson noise Thermometry}, journal = {Metrologia}, year = {2015}, month = {8}, day = {19}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S242-S256}, keywords = {Boltzmann constant, Johnson noise, quantum voltage, noise thermometry}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S242/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/0026-1394/52/5/S242}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Qu, J and Benz, S P and Pollarolo, A and Roglla, H and Tew, W L and White, R and Zhou, K} } @Article { , title = {Detecting metrologically useful entanglement in the vicinity of Dicke states}, journal = {New Journal of Physics}, year = {2015}, month = {8}, day = {13}, volume = {17}, number = {1}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {083027}, keywords = {quantum Fisher information, quantum metrology, quantum entanglement, Dicke states}, web_url = {http://arxiv.org/abs/1412.3426}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol BS1 6HG UK}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/17/8/083027}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://iopscience.iop.org/1367-2630/17/8/083027}, author = {Apellaniz, I and L{\"u}cke, B and Peise, J and Klempt, C and T{\'o}th, G} } @Proceedings { , title = {LED-based field radiometer for sensor web in-situ measurements}, journal = {IEEE International Workshop on Metrology for Aerospace, MetroAeroSpace 2015 - Proceedings 08/2015}, year = {2015}, month = {8}, volume = {2}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {radiometer, LED, vicarious calibration, sensor web, in-situ}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7180675}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {IEEE}, event_place = {Benevento, Italy}, event_name = {2nd IEEE International Workshop on Metrology for Aerospace, MetroAeroSpace 2015}, event_date = {04-06-2015 to 05-06-2015}, language = {30}, DOI = {10.1109/MetroAeroSpace.2015.7180675}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Taralli, ET and Filippo, RF and Brida, GB and Rajteri, MR and Hall, SRGH and Bialek, AB and Greenwell, CG and Fox, NF} } @Article { , title = {Measuring Compositions in Organic Depth Profiling: Results from a VAMAS Interlaboratory Study}, journal = {Journal of Physical Chemistry (B)}, year = {2015}, month = {7}, day = {23}, volume = {119}, number = {33}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {10784–10797}, web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b05625}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ACS}, address = {Washington DC}, language = {30}, DOI = {10.1021/acs.jpcb.5b05625}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-6}, author = {Shard, A. and Havelund, R. and Spencer, S. and Gilmore, I. and Alexander, M.R. and Angerer, T.B. and Aoyagi, S. and Barnes, J.P. and Benayad, A. and Bernasik, A. and Ceccone, G. and Counsell, J.D.P and Deeks, C. and Fletcher, J.S. and Graham, D.J. and Heuser, C. and Lee, T.G. and Marie, C. and Marzec, M.M. and Mishra, G. and Rading, D. and Renault, O. and Scurr, D.J and Shon, H.K. and Spampinato, V. and Tian, H. and Wang, F. and Winograd, N. and Wu, K. and Wucher, A.} } @Article { , title = {How to use current practice, risk analysis and standards to define hospital-wide policies on the safe use of infusion technology}, journal = {Biomed. Eng.-Biomed.}, year = {2015}, month = {7}, day = {20}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {381-387}, keywords = {drug delivery; hospital policy; infusion; therapy; medical devices; metrology; multi-infusion; quality assurance; standards}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0147}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Timmerman, A.M.D.E. and Oliveira-Martens, S.M. and Snijder, R.A. and Niemann, A.K. and Egberts, T.C.} } @Article { PimpinellaBFVVTPMGD2015, title = {A novel synthetic single crystal diamond device for in vivo dosimetry}, journal = {Medical Physics}, year = {2015}, month = {7}, day = {13}, volume = {42}, number = {8}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {4636-4644}, keywords = {synthetic diamond dosimeter, in vivo dosimetry, radiation therapy, semiconductor detector}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0094-2405}, DOI = {10.1118/1.4926556}, stag_bib_extends_levelofaccess = {NA}, author = {Pimpinella, M. and Bagal{\`a}, P. and Falco, M. D. and Verona-Rinati, G. and Verona, C. and Tonnetti, A. and Prestopino, G. and Marinelli, M. and Guerra, A. S. and De Coste, V.} } @Article { , title = {Flow variability and its physical causes in infusion technology: a systematic review of in vitro measurement and modeling studies}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {7}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {277-300}, keywords = {compliance; drug delivery; in vitro; infusion; metrology; pumps; review}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0148}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Snijder, R.A. and Koning, M.K. and Lucas, P. and Egberts, T.C. and Timmerman, A.M.D.E.} } @Article { , title = {Characterization and reduction of the amplitude-to-phase conversion effects in telemetry}, journal = {Meas. Sci. Technol.}, year = {2015}, month = {7}, volume = {26 (8)}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {laser diode, photodetection, amplitude modulation, phase measurement, amplitude-to-phase coupling, optical telemetry, absolute distance meter}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1088/0957-0233/26/8/084006}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Guillory, J and Garc{\'i}a-M{\'a}rquez, J and Alexandre, C and Wallerand, J-P and Truong, D} } @Article { , title = {Influence of impurity spin dynamics on quantum transport in epitaxial graphene}, year = {2015}, month = {7}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {epitaxial graphene, measurements, graphene, magnetotransport, magnetic field B∥,}, web_url = {http://arxiv.org/abs/1507.03841v1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1103/PhysRevLett.115.106602}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lara-Avila, S. and Kubatkin, S. and Kashuba, O. and Folk, J. A. and L{\"u}scher, S. and Yakimova, R. and Janssen, T.J.B.M. and Tzalenchuk, A. and Fal'ko, V.} } @Article { , title = {A prototype of RK=200 quantum Hall array resistance standard on epitaxial graphene}, journal = {A prototype of RK=200 quantum Hall array resistance standard on epitaxial graphene}, year = {2015}, month = {7}, volume = {118}, number = {4}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {044506}, keywords = {Epitaxial graphene, silicon carbide, Hall, graphene, measurement,}, web_url = {http://scitation.aip.org/content/aip/journal/jap/118/4/10.1063/1.4927618}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979}, DOI = {10.1063/1.4927618}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lartsev, A. and Lara-Avila, S. and Danilov, A. and Tzalenchuk, A. and Yakimova, R. and Kubatkin, S.} } @Article { , title = {Online validation of comparison algorithms using the TraCIM system}, journal = {Journal of mechanical Engineering and Automation}, year = {2015}, month = {7}, volume = {2}, number = {7}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {312-327}, keywords = {Comparison, TraCIM, weighted mean, expanded measurement uncertainty, En value, largest consistent subset, En criterion, Grubbs’ test.}, tags = {MAT}, web_url = {http://www.ethanpublishing.com/uploadfile/2015/0806/20150806111104726.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Scientific \& Academic Publishing (SAP)}, address = {Rosemead}, language = {30}, ISSN = {2163-2413}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"a}rtig, FH and Tang, JT and Hutzschenreuter, DH and Wendt, KW and Kniel, KK and Shi, ZS} } @Article { , title = {Imaging microwave and DC magnetic fields in a vapor-cell Rb atomic clock}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, day = {30}, volume = {64}, number = {12}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {3629-3637}, keywords = {Atomic clocks, diode lasers, microwave measurements, microwave resonators, microwave spectroscopy, optical pumping}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7140794}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, NY, USA}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2444261}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1505.07739}, author = {Affolderbach, C. and Du, G.-X. and Bandi, T. and Horsley, A. and Treutlein, P. and Mileti, G.} } @Article { , title = {How physical infusion system parameters cause clinically relevant dose deviations after setpoint changes}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {6}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {365-376}, keywords = {drug delivery; metrology; multi-infusion; standards; syringe compliance}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0139}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Timmerman, A.M.D.E. and Snijder, R.A. and Lucas, P. and Lagerwij, M.C. and Radermacher, J.H. and Konings, M.K.} } @Article { SuranKBAMSHTLT2015, title = {A new large-volume metal reference standard for radioactive waste management}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {13}, volume = {168}, number = {3}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {293-299}, keywords = {reference materials, calibration, ionizing radiation, free release measurement}, web_url = {http://rpd.oxfordjournals.org}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv309}, stag_bib_extends_levelofaccess = {NA}, author = {Šur{\'a}ň, J. and Kov{\'a}ř, P. and Burda, O. and Arnold, D. and Marissens, G. and Stroh, H. and Hult, M. and Tzika, F. and Listkowska, A. and Tyminski, Z.} } @Article { , title = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, journal = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, year = {2015}, month = {5}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Dirac-point physics, epitaxial graphene, magneto-transport, measurement, graphene, hall effect, electron-hole puddles,}, web_url = {http://arxiv.org/abs/1505.03747}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1103/PhysRevB.92.075407}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, J. and Alexander-Webber, J.A. and Baker, A.M.R. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.} } @Article { , title = {First on-line isotopic characterization of N2O above intensively managed grassland}, journal = {Biogeosciences}, year = {2015}, month = {4}, day = {29}, volume = {12}, number = {N/A}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2517-2531}, keywords = {None supplied.}, web_url = {http://www.biogeosciences.net/12/2517/2015/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus Publications}, address = {Gottingen}, language = {30}, ISSN = {1726-4189}, DOI = {10.5194/bg-12-2517-2015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wolf, B and Merbold, L and Decock, C and Tuzson, B and Harris, E and Six, J and Emmenegger, L and Mohn, J} } @Article { NemethTN2015, title = {New Experimental Technique for the Study of Phase Transition Evolution in Fixed-Point Cells}, journal = {International Journal of Thermophysics}, year = {2015}, month = {4}, day = {23}, volume = {36}, number = {8}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {1956-1967}, keywords = {Temperature fixed points, ITS-90, phase transition, electrical conductivity, endless plateaus}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-015-1880-9}, stag_bib_extends_levelofaccess = {NA}, author = {Nemeth, S. and Turz{\'o}-Andr{\'a}s, E. and Nemeth, T.} } @Article { , title = {Critical Review of Industrial Techniques for Thermal Conductivity Measurements of Thermal Protection Materials}, journal = {International Journal of Thermophysics}, year = {2015}, month = {4}, day = {23}, volume = {36}, number = {7}, number2 = {SIB52: Thermo: Metrology for thermal protection materials}, pages = {1530-1544}, keywords = {Guarded heat-flow meter, Guarded hot-plate apparatus, High temperature, Laser-flash instrument, Measuring device, Thermal conductivity, Thermal insulation material, Transient hot wire, Transient plane source}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1863-x}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Link}, language = {30}, ISSN = {1572-9567}, DOI = {10.1007/s10765-015-1863-x}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hammerschmidt, UHS and Hameury, JH and Strnad, RS and Turz{\'o}-Andras,, ETA and Wu, JW} } @Article { , title = {Epitaxial graphene on SiC: Modification of structural and electron transport properties by substrate pretreatment}, journal = {Epitaxial graphene on SiC: modification of structural and electron transport properties by substrate pretreatment}, year = {2015}, month = {4}, day = {20}, volume = {27}, number = {18}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {185303}, keywords = {Epitaxial graphene, step bunching, graphene buffer layer, graphene bilayer, resistance anisotropy, quantum Hall resistance, hydrogen, argon, pretreatment, transport properties, SiC substrate, annealing, shallowly stepped}, web_url = {http://iopscience.iop.org/article/10.1088/0953-8984/27/18/185303/meta}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {0953-8984}, DOI = {10.1088/0953-8984/27/18/185303}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kruskopf, M. and Pierz, K. and Wundrack, S. and Stosch, R. and Dziomba, T. and Kalmbach, C.C. and M{\"u}ller, A. and Ahlers, F.J. and Schumacher, H.W. and Baringhaus, J. and Tegenkamp, C.} } @Article { , title = {‘BIOQUART’ PROJECT: DESIGN OF A NOVEL IN SITU PROTOCOL FOR THE SIMULTANEOUS VISUALISATION OF CHROMOSOMAL ABERRATIONS AND MICRONUCLEI AFTER IRRADIATION AT MICROBEAM FACILITIES}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {4}, day = {15}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, web_url = {http://rpd.oxfordjournals.org/content/early/2015/04/15/rpd.ncv160.abstract}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1093/rpd/ncv160}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Patrono, C. and Monteiro Gil, O. and Giesen, U. and Langner, F. and Pinto, M. and Rabus, H. and Testa, A.} } @Article { , title = {Sensing earth's rotation with a helium-neon ring laser operating at 1.15 \(\mu\)m}, journal = {Opt. Lett.}, year = {2015}, month = {4}, day = {8}, volume = {40}, number = {8}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {1705}, keywords = {(120.5790) Sagnac effect; (140.3370) Laser gyroscopes; (140.3560) Lasers, ring.}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-8-1705}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington, DC, USA}, language = {30}, ISSN = {1539-4794}, DOI = {10.1364/OL.40.001705}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schreiber, U and Thirkettle, R and Hurst, R and Follman, D and Cole, G and Aspelmeyer, M and Wells, J-P} } @Article { , title = {Evaluation and Selection of High-Temperature Fixed-Point Cells for Thermodynamic Temperature Assignment}, journal = {Int J Thermophys}, year = {2015}, month = {4}, day = {5}, volume = {36}, number = {8}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1834-1847}, keywords = {High-temperature fixed points · Metal-carbon eutectics · Radiation thermometry · Temperature standards · Thermodynamic temperature}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1860-0}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Link}, address = {Europe/Asia/Africa}, language = {30}, ISSN = {NA}, DOI = {10.1007/s10765-015-1860-0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yamada, Y and Anhalt, K and Battuello, M and Bloembergen, P and Khlevnoy, B and Machin, G and Matveyev, M and Sadli, M and Todd, A and Wang, T} } @Article { , title = {Magnetoencephalographic accuracy profiles for the detection of auditory pathway sources}, journal = {Biomedizinische Technik}, year = {2015}, month = {4}, day = {1}, volume = {Vol.60 (2015-Apr)}, number = {2}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {135–145}, keywords = {head phantom; magnetoencephalography; source localisation.}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/25490026}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {0013-5585}, DOI = {10.1515/bmt-2013-0136}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bauer, M. and Sander, T. and Trahms, L.} } @Article { , title = {Electroluminescence from a diamond device with ion-beam-micromachined buried graphitic electrodes}, journal = {Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms}, year = {2015}, month = {4}, day = {1}, volume = {348}, number = {8}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {187-190}, keywords = {Diamond; Electroluminescence; Graphite; Ion beam micro-machining}, web_url = {http://www.sciencedirect.com/science/journal/0168583X}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Elsevier}, address = {London}, language = {30}, ISSN = {0168-583X}, DOI = {10.1016/j.nimb.2014.12.036}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Forneris, J. and Battiato, A. and Gatto Monticone, D. and Picollo, F. and Amato, G. and Boarino, L. and Brida, G. and Degiovanni, I.P. and Enrico, E. and Genovese, M. and Moreva, E. and Traina, P. and Verona, C. and Verona Rinati, G. and Olivero, P.} } @Article { , title = {Assessment of drug delivery devices}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {3}, day = {30}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {347-357}, keywords = {compliance; drug delivery; infusion; metrology; pump; standards}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0138}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Batista, E. and Almeida, N. and Fillipe, E. and Sousa, L. and Martins, R. and Lucas, P. and Petter, H.T. and Snijder, R.A and Timmerman, A.M.D.E.} } @Article { , title = {Interference Cancellation for Hollow-Core Fiber Reference Cells}, journal = {IEEE TIM (Transactions on Instrumentation and Measurement)}, year = {2015}, month = {3}, day = {13}, volume = {64}, number = {6}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {1595 - 1599}, keywords = {Frequency measurement standards, infrared spectra, interference cancellation, measurement techniques, metrology, optical fiber spectroscopy, spectroscopy.}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2408800}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Sepp{\"a}, J and Merimaa, M and Manninen, A and Triches, M and Hald, J and Lassila, A} } @Article { , title = {¹³C- and ¹H-detection under fast MAS for the study of poorly available proteins: application to sub-milligram quantities of a 7 trans-membrane protein.}, journal = {Journal of Biomolecular NMR}, year = {2015}, month = {2}, day = {21}, volume = {62}, number = {1}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {17-23}, keywords = {7 trans-membrane proteins Poorly available proteins Fast magic angle spinning Heteronuclear detection 13C-detection Low sample volumes}, web_url = {http://link.springer.com/article/10.1007\%2Fs10858-015-9911-1}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer}, address = {Berlin}, language = {30}, DOI = {10.1007/s10858-015-9911-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Watts, Anthony and Judge, Peter J. and Asilmovska, Lubica and Pfeil, Marc Philipp and Higman, Victoria A. and Varga, Krisztina and Taylor, Garrick F. and Dannatt, Hugh R W} } @Article { , title = {Metrology to support therapeutic and diagnostic techniques based on electromagnetics and nanomagnetics}, journal = {Rendiconti Lincei}, year = {2015}, month = {2}, day = {17}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {1-10}, keywords = {Magnetic resonance imaging, Dosimetry, Magnetic nanoparticles, Biosensors}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {Print ISSN 2037-4631, Online ISSN 1720-0776}, DOI = {10.1007/s12210-015-0386-5}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Barrera, G and Borsero, M and Bottauscio, O and Celegato, F and Chiampi, M and Coı¨sso, M and Giordano, D and Inguscio, M and Manzin, A and Simonetto, E and Tiberto, P and Zilberti, L} } @Article { , title = {En route to traceable reference standards for surface group quantifications by XPS, NMR and fluorescence spectroscopy.}, journal = {Analyst}, year = {2015}, month = {1}, day = {28}, volume = {140}, number = {6}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/AN/C4AN02248C\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {0003-2654}, DOI = {10.1039/c4an02248c}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hennig, A. and Dietrich, P. M. and Hemmann, F. and Thiele, T. and Borcherding, H. and Hoffmann, A. and Schedler, U. and J{\"a}ger, C. and Resch-Genger, U. and Unger, W. E. S.} } @Article { MalikBPTHH2015, title = {Specific absorption rate in neonates undergoing magnetic resonance procedures at 1.5 T and 3 T}, journal = {NMR in Biomedicine}, year = {2015}, month = {1}, day = {16}, volume = {28}, number = {3}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {344-352}, keywords = {specific absorption rate; neonatal MRI; RF safety; electromagnetic simulations}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {1099-1492}, DOI = {10.1002/nbm.3256}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Malik, Shaihan J. and Beqiri, Arian and Price, Anthony N. and Teixeira, Jose Nuno and Hand, Jeffrey W. and Hajnal, Joseph V.} } @Article { , title = {Two-dimensional control of field-driven magnetic bubble movement using Dzyaloshinskii–Moriya interactions}, journal = {Applied Physics Letters}, year = {2015}, month = {1}, day = {12}, volume = {106}, number = {2}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {022402}, keywords = {Nucleation, Domain walls, Magnetic fields, Magnetic films, Magnetooptic Kerr effect}, web_url = {http://scitation.aip.org/content/aip/journal/apl/106/2/10.1063/1.4905600}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publishing LLC}, address = {New York}, language = {30}, ISSN = {1077-3118}, DOI = {10.1063/1.4905600}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Petit, D and Seem, PR and Tillette, M and Mansell, R and Cowburn, RP} } @Article { , title = {An active filter for Delta-Sigma-modulated Josephson waveforms}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, volume = {64}, number = {6}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1559-1563}, keywords = {Active filters, analog circuits, Butterworth filters, harmonic distortion, Josephson voltage standards, low-pass filters, phase distortion, temperature dependence}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2418454}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bergsten, Tobias and Eklund, Gunnar and Tarasso, Valter and Rydler, Karl-Erik} } @Proceedings { HallHT2015, title = {So, You Need Reliable Magnetic Measurements You Can Use With Confidence? How the Magnetic Measurement Capabilities at NPL Can Help}, journal = {Journal of Magnetics}, year = {2015}, volume = {18(3)}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {ambient field cancellation, magnetic noise, magnetic capability, properties with stress}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {South Korea}, event_name = {ICM}, event_date = {2012}, ISSN = {1226-1750}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hall, Michael and Harmon, Stuart and Thomas, Owen} } @Proceedings { , title = {Imaging the Static Magnetic Field Distribution in a Vapor Cell Atomic Clock}, year = {2015}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {21-24}, keywords = {Atomic clocks, Magnetic field measurement, Microwave resonators, Microwave spectroscopy, Optical pumping.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Denver CO, USA}, event_name = {2015 JOINT CONFERENCE OF THE IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM \& European Frequency and Time Forum}, event_date = {13-17 April 2015}, language = {30}, DOI = {10.1109/FCS.2015.7138785}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Affolderbach, C. and Du, G.-X. and Bandi, T. and Horsley, A. and Treutlein, P. and Mileti, G.} } @Article { , title = {Optical frequency standard using acetylene-filled hollow-core photonic crystal fibers}, journal = {Optics Express}, year = {2015}, volume = {23}, number = {9}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {11227-11241}, web_url = {https://www.osapublishing.org/oe/}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1364/OE.23.011227}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Triches, Marco and Michieletto, Mattia and Hald, Jan and Lyngs{\o}, Jens K. and L{\ae}gsgaard, Jesper and Bang, Ole} } @Article { , title = {Absolute distance measurementby dual-comb interferometry with multi-channel digital lock-in phase detection}, journal = {Meas. Sci. Technol.}, year = {2015}, volume = {26 (8)}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1088/0957-0233/26/8/084001}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yang, R. and Pollinger, F. and Meiners-Hagen, K. and Krystek, M. and Tan, J. and Bosse, H.} } @Proceedings { , title = {Self-compensating networks for four terminal-pair impedance definition in current comparator bridges}, journal = {Proceedings of the 2015 IEEE International Instrumentation and Measurement Technology Conference}, year = {2015}, volume = {-}, number = {-}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {1658-1661}, keywords = {Impedance measurement, bridge circuits, digital-analog conversion, electromagnetic devices, precision measurements.}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Luca Callegaro}, address = {INRIM, Torino, Italy}, event_place = {Pisa, Italy}, event_name = {2015 IEEE International Instrumentation and Measurement Technology Conference}, event_date = {2015-05- 11-14}, language = {30}, ISBN = {-}, ISSN = {978-1-4799-6113-9}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Callegaro, Luca and D'Elia, V. and Pourdanesh, Faranak and Trinchera, Bruno and Kucera, J. and Ortolano, Massimo} } @Proceedings { , title = {Provisional Assessment of Candidate High-Temperature Thermal Conductivity Reference Materials in the EMRP “Thermo” Project}, journal = {32nd International Thermal Conductivity Conference and 20th International Thermal Expansion Symposium}, year = {2015}, volume = {N/A}, number = {N/A}, number2 = {SIB52: Thermo: Metrology for thermal protection materials}, pages = {142-153}, keywords = {thermal conductivity, reference material, provisional assessment, high temperature, dimensional stability, mechanical stability, chemical stability, uniformity}, web_url = {http://docs.lib.purdue.edu/thermal/2014/steady/5/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Purdue University Press}, address = {West Lafayette, IN, USA}, event_place = {Purdue University, West Lafayette, Indiana, USA}, event_name = {32nd International Thermal Conductivity Conference}, event_date = {Apr. 27 - May 1, 2014}, language = {30}, ISBN = {Print ISBN: 978-1-62671-050-4; ePUB ISBN: 978-1-62671-051-1; ePDF ISBN: 978-1-62671-052-8}, ISSN = {N/A}, DOI = {10.5703/1288284315555}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wu, J. and Morrell, R. and Fry, T. and Gnaniah, S. and Dohil, D. and Dawson, A. and Hameury, J. and Koenen, A. and Hammerschmidt, U. and Turz{\'o}-Andr{\'a}s, E. and Strnad, R. and Blahut, A.} } @Article { , title = {Goniochromatic and Sparkle properties of effect pigmented samples in multidimensional configuration}, journal = {Proceedings of SPIE}, year = {2015}, volume = {9398}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {93980O}, keywords = {Goniochromatism; Effect Pigments; Multidimensional; Sparkle; Graininess}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2208034}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, address = {Bellingham}, language = {30}, ISSN = {0277-786X}, DOI = {10.1117/12.2078727}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}pe, A. and Hauer, K. O. and Teichert, S. and Hunerhoff, D. and Strothk{\"a}mper, C.} } @Proceedings { , title = {Investigation of transfer standards in the highest range up to 50 MN within EMRP project SIB 63}, journal = {Proceedings of the 21st IMEKO World Congress}, year = {2015}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {7}, keywords = {transfer standard, meganewton, build-up system}, web_url = {http://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC3-083.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Prague, Czech Republic}, event_name = {XXI IMEKO World Congress}, event_date = {August 30 - September 4}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Tegtmeier, F and Wagner, M and Kumme, R} } @Proceedings { , title = {Processing and evaluation of build-up system measurement data}, journal = {Proceedings of the 21st IMEKO World Congress}, year = {2015}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {7}, keywords = {Build-Up systems, processing, uncertainty}, web_url = {http://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC3-091.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Prague, Czech Republic}, event_name = {XXI IMEKO World Congress}, event_date = {August 30 - September 4}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wagner, M and Tegtmeier, F} } @Article { , title = {Custom-shaped metal nanostructures based on DNA origami silhouettes}, journal = {Nanoscale}, year = {2015}, volume = {7}, number = {2015}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {11267–11272}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {The Royal Society of Chemistry}, language = {30}, DOI = {10.1039/c5nr02300a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Shen, B. and Linko, V. and Tapio, K. and Kostianen, M. and Toppair, J.} } @Article { , title = {First determination of the Planck constant using the LNE watt balance}, journal = {Metrologia}, year = {2015}, volume = {52}, number = {2015}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {433-443}, keywords = {watt balance, Planck’s constant, kilogram}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, DOI = {10.1088/0026-1394/52/2/433}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Thomas, Matthieu and Espel, Patrick and Ziane, Djamel and Pinot, Patrick and Juncar, Patrick and Pereira Dos Santos, Franck and Merlet, S{\'e}bastien and Piquemal, Fran\c{c}ois and Genv{\`e}s, G{\'e}rard} } @Article { , title = {Low contact resistance in epitaxial graphene devices for quantum metrology}, journal = {Low contact resistance in epitaxial graphene devices}, year = {2015}, volume = {5}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {087134}, keywords = {epitaxial graphene, monolayer, measurement, Quantum Hall, bilayer, graphene, chemical sciences, Kemi}, web_url = {http://urn.kb.se/resolve?urn=urn:nbn:se:liu:diva-122071}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AMER INST PHYSICS}, language = {30}, DOI = {10.1063/1.4928653}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yager, T. and Lartsev, A. and Cedergren, K. and Yakimova, R. and Panchal, V. and Kazakova, O. and Tzalenchuk, A. and Ho Kim, K. and Woo Park, Y. and Lara-Avila, S. and Kubatkin, S.} } @Article { , title = {A study of thermal dose induced autophagy, apoptosis and necroptosis in colon cancer cells}, journal = {International Journal of Hyperthermia}, year = {2015}, volume = {31}, number = {5}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {476-488}, keywords = {Apoptosis, Autophagy, Necroptosis, Thermal Dose, High Intensity Focused Ultrasound}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/25974074}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Taylor Francis}, address = {Abingdon}, language = {30}, ISSN = {N/A}, DOI = {10.3109/02656736.2015.1029995}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mouratidis, P and Rivens, I and Ter Haar, G} } @Article { , title = {The contribution of shear wave absorption to ultrasound heating in bones: Coupled elastic and thermal modeling}, journal = {IEEE International Ultrasonics Symposium}, year = {2015}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, keywords = {Ultrasound, modelling, bone, heating, HIFU}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IEEE}, language = {30}, DOI = {10.1109/ULTSYM.2015.0296}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Treeby, BE and Saratoon, T} } @Article { , title = {Modeling power law absorption and dispersion in viscoelastic solids using a split-field and the fractional Laplacian}, journal = {J. Acoust. Soc. Am.}, year = {2015}, volume = {136}, number = {4}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1499-1510}, keywords = {Ultrasound, Modelling, Bone, Elastic, HIFU}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {ASA}, language = {30}, DOI = {10.1121/1.4894790}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Treeby, BE and Cox, BT} } @Article { , title = {Acoustical characterization of polysaccharide polymers tissue-mimicking materials}, journal = {Ultrasonics}, year = {2015}, volume = {56}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {210–219}, keywords = {Sound speed Attenuation coefficient Tissue-mimicking material Uncertainty evaluation Ultrasound}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.ultras.2014.03.018}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Cuccaro, R. and Musacchio, C. and Giuliano Albo, P.A. and Troia, A. and Lago, S.} } @Proceedings { , title = {Temperature increase dependence on ultrasound attenuation coefficient in innovative tissue-mimicking materials}, journal = {Physics Procedia}, year = {2015}, volume = {70}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {187 – 190}, keywords = {Temperature increase; attenuation coefficient; tissue-mimicking materials}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier B.V.}, event_place = {Metz (France)}, event_name = {2015 International Congress on Ultrasonics}, event_date = {10-05-2015 to 14-05-2015}, language = {30}, DOI = {10.1016/j.phpro.2015.08.109}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Cuccaro, R. and Magnetto, C. and Giuliano Albo, P.A. and Troia, A. and Lago, S.} } @Article { , title = {NOVEL EQUIPMENT FOR IN-SITU ALPHA SPECTROMETRY WITH GOOD ENERGY RESOLUTION}, journal = {Health Physics}, year = {2015}, volume = {109}, number = {6}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {601-605}, keywords = {in-situ measurements; radionuclide contamination; alpha spectrometry; spectrum unfolding}, web_url = {http://journals.lww.com/health-physics/Abstract/2015/12000/Novel_Equipment_for_In_Situ_Alpha_Spectrometry.22.aspx}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wolters, Kluwer, Lippincott Williams \& Wilkins}, address = {Philadelphia}, language = {30}, ISSN = {-}, DOI = {10.1097/HP.0000000000000360}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {P{\"o}ll{\"a}nen, R. and Turunen, J. and Karhunen, T. and Per{\"a}j{\"a}rvi, K. and Siiskonen, T. and Wirta, M. and Turunen, A.} } @Article { , title = {Primary standardization of SIR-Spheres based on the dissolution of the 90Y-labelled resin microspheres}, journal = {Applied Radiation and Isotopes}, year = {2015}, volume = {97}, number = {-}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {170 176}, keywords = {Radionuclide metrology, SIR-Spheres standardization, 90Y-labelled resin microspheres, Dissolution of ion exchange resin, TDCR method, Calibration factors of ionization chambers}, web_url = {-}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0969 8043}, DOI = {10.1016/j.apradiso.2014.12.024}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S0969804314004515}, author = {Louren\c{c}o, VL and Bobin, CB and Chist{\'e}, VC and Lacour, DL and Rigoulay, FR and Tapner, MT and Thiam, CT and Ferreux, LF} } @Proceedings { , title = {A method for in-situ measurement of grid impedance and load impedance at 2 k – 150 kHz}, journal = {Power Electronics and ECCE Asia (ICPE-ECCE Asia), 2015 9th International Conference on}, year = {2015}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {443-448}, keywords = {Electromagnetic interference (EMI), grid impedance, load impedance, in-situ measurement}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7167823\&isnumber=7167754}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {New York}, event_place = {Seoul, Korea}, event_name = {2015 9th International Conference on Power Electronics and ECCE Asia (ICPE-ECCE Asia)}, event_date = {1-5 June 2015}, language = {30}, ISBN = {978-8-9570-8254-6}, DOI = {10.1109/ICPE.2015.7167823}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Tan, J and Zhao, D and Ferreira, B} } @Article { , title = {Single-photon emitters based on NIR color centers in diamond coupled with solid immersion lenses}, journal = {International Journal of Quantum Information}, year = {2014}, month = {12}, day = {10}, volume = {12}, number = {07n08}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {1560011}, keywords = {Diamond; single-photon emitters; color centers.}, web_url = {http://www.worldscientific.com/worldscinet/ijqi}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {worldscientific}, address = {Singapore}, language = {30}, ISSN = {0219-7499}, DOI = {10.1142/S0219749915600114}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gatto Monticone, D. and Forneris, J. and Levi, M. and Picollo, F. and Olivero, P. and Traina, P. and E. Moreva, E. and Enrico, E. and Brida, G. and Degiovanni, I. P. and Genovese, M. and Amato, G. and Boarino, L.} } @Article { IthierTM2014_2, title = {Direct spectral analysis of environmental noise in SQUID and SQUBIT type circuits using a Josephson bifurcation amplifier}, journal = {Journal of Physics (Conference Series)}, year = {2014}, month = {12}, day = {8}, volume = {568}, number = {5}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, keywords = {Josephson bifurcation amplifier, spectrum analysis, threshold detector}, web_url = {http://iopscience.iop.org/1742-6596/568/5/052021/pdf/1742-6596_568_5_052021.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {1742-6596}, DOI = {10.1088/1742-6596/568/5/052021}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ithier, G and Tancredi, G and Meeson, P J} } @Article { TancrediIM2014, title = {Spectroscopy of the modes of a non-linear superconducting microwave resonator via inter-mode coupling and bifurcation amplification}, journal = {Journal of Physics (Conference Series)}, year = {2014}, month = {12}, day = {8}, volume = {568}, number = {5}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, keywords = {Josephson bifurcation amplifier, spectrum analysis, threshold detector}, web_url = {http://iopscience.iop.org/1742-6596/568/5/052022/pdf/1742-6596_568_5_052022.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {1742-6596}, DOI = {10.1088/1742-6596/568/5/052022}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Tancredi, G and Ithier, G and Meeson, P J} } @Article { , title = {Micro-flow facility for traceability in steady and pulsating flow}, journal = {Flow measurement and instrumentation}, year = {2014}, month = {12}, day = {8}, volume = {44}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {34-42}, keywords = {Micro-flow, Liquid, Dynamic, gravimetric, calibration, Pulsating flow}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1016/j.flowmeasinst.2014.11.008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bissig, H. and Tschannen, M. and Huu, M. de} } @Article { , title = {High-accuracy coherent optical frequency transfer over a doubled 642-km fiber link}, journal = {Applied Physics B}, year = {2014}, month = {12}, volume = {117}, number = {3}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {979 - 986}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1007/s00340-014-5917-8}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Calonico, D. and Bertacco, E. K. and Calosso, C. E. and Clivati, C. and Costanzo, G. A. and Frittelli, M. and Godone, A. and Mura, A. and Poli, N. and Sutyrin, D. V. and Tino, G. and Zucco, M. E. and Levi, F.} } @Article { RaffaeleLCCVVPPMRT2014, title = {Dosimetric characterization of a synthetic single crystal diamond detector in a clinical 62MeV ocular therapy proton beam}, journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment}, year = {2014}, month = {12}, volume = {767}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {310-317}, keywords = {synthetic diamond detector, proton beam, ocular therapy}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2014.09.004}, stag_bib_extends_levelofaccess = {NA}, author = {Raffaele, L. and La Rosa, R.M. and Cuttone, G. and Cirrone, G.A.P. and Verona-Rinati, G. and Verona, C. and Prestopino, G. and Pompili, F. and Marinelli, M. and Romano, F. and Tuv{\`e}, C.} } @Article { HapalaTSJ2014, title = {Origin of High-Resolution IETS-STM Images of Organic Molecules with Functionalized Tips}, journal = {Physical Review Letters}, year = {2014}, month = {11}, day = {28}, volume = {PRL 113}, number = {226101}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {226101-1 - 226101-5}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, DOI = {10.1103/PhysRevLett.113.226101}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hapala, Prokop and Temirov, Ruslan and Stefan Tautz, F. and Jel{\'i}nek, Pavel} } @Article { RastelloDSKCPSMIKSHKTBMPTACMKV2014, title = {Metrology for industrial quantum communications: the MIQC project}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {10}, keywords = {Metrology, quantum cryptography, quantum communication}, web_url = {http://iopscience.iop.org/0026-1394/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S267}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rastello, M L and Degiovanni, I P and Sinclair, A G and K{\"u}ck, S and Chunnilall, C J and Porrovecchio, G and Smid, M and Manoocheri, F and Ikonen, E and Kubarsepp, T and Stucki, D and Hong, K S and Kim, S K and Tosi, A and Brida, G and Meda, A and Piacentini, F and Traina, P and Al Natsheh, A and Cheung, J Y and M{\"u}ller, I and Klein, R and Vaigu, A} } @Article { , title = {Fabrication and Characterization of Fast TESs With Small Area for Single Photon Counting}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2014}, month = {11}, day = {20}, volume = {25}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {2101004}, keywords = {Transition edge sensors}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6963295}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {not known}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2367455}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Portesi, C and Taralli, E and Lolli, L and Rajteri, M and Monticone, E} } @Article { , title = {New source and detector technology for the realization of photometric units}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry}, pages = {197-202}, keywords = {candela photometry radiometry}, web_url = {http://iopscience.iop.org/journal/0026-1394}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0195-928X}, DOI = {10.1088/0026-1394/51/6/S276}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Timo D{\"o}nsberg, T. and Tomi Pulli, T. and Tuomas Poikonen, T. and Hans Baumgartner, H. and Anna Vaskuri, A. and Meelis Sildoja, M. and Farshid Manoocheri, F. and Petri K{\"a}rh{\"a}, P. and Erkki Ikonen, E.} } @Article { SchneidmillerBCTSSZRYSBY2014, title = {Time-dependent wave front propagation simulation of a hard x-ray split-and-delay unit: Towards a measurement of the temporal coherence properties of x-ray free electron lasers}, journal = {Physical Review Special Topics - Accelerators and Beams}, year = {2014}, month = {11}, day = {18}, volume = {17}, number = {11}, number2 = {SIB58: Angles: Angle metrology}, keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {1098-4402}, DOI = {10.1103/PhysRevSTAB.17.110705}, stag_bib_extends_levelofaccess = {NA}, author = {Schneidmiller, E. and Buzmakov, A. and Chubar, O. and Tschentscher, Th. and Sinn, H. and Samoylova, L. and Zacharias, H. and Roling, S. and Yurkov, M. V. and Siewert, F. and Braun, S. and Yandayan, T.} } @Article { , title = {Reduced active area in transition-edge sensors for visible-NIR photon detection: a comparison of experimental data and two-fluid model}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2014}, month = {11}, day = {6}, volume = {25}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {2200304}, keywords = {Transition-edge sensors, photons, photon-number resolving detectors}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6949073}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {Unknown}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2367469}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Taralli, E and Lolli, L and Portesi, C and Rajteri, M and Monticone, E and Wang, T. S. and Chen, J. K. and Zhou, X} } @Article { MaringerSKCPGCDVHRMSJDTAHM2014, title = {Radioactive waste management: Review on clearance levelsand acceptance criteria legislation, requirements and standards}, journal = {Applied Radiation and Isotopes}, year = {2014}, month = {11}, volume = {81}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, keywords = {Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal}, web_url = {http://www.sciencedirect.com/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2013.03.046}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Maringer, F.J. and Šur{\'a}ň, J. and Kov{\'a}ř, P. and Chauvenet, B. and Peyres, V. and Garc{\'i}a-Tora{\~n}o, E. and Cozzella, M.L. and De Felice, P. and Vodenik, B. and Hult, M. and Roseng{\aa}rd, U. and Merimaa, M. and Sz{\"u}cs, L. and Jeffery, C. and Dean, J.C.J. and Tymińsk, Z. and Arnold, D. and Hincam, R. and Mirescu, G.} } @Article { TesaovaBGWERCTSJNMMN2014, title = {Comparison of micromagnetic parameters of the ferromagnetic semiconductors (Ga,Mn)(As,P) and (Ga,Mn)As}, journal = {Physical Review B}, year = {2014}, month = {10}, day = {23}, volume = {90}, number = {15}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, keywords = {Comparison of micromagnetic parameters of the ferromagnetic semiconductors (Ga,Mn)(As,P) and (Ga,Mn)As}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society (APS)}, address = {1 Research Rd, Ridge, NY 11961, USA}, language = {30}, ISSN = {1098-0121, 1550-235X}, DOI = {10.1103/PhysRevB.90.155203}, stag_bib_extends_levelofaccess = {NA}, author = {Tesařov{\'a}, N. and Butkovičov{\'a}, D. and Gallagher, B. L. and Wadley, P. and Edmonds, K. W. and Rushforth, A. W. and Campion, R. P. and Troj{\'a}nek, F. and Schmoranzerov{\'a}, E. and Jungwirth, T. and Nov{\'a}k, V. and Motloch, P. and Mal{\'y}, P. and Němec, P.} } @Article { , title = {Novel and improved techniques for traceable temperature dissemination}, journal = {High Temperatures-High Pressures,}, year = {2014}, month = {10}, day = {13}, volume = {43}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {1-11}, keywords = {Temperature, thermometer, ITS-90, traceability, fixed points, standard platinum resistance thermometer, radiation thermometer, thermocouple}, web_url = {http://www.oldcitypublishing.com/HTHP/HTHPcontents/HTHP43.1contents.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0018-1544}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {del Campo, Dolores and Bojkovski, Jovan and Dobre, Miruna and Filipe, Eduarda and Kalemci, Murat and Merlone, Andrea and Pearce, Jonathan and Peruzzi, Andrea and Sparasci, Fernando and Strnad, Radek and Taubert, Dietert and Turz{\'o}-Andr{\'a}s, Emese} } @Article { , title = {Trends in single-cell analysis by use of ICP-MS}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, month = {10}, day = {1}, volume = {406 / 2014}, number = {27}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {6963–6977}, keywords = {Bioanalytical methodsCell systems/single cell analysisMass spectrometry/ICP-MS}, web_url = {http://link.springer.com/article/10.1007/s00216-014-8143-7}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer Berlin}, address = {Heidelberg}, language = {30}, ISSN = {1618-2642 (print); 1618-2650 (online)}, DOI = {10.1007/s00216-014-8143-7}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mueller, Larissa and Traub, Heike and Jakubowski, Norbert and Drescher, Daniela and Baranov, Vladimir I. and Kneipp, Janina} } @Proceedings { IvanovBDHATMS2014, title = {Experimental and numerical study of the microwave field distribution in a compact magnetron-type microwave cavity}, year = {2014}, month = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {208-211}, keywords = {atomic clock, microwave cavity, field imaging, optical pumping.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Neuchatel, Switzerland}, event_name = {28th European Frequency and Time Forum (EFTF)}, event_date = {22-26 June 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ivanov, A. and Bandi, T. and Du, G.-X. and Horsley, A. and Affolderbach, C. and Treutlein, P. and Mileti, G. and Skrivervik, A. K.} } @Article { , title = {Heterodyne multi-wavelength absolute interferometry based on a cavity-enhanced electro-optic frequency comb pair}, journal = {Optics Letters}, year = {2014}, month = {10}, volume = {39}, number = {20}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {5834-5837}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1364/OL.39.005834}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yang, R. and Pollinger, F. and Meiners-Hagen, K. and Tan, J. and Bosse, H.} } @Article { GattoMonticoneKTMFRODBG2014, title = {Beating the diffraction Abbe limit in confocal microscopy via nonclassical photon statistics}, journal = {Physical Review Letters}, year = {2014}, month = {9}, day = {30}, volume = {113}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {143602 [1 to 5]}, web_url = {http://journals.aps.org/prl/}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.113.143602}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gatto Monticone, D and Katamadze, K and Traina, P and Moreva, E and Forneris, J and Ruo-Berchera, I and Olivero, P and Degiovanni, I. P and Brida, G and Genovese, M} } @Article { , title = {Future development of biologically relevant dosimetry}, journal = {British Journal of Radiology}, year = {2014}, month = {9}, day = {26}, volume = {88}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Radiation quantities, biologically relevant dosimetry, microbeam, nanodosimetry, microdosimetry, reactive species, BioQuaRT}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0007-1285}, DOI = {10.1259/bjr.20140392}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Palmans, H. and Rabus, H. and Belchior, A. L. and Bug, M. U. and Galer, S. and Giesen, U. and Gonon, G. and Gruel, G. and Hilgers, G. and Moro, D. and Nettelbeck, H. and Pinto, M. and Pola, A. and Pszona, S. and Schettino, G. and Sharpe, P. H. G. and Teles, P. and Villagrasa, C. and Wilkens, J. J.} } @Article { , title = {Roundtrip matrix method for calculating the leaky resonant modes of open nanophotonic structures}, journal = {Journal of the Optical Society of America A}, year = {2014}, month = {9}, day = {10}, volume = {31}, number = {10}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {2142-2151}, keywords = {Mathematical methods in physics; Numerical approximation and analysis; Computational electromagnetic methods; Photonic crystals; Microcavities; Optical resonators}, web_url = {https://www.osapublishing.org/josaa/home.cfm}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {OSA Publishing}, address = {Washington}, language = {30}, ISSN = {1084-7529}, DOI = {10.1364/JOSAA.31.002142}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-9-10}, author = {Rosenkrantz de Lasson, J. and Tr{\o}st Kristensen, P. and M{\o}rk, J. and Gregersen, N.} } @Article { , title = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene}, journal = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene}, year = {2014}, month = {9}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {hot carriers, bilayer graphene, energy loss rate, magnetotransport}, web_url = {http://arxiv.org/abs/1409.6267v1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1088/0953-8984/27/16/164202}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, J. and Alexander-Webber, J.A. and Janssen, T.J.B.M. and Tzalenchuk, A. and Yager, T. and Lara Avila, S. and Kubatkin, S. and Myers-Ward, R. L. and Gaskill, D. K. and Nicholas, R.J.} } @Article { , title = {Biologically Weighted Quantities in Radiotherapy: an EMRP Joint Research Project}, journal = {EPJ Web of Conferences}, year = {2014}, month = {8}, day = {19}, volume = {77}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Radiation units, dose, microbeam, nanodosimetry, microdosimetry}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {2100-014X}, DOI = {10.1051/epjconf/20147700021}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rabus, H. and Palmans, H. and Hilgers, G. and Sharpe, P. and Pinto, M. and Villagrasa, C. and Nettelbeck, H. and Moro, D. and Pola, A. and Pszona, S. and Teles, P.} } @Article { KungMNT2014, title = {Application of a virtual coordinate measuring machine for measurement uncertainty estimation of aspherical lens parameters}, journal = {Measurement Science and Technology}, year = {2014}, month = {8}, day = {12}, volume = {25}, number = {9}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {microcoordinate metrology, asphere, measurement uncertainty, Monte Carlo simulation, virtual CMM}, web_url = {http://iopscience.iop.org/0957-0233/25/9/094011}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1088/0957-0233/25/9/094011}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ng, A. and Meli, F. and Nicolet, A. and Thalmann, R.} } @Article { , title = {Tuning carrier density across Dirac point in epitaxial graphene on SiC by corona discharge.}, journal = {Applied Physics Letters}, year = {2014}, month = {8}, day = {12}, volume = {105}, number = {6}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {063106}, keywords = {dirac point, graphene, SiC}, web_url = {http://scitation.aip.org/content/aip/journal/apl/105/6/10.1063/1.4892922}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.4892922}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lartsev, A. and Yager, T. and Bergsten, T. and Tzalenchuk, A. and Janssen, T.J.B.M. and Yakimova, R. and Lara-Avila, S. and Kubatkin, S.} } @Article { GoveniusLTPJMVM2014, title = {Microwave nanobolometer based on proximity Josephson junctions}, journal = {Physical Review B}, year = {2014}, month = {8}, day = {11}, volume = {90}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, keywords = {74.78.Na, 07.57.Kp, 74.45.+c, 85.25.Cp}, web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.90.064505}, web_url2 = {http://arxiv.org/abs/1403.6586}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {1098-0121}, DOI = {10.1103/PhysRevB.90.064505}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Govenius, J. and Lake, R. E. and Tan, K. Y. and Pietil{\"a}, V. and Julin, J. K. and Maasilta, I. J. and Virtanen, P. and M{\"o}tt{\"o}nen, M.} } @Article { , title = {Surface Analytical Study of Poly(acrylic acid)-Grafted Microparticles (Beads): Characterization, Chemical Derivatization, and Quantification of Surface Carboxyl Groups}, journal = {The Journal of Physical Chemistry C}, year = {2014}, month = {8}, day = {8}, volume = {118}, number = {35}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, web_url = {http://pubs.acs.org/doi/abs/10.1021/jp505519g}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {1932-7447}, DOI = {10.1021/jp505519g}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Dietrich, P.M. and Hennig, A. and Holzweber, M. and Thiele, T. and Borcherding, H. and Lippitz, A. and Schedler, U. and Resch-Genger, U. and Unger, W. E. S.} } @Proceedings { , title = {Graphene metrology}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {662-663}, keywords = {C,Conductivity,Graphene,Metrology,Microwave measurement,Resistance,Silicon carbide,Substrates,electrical conductivity measurement,functional property,graphene,graphene metrology,graphene morphology,graphene topography,industrial production,joining processes,linking morphology,measurement standards,microwave materials,microwave measurement,noncontact microwave conductivity measurement,quality control,quantum Hall effect,rapid noninvasive quality control}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898559}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898559}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Giusca, C. and Gallop, J. and Hao, L. and Kazakova, O. and Panchal, V. and Pierce, R. and Tzalenchuk, A.} } @Proceedings { , title = {CVD Graphene for Electrical Quantum Metrology}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014),}, year = {2014}, month = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {540--541}, keywords = {C,CVD graphene,Chemical Vapor Deposition (CVD),Copper (Cu),Electrical resistance measurement,Films,Graphene,Graphene (G),Magnetic field measurement,Quantum Hall effect (QHE),Raman spectra,Raman spectroscopy,Resistance,Substrates,Temperature measurement,chemical vapor deposition,chemical vapour deposition,electric variables measurement,electrical quantum metrology,electrical transport measurements,graphene,quantum Hall effect}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898498}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898498}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Thodkar, K. and Nef, C. and Fu, W. and Sch{\"o}nenberger, C. and Calame, M. and L{\"u}{\"o}nd, F. and Overney, F. and Jeanneret, B.} } @Article { KaiserRDYWGFCOSDSWBLLTMWY2014, title = {Interlaboratory assessment of nitrous oxide isotopomer analysis by isotope ratio mass spectrometry and laser spectroscopy: current status and perspectives}, journal = {Rapid Communications in Mass Spectrometry}, year = {2014}, month = {8}, volume = {28}, number = {18}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {1995-2007}, keywords = {mass spectroscopy, laser spectroscopy}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0951-4198}, DOI = {10.1002/rcm.6982}, stag_bib_extends_levelofaccess = {NA}, author = {Kaiser, J. and Ridley, A.R. and Doucett, R.R. and Yarnes, C.T. and Well, R. and Giesemann, A. and Forbes, M. and Casciotti, K.L. and Ostrom, N.E. and Szwec, L. and Dyckmans, J. and Steiker, A.E. and Wissel, H. and Br{\"u}ggemann, N. and Liang, M.C. and Lin, C.T. and Toyoda, S. and Mohn, J. and Wolf, B. and Yoshida, N.} } @Article { PanchalLMYTK2014, title = {Visualisation of edge effects in side-gated graphene nanodevices}, journal = {SCIENTIFIC REPORTS}, year = {2014}, month = {7}, day = {30}, volume = {4 : 5881}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1038/srep05881}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, Vishal and Lartsev, Arseniy and Manzin, Alessandra and Yakimova, Rositza and Tzalenchu, Alexander and Kazakova, Olga} } @Article { , title = {Improved limit on a temporal variation of mp=me from comparisons of Yb+ and Cs atomic clocks}, journal = {Phys. Rev. Lett. 113}, year = {2014}, month = {7}, day = {17}, volume = {210802 (2014)}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {https://arxiv.org/abs/1407.4408}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Huntemann, N. and Lipphardt, B. and Tamm, C. and Gerginov, V. and Weyers, S. and Peik, E.} } @Article { , title = {The accuracy and precision of the advanced Poisson dead-time correction and its importance for multivariate analysis of high mass resolution ToF-SIMS data}, journal = {Surface and Interface Analysis}, year = {2014}, month = {6}, day = {27}, volume = {46}, number = {9}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {581-590}, keywords = {Toff-Simms, mass spectrometry imagery.}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5543/abstract}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wiley}, address = {Hoboken}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.5543}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Tyler, B.} } @Article { , title = {A comparison of methods for focusing the field of a HIFU array transducer through human ribs}, journal = {Physics in Medicine and Biology}, year = {2014}, month = {6}, day = {21}, volume = {59}, number = {12}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {3139-71}, keywords = {Ultrasound, modelling, ribs, scattering}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IoP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {ISSN: 0031-9155}, DOI = {10.1088/0031-9155/59/12/3139}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-7-1}, author = {Gelat, PN and ter Haar, G and Saffari, N} } @Article { WoszczynaWGWWSWAT2014, title = {All-Carbon Vertical van der Waals Heterostructures: Non-destructive Functionalization of Graphene for Electronic Applications}, journal = {Wiley Online Library- Advanced Materials}, year = {2014}, month = {5}, day = {23}, volume = {26}, number = {28}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {1521-4095}, keywords = {graphene heterostructures,electric and electromagnetic transport, carbon nanomembrane, chemical functionalization,field-effect devices, molecular self-assembly, graphene-based nanosensors}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1002/adma.201400948}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Woszczyna, M. and Winter, A. and Grothe, M. and Willunat, A. and Wundrack, S. and Stosch, R. and Weimann, T. and Ahlers, F. and Turchanin, A.} } @Article { ChuaCLYLKKFYPJTS2014, title = {Quantum Hall Effect and Quantum Point Contact in Bilayer-Patched Epitaxial Graphene}, journal = {Nano Letters}, year = {2014}, month = {5}, day = {21}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {SiC epitaxial graphene, quantum hall e ff ect, scanning gate microscopy, monolayer and bilayer graphene, resistance metrology, quantum point contact}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1021/nl5008757}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Chua, Cassandra and Connolly, Malcolm and Lartsev, Arseniy and Yager, Tom and Lara-Avila, Samuel and Kubatkin, Sergey and Kopylov, Sergey and Falko, Vladimir and Yakimova, Rositza and Pearce, Ruth and Janssen, T. J. B. M. and Tzalenchuk, Alexander and Smith, Charles G.} } @Article { IthierTM2014, title = {Direct spectrum analysis using a threshold detector with application to a superconducting circuit}, journal = {New Journal of Physics}, year = {2014}, month = {5}, day = {14}, volume = {16}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, keywords = {Josephson bifurcation amplifier, spectrum analysis, threshold detector}, web_url = {http://iopscience.iop.org/1367-2630/16/5/055010/pdf/1367-2630_16_5_055010.pdf}, web_url2 = {http://iopscience.iop.org/1367-2630/16/5/055010/pdf/1367-2630_16_5_055010.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/16/5/055010}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ithier, G. and Tancredi, G. and Meeson, P.J.} } @Proceedings { , title = {Evaluation of electric fields induced in the patient during body rotations in the static magnetic field of a MRI-LINAC system}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2014}, month = {5}, day = {10}, volume = {22}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/14/}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Milan, Italy}, event_name = {Joint Annual Meeting ISMRM-ESMRMB}, event_date = {10-16 May 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Trakic, A. and Liu, L. and Sanchez Lopez, H. and Zilberti, L. and Liu, F. and Weber, E. and Crozier, S.} } @Article { GattoMonticoneTMFODTGBAG2014, title = {Native NIR-emitting single colour centres in CVD diamond}, journal = {New Journal of Physics}, year = {2014}, month = {5}, day = {1}, volume = {16}, number = {5}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, keywords = {diamond, photoluminescence, single defects, single photon sources, confocal microscopy}, web_url = {http://iopscience.iop.org/1367-2630}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/16/5/053005}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gatto Monticone, D. and Traina, P. and Moreva, E. and Forneris, J. and Olivero, P. and Degiovanni, I. P. and Taccetti, F. and Giuntini, L. and Brida, G. and Amato, G. and Genovese, M.} } @Proceedings { GattoMonticoneTMFLBDABOG2014, title = {High performing SPS based on native NIR-emitting single colour centers in diamond}, journal = {Proc. SPIE 9136, Nonlinear Optics and Its Applications VIII; and Quantum Optics III}, year = {2014}, month = {5}, day = {1}, volume = {9136}, number = {8}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, web_url = {http://spie.org}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brussels, Belgium}, event_name = {Nonlinear Optics and Its Applications VIII; and Quantum Optics III}, event_date = {April 14, 2014}, language = {English}, DOI = {10.1117/12.2051714}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gatto Monticone, D and Traina, P and Moreva, E and Forneris, J and Levi, M and Brida, G and Degiovanni, I. P and Amato, G and Boarino, L and Olivero, P and Genovese, M} } @Article { , title = {A primary standard of optical power based on induced-junction silicon photodiodes operated at room temperature}, journal = {Metrologia}, year = {2014}, month = {5}, day = {1}, volume = {51}, number = {3}, number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry}, pages = {197-202}, keywords = {Absolute radiometry}, web_url = {http://iopscience.iop.org/journal/0026-1394}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/3/197}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Timo D{\"o}nsberg1,2,, T. and Meelis Sildoja2,, F. and Farshid Manoocheri1,2,, M. and Mikko Merimaa1,, M. and Leo Petroff3, E. and Erkki Ikonen1,2, L.} } @Article { PiacentiniMTHDBGRGR2014, title = {Measurement facility for the evaluation of the backscattering in fiber: Realization of an OTDR operating at single photon level}, journal = {International Journal of Quantum Information}, year = {2014}, month = {4}, day = {30}, volume = {12}, number = {02}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {1461014 [1 to 8]}, keywords = {OTDR; single photon detector; quantum information}, web_url = {http://www.worldscientific.com/worldscinet/ijqi}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0219-7499}, DOI = {10.1142/S0219749914610140}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, Fabrizio and Meda, Alice and Traina, Paolo and Hong, Kee Suk and Degiovanni, Ivo Pietro and Brida, Giorgio and Gramegna, Marco and Ruo Berchera, Ivano and Genovese, Marco and Rastello, Maria Luisa} } @Article { , title = {Detecting multiparticle entanglement of Dicke states}, journal = {Phys. Rev. Lett.}, year = {2014}, month = {4}, day = {17}, volume = {112}, number = {15}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {155304}, keywords = {67.85.−d, 03.67.Bg, 03.67.Mn, 03.75.Mn}, web_url = {http://arxiv.org/abs/1403.4542v2}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.112.155304}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\"u}cke, B and Peise, J and Vitagliano, G and Arlt, J and Santos, L and T{\'o}th, G and Klempt, C} } @Article { , title = {Thermal desorption mass spectrometer for mass metrology}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS 85, 045111 (2014)}, year = {2014}, month = {4}, day = {14}, volume = {85}, number = {85}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {045111}, keywords = {Thermal, desorption, mass spectrometer, mass metrology}, web_url = {http://scitation.aip.org/docserver/fulltext/aip/journal/rsi/85/4/1.4870921.pdf?expires=1460456419\&id=id\&accname=2118383\&checksum=AC3FCE73DE77059689EE889598D57A63}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, DOI = {10.1063/1.4870921}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Silvestri, Z and Azouigui, S and Bouhtiyya, S and Mac{\'e}, S and Plimmer, M D and Pinot, P and Tayeb-Chandoul, F and Hannachi, R} } @Article { , title = {Recent advances in vacuum sciences and applications}, journal = {Journal of Physics D: Applied Physics}, year = {2014}, month = {3}, day = {27}, volume = {47}, number = {15}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, pages = {24}, keywords = {vacuum, surface, plasma, interface, nanoscience}, web_url = {http://iopscience.iop.org/article/10.1088/0022-3727/47/15/153001}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0022-3727}, DOI = {10.1088/0022-3727/47/15/153001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-3-27}, author = {Mozetič, M and Ostrikov, K and Ruzic, D.N and Curreli, D and Cvelbar, U and Tagliaferro, A and Conde, O. and Silvestre, A.J and Giapintzakis, J. and Buljan, M. and Radić, N. and Dražić, G. and Bernstorff, S. and Biederman, H. and Kyli{\'a}n, O. and Hanuš, J. and Miloševič, S. and Galtayries, A. and Dietrich, P. and Unger, W. and Sedlarik, V. and Stana-Kleinschek, K. and Drmota-Petrič, A. and Pireaux, J.J and Rogers, J.,.W and Anderle, M.} } @Article { , title = {Performance metrics for testing statistical calculations in interlaboratory comparisons}, journal = {Advances in Production Engineering \& Management}, year = {2014}, month = {3}, day = {12}, volume = {9}, number = {1}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {44-52}, keywords = {Interlaboratory comparisons, Data generator, Software validation}, tags = {MAT}, web_url = {http://apem-journal.org/Archives/2014/Abstract-APEM9-1_044-052.html}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Production Engineering Institute (PEI), University of Maribor}, address = {Maribor}, language = {30}, ISSN = {1854-6250}, DOI = {10.14743/apem2014.1.175}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Acko, BA and Sluban, BS and Tasic, TT and Brezovnik, SB} } @Article { HusuSLSTL2014, title = {Scatterometer for characterization of diffractive optical elements}, journal = {Measurement Science and Technology}, year = {2014}, month = {3}, day = {5}, volume = {25}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Diffraction gratings, metrology, nanoscale materials and structures}, web_url = {http://iopscience.iop.org/0957-0233/25/4/044019/article?fromSearchPage=true}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1088/0957-0233/25/4/044019}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Husu, H. and Saastamoinen, T. and Laukkanen, J. and Siitonen, S. and Turunen, J. and Lassila, A.} } @Article { TrakicLLZLC2014, title = {Numerical Safety Study of Currents Induced in the Patient During Rotations in the Static Field Produced by a Hybrid MRI-LINAC System}, journal = {IEEE TRANSACTIONS ON BIOMEDICAL ENGINEERING}, year = {2014}, month = {3}, volume = {61}, number = {3}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {784-793}, keywords = {Body model, electric field and current density, MRI-LINAC, magnetic resonance imaging (MRI) patient safety, quasi-static finite-difference (QSFD).}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {0018-9294}, DOI = {10.1109/TBME.2013.2289924}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Trakic, Adnan and Liu, Limei and Lopez, Hector Sanchez and Zilberti, Luca and Liu, Feng and Crozier, Stuart} } @Article { TammHLGNKWP2014, title = {Cs-based optical frequency measurement using cross-linked optical and microwave oscillators}, journal = {Physical Review A}, year = {2014}, month = {2}, day = {14}, volume = {89}, number = {2014}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.023820\#abstract}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, DOI = {10.1103/PhysRevA.89.023820}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Tamm, Chr. and Huntemann, N. and Lipphardt, B. and Gerginov, V. and Nemitz, N. and Kazda, M. and Weyers, S. and Peik, E.} } @Article { , title = {Dark injection transient spectroscopy and density of states in amorphous organics}, journal = {Organic Electronics}, year = {2014}, month = {1}, day = {1}, volume = {15}, number = {1}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {226-239}, keywords = {DITS, Polymer film, Charge trapping, DOS, Gaussian disorder, Exponential tail}, web_url = {http://www.sciencedirect.com/science/article/pii/S1566119913005016}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, language = {30}, ISSN = {1566-1199}, DOI = {10.1016/j.orgel.2013.11.014}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Jurić, IJ and Tutiš, ET} } @Proceedings { BergstenETR2014, title = {An active filter for Delta-Sigma modulated Josephson waveforms}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {518 to 519}, keywords = {Active filters, low pass filters, analog circuits, harmonic distortion, Josephson voltage standards}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 to 29 August 2014}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898487}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bergsten, Tobias and Eklund, Gunnar and Tarasso, Valter and Rydler, Karl-Erik} } @Proceedings { EklundBTR2014, title = {Progress towards an Impedance Bridge using two Programmable Josephson Voltage Standards}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {224 - 225}, keywords = {Josephson voltage standard, Josephson array,voltage measurement, impedance bridge.}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898340}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898340}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Eklund, Gunnar and Bergsten, Tobias and Tarasso, Valter and Rydler, Karl-Erik} } @Proceedings { Margolis2014, title = {International Timescales with Optical Clocks}, journal = {Proceedings of European Frequency and Time Forum \& International Frequency Control Symposium (EFTF/IFC)}, year = {2014}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {908-911}, keywords = {geodesy, international timescales, optical clock, redefinition of the second, time and frequency transfer}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6702183}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Prague, Czech Republic}, event_name = {European Frequency and Time Forum \& International Frequency Control Symposium (EFTF/IFC)}, event_date = {21 - 25 July 2013}, language = {English}, DOI = {10.1109/EFTF-IFC.2013.6702183}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Margolis, H. and Godun, R. and Gill, P. and Johnson, L. and Shemar, L. and Whibberley, P. and Calonico, D. and Levi, F. and Lorini, L. and Pizzocaro, M. and Delva, P. and Bize, S. and Achkar, J. and Denker, H. and Timmen, L. and Voigt, C. and Falke, S. and Piester, D. and Lisdat, C. and Sterr, U. and Vogt, S. and Weyers, S. and Gersl, J. and Lindvall, T. and Merimaa, M.} } @Proceedings { KummeTRBGA2014, title = {Force traceability within the meganewton range}, journal = {Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque}, year = {2014}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {2}, keywords = {Force, Build-up Systems, Mega Newton}, web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-027.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Cape Town, Republic of South Africa}, event_name = {IMEKO 22nd TC3, 15th TC5 and 3rd TC22 International Conferences}, event_date = {3 to 5 February}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kumme, R. and Tegtmeier, F. and R{\"o}ske, D. and Barthel, A. and Germak, A. and Averlant, P.} } @Proceedings { TrincheraSPLMFRRS2014, title = {Wideband digital modular system for dynamic characterization of PJVS}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {114 to 115}, keywords = {Digital-analog conversion, signal synthesis, sampling methods, Josephson junctions}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898285}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Trinchera, B and Sosso, A and Pogliano, U and Lacquaniti, V and Monticone, E and Fretto, M and Rocci, R and Roncaglione Tet, L and Serazio, D} } @Proceedings { SossoTMFRRSL2014, title = {Operation of SNIS arrays in a cryocooler}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {658 to 659}, keywords = {PJAVS, Voltage standards, Josephson junctions, cryocoolers}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 to 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898557}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Sosso, A and Trinchera, B and Monticone, E and Fretto, M and Rocci, R and Roncaglione, L and Serazio, D and Lacquaniti, V} } @Article { CaroTHLMC2014, title = {Characterization of 226Ra activity in low-level slag reference standards}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2014}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, keywords = {EURAMET; EMRP; MetroMetal; low-level 226Ra slag source; underground laboratory; HADES; HPGe-detector; gamma-ray spectrometry}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0236-5731}, DOI = {10.1007/s10967-014-3851-1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Caro, B. and Tzika, F. and Hult, M. and Lutter, G. and Mejuto, M. and Crespo, T.} } @Article { SvecCSAWCMPBTGdT2014_2, title = {Ionising radiation metrology for the metallurgical industry}, journal = {International Journal of Metrology and Quality Engineering}, year = {2014}, volume = {5}, number = {3}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {301}, keywords = {Ionising radiation measurements / interlaboratory comparisons / EURAMET / EMRP}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {EDP Sciences}, language = {30}, ISSN = {2107-6839, 2107-6847}, DOI = {10.1051/ijmqe/2014010}, stag_bib_extends_levelofaccess = {NA}, author = {Svec, A. and Carconi, P. and Sochor, V. and Arnold, D. and W{\"a}tjen, U. and Crespo, T. and Mejuto, M. and Peyres, V. and Burda, O. and Tzika, F. and Garc{\'i}a-Tora{\~n}o, E. and De Felice, P. and Tecl, J.} } @Proceedings { KohlmannBKDSSTGMJONLIWLVBECHvO2014, title = {A quantum standard for sampled electrical measurements - main goals and first results of the EMRP project Q-WAVE}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {522 - 523}, keywords = {AC Josephson voltage standards European Metrology Research Programme (EMRP) binary-divided Josephson series arrays pulse-driven Josephson series arrays}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898489}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kohlmann, J. and Behr, R. and Kieler, O. and Diaz de Aguilar Rois, J. and Sira, M. and Sosso, A. and Trinchera, B. and Gran, J. and Malmbekk, H. and Jeanneret, B. and Overney, F. and Nissil{\"a}, J. and Lehtonen, T. and Ireland, J. and Williams, J. and Lapuh, R. and Voljc, B. and Bergsten, T. and Eklund, G. and Coskun Ozturk, T. and Houtzager, E. and van den Brom, H.E. and Ohlckers, P.} } @Proceedings { NissilaOKKMCOCCDTPOKPR2014, title = {A precise two-channel digitally synthesized AC voltage source for impedance metrology}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {768 - 769}, keywords = {Digital signal source, digital-to-analog converter, impedance ridge, standard}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898612}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nissil{\"a}, J. and Ojasalo, K. and Kampik, M. and Kaasalainen, J. and Maisi, V. and Casserly, M. and Overney, F. and Christensen, A. and Callegaro, L. and D'Elia, V. and Tran, N. T. M. and Pourdanesh, F. and Ortolano, M. and Kim, D. B. and Penttil{\"a}, J. and Roschier, L.} } @Proceedings { SanchezLopezZBHPTCC, title = {Heating of bilateral hip prostheses in a human body model induced by a multi-axis gradient coil set}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2014}, volume = {22}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/14/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Milan, Italy}, event_name = {Joint Annual Meeting ISMRM-ESMRMB}, event_date = {10-16 May 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Sanchez-Lopez, H. and Zilberti, L. and Bottauscio, O. and Hand, J. and Papadaki, A. and Tang, F. and Chiampi, M. and Crozier, S.} } @Article { ThomasEBGBPJP2014, title = {Minimization of the coil movement of the LNE watt balanceduring weighing mode and estimation of parasitic forces and torques involved}, journal = {Metrologia}, year = {2014}, volume = {51}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {S54, S64}, keywords = {watt balance, alignment, LNE}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1088/0026-1394/51/2/S54}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Thomas, Matthieu and Espel, Patrick and Briand, Yves and Genev{\`e}s, G{\'e}rard and Bielsa, Franck and Pinot, Patrick and Juncar, Patrick and Piquemal, Fran\c{c}ois} } @Proceedings { IrelandHWKKBGMLT2014, title = {An opto-electronic coupling for pulsedriven Josephson junction arrays}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {124 - 125}, keywords = {Measurement, metrology, voltage measurement, Josephson arrays, opto-electronics, Josephson arbitrary waveform synthesizer.}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898290}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ireland, J. and Henderson, D. and Williams, J. and Kieler, O. and Kohlmann, J. and Behr, R. and Gran, J. and Malmbekk, H. and Lind, K. and Tang, Chi Kwong} } @Proceedings { OzturkKKMBCATA2014, title = {ERROR ANALYSIS IN WAVEFORMS SYNTHESIZED WITH A COMBINED JOSEPHSON SYSTEM FOR AC COMPONENT CHARACTERIZATION}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {734 - 735}, keywords = {analog to digital converter, error analysis, Josephson voltage standards, sampling techniques}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6898595\&refinements\%3D4270696875\%26queryText\%3DCPEM+2014}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898595}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {{\"O}zt{\"u}rk, T. C. and Kohlmann, J. and Kieler, O. and M{\"o}hring, T. and Behr, R. and \c{C}aycı, H. and Arifovi\c{c}, M. and Turhan, S. and Ata, L.D.} } @Proceedings { , title = {Modeling of a tunable-barrier non-adiabatic electron pump beyond the decay cascade model}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {536-537}, keywords = {electron pump, quantum dot, quantum metrology, tunneling, single-electron transport}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kashcheyevs, Vyacheslavs and Timoshenko, Janis} } @Proceedings { , title = {A magnetic current sensor with SQUID readout}, journal = {-}, year = {2014}, volume = {-}, number = {-}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {-}, keywords = {-}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Luca Callegaro}, address = {INRIM , Torino, Italy}, event_place = {Benevento, Italy}, event_name = {20th IMEKO TC4 International Symposium and 18th International Workshop on ADC Modelling and Testing}, event_date = {2014-09- 15-17}, language = {30}, ISBN = {-}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Callegaro, Luca and Trinchera, Bruno and Roncaglione Tet, Luca} } @Proceedings { , title = {A precise buffer for impedance metrology}, journal = {Mat. Konferencji Naukowo-Technicznej Podstawowe Problemy Metrologii PPM'14, Prace Komisji Metrologii Oddziału PAN w Katowicach}, year = {2014}, volume = {19}, number = {-}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {13-16}, keywords = {measurement system, voltage ratio measurement, calibration}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Marian Kampik}, address = {SUT, Gliwice, Poland}, event_place = {Koscielisko, Poland}, event_name = {Podstawowe Problemy Metrologii (Problems and Progress in Metrology), PPM'14}, event_date = {2014-06- 15-18}, language = {30}, ISBN = {978-83-930505-9-8}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kampik, Marian and TOKARSKI, Janusz and BARWINEK, Wojciech and RYBSKI, Ryszard and KACZMAREK, Janusz and KOZIOŁ, Mirosław} } @Proceedings { , title = {Performance verification of a dual sensor stage}, journal = {Proceedings of the 14th euspen International Conference – Dubrovnik – June 2014}, year = {2014}, volume = {I}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {P4.38, 309V1}, keywords = {nanopositioning, nanometrology, optical interferometry}, web_url = {http://www.euspen.eu/Portals/0/Content/2000-2013/Resources/Proceedings/2014\%20Dubrovnik\%20Contents\%20Pages.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {EUSPEN}, address = {Bedford}, event_place = {Dubrovnik, Croatia}, event_name = {14th international conference of the european society for precision engineering and nanotechnology}, event_date = {June 2-6, 2014}, language = {30}, ISBN = {978-0-9566790-3-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yacoot, A. and Mountford, J. and Tedaldi, M. and Reid, B. and Levy, S.} } @Proceedings { , title = {Towards Quantum Resistance Metrology Based on Graphene}, journal = {The EMRP Project GraphOhm - Towards Quantum Resistance Metrology Based on Graphene}, year = {2014}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {548-549}, keywords = {Measurement standards, resistance, quantum hall effect, graphene, C, Calibration, EMRP project GraphOhm, Electrical resistance measurement, Hall effect devices, JRP, Materials, Metrology, Resistance, Standards, electric resistance measurement, electrical measurement, intrinsically referenced resistance standard disse, joint research project, quantum resistance metrology standard, semiconductor quantum Hall device}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898502}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_date = {24-29 Aug. 2014}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898502}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ahlers, F. and Kučera, J. and Poirier, W. and Jeanneret, B. and Satrapinski, A. and Tzalenchuk, A. and Vrabček, P. and Bergsten, T. and Hwang, C. and Yakimova, R. and Kubatkin, S.} } @Proceedings { , title = {Breakdown of the quantum Hall effect in epitaxial graphene}, journal = {Breakdown of the quantum Hall effect in epitaxial graphene}, year = {2014}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {40-41}, keywords = {Current measurement,Electric breakdown,Electrical resistance measurement,Graphene,Hall effect,Hall effect devices,Resistance,SiC-C,Silicon carbide,carrier density,current density,electric breakdown,graphene,magnetic field,magnetic fields,measurement standards,phase space,polymer gated epitaxial graphene,polymers,quantum Hall effect,quantum Hall effect breakdown,quantum resistance standard,silicon compounds,wide band gap semiconductors}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898248}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_name = {CPEM2014}, event_date = {24-29 Aug. 2014}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898248}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Rozhko, S. and Tzalenchuk, A. and Alexander-Webber, J.A. and Nicholas, R.J.} } @Article { , title = {Temperature stability of SNIS Josephson arrays between 4.2 K and critical temperature in cryocooler}, journal = {IEEE Transactions on Superconductivity}, year = {2014}, volume = {25}, number = {3}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1101404 (4 pages)}, keywords = {Josephson Junctions, Voltage standards, Cryocoolers, Temperature effects, Metrology}, web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6990584\&tag=1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2383173}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Sosso, A. and Trinchera, B. and Monitcone, E. and Fretto, M. and Durandetto, P. and Lacquaniti, V.} } @Article { , title = {Linear mixed models: GUM and beyond}, journal = {Measurement Science Review}, year = {2014}, volume = {14}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {52-61}, keywords = {linear mixed models, uncertainty, GUM, ANOVA, random effects}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {De Gruyter}, language = {30}, DOI = {10.2478/msr-2014-0009}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arendack{\'a}, B and T{\"a}ubner, A and Eichst{\"a}dt, S and Bruns, Th and Elster, C} } @Article { , title = {Modelling Elastic Wave Propagation Using the k-Wave MATLAB Toolbox}, journal = {IEEE International Ultrasonics Symposium}, year = {2014}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {146-149}, keywords = {Ultrasound, modelling, bone, elastic}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IEEE}, language = {30}, DOI = {10.1109/ULTSYM.2014.0037}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Treeby, BE and Jaros, J and Rohrbach, D and Cox, BT} } @Article { , title = {In-Situ Measurement of High Frequency Emission Caused by Photo Voltaic Inverters}, journal = {Proceedings of the 2014 International Symposium on EMC (EMC Europe) Gothenburg, Sweden}, year = {2014}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {74-78}, keywords = {EMC Directive, Solar Panels, PhotoVoltaic inverters, interference Ham Radio.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6930880}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, N.J.}, language = {30}, ISSN = {2325-0356}, DOI = {10.1109/EMCEurope.2014.6930880}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Keyer, C.H. and Timens, R.B. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Time domain methods for the analysis of conducted interference on the power supply network of complex installations}, journal = {Proceedings of the 2014 International Symposium on EMC (EMC Europe) Gothenburg, Sweden}, year = {2014}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {605-610}, keywords = {power drive system; time variant periodic asynchronous; EFT; 150 kHz; LV-network; time-domain measurements}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6930977}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {2325-0356}, DOI = {10.1109/EMCEurope.2014.6930977}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {van Leersum, B.J.A.M. and Timens, R.B. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Design and Implementation of Conducted Emission Reference Source}, journal = {Proceedings of the IEEE International Symposium on EMC, Raleigh NC, 2014}, year = {2014}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {12-17}, keywords = {design, conducted emissions, reference source}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6898934}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {2158-110X}, DOI = {10.1109/ISEMC.2014.6898934}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zhao, D. and Teunisse, G. and Leferink, F.B.J.} } @Proceedings { , title = {Novel Equipment for in-situ Alpha Spectrometry}, journal = {Conference Proceedings: 8th International Conference on High Levels of Natural Radiation and Radon Areas held in Hotel Diplomat Prague, Czech Republic, 1-5 September 2014}, year = {2014}, volume = {-}, number = {-}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {96-101}, keywords = {alpha spectrometry, spectrum unfolding}, web_url = {http://www.ichlnrra2014prague.cz/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {-}, address = {-}, event_place = {Hotel Diplomat, Prague, Czech Republic}, event_name = {8th International Conference on High Levels of Natural Radiation and Radon Areas held in Hotel Diplomat Prague, Czech Republic}, event_date = {1-5 September 2014}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {P{\"o}ll{\"a}nen, R. and Turunen, J. and Karhunen, T. and Per{\"a}j{\"a}rvi, K. and Siiskonen, T. and Wirta, M. and Turunen, A.} } @Article { , title = {Spontaneous symmetry breaking in spinor Bose-Einstein condensates}, journal = {Phys. Rev. A}, year = {2013}, month = {11}, day = {19}, volume = {88}, number = {5}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {053624}, keywords = {67.85.Fg, 03.75.Lm, 03.75.Mn, 11.30.Qc}, web_url = {http://arxiv.org/abs/1309.0424}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1094-1622}, DOI = {10.1103/PhysRevA.88.053624}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Scherer, M and L{\"u}cke, B and Peise, J and Topic, O and Gebreyesus, G and Deuretzbacher, F and Ertmer, W and Santos, L and Klempt, C and Arlt, J J} } @Article { SantoniPPPMMGFDBTVV2013, title = {Radiotherapy electron beams collimated by small tubular applicators: characterization by silicon and diamond diodes}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {11}, volume = {58}, number = {22}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {8121-8133}, keywords = {electron beam, applicators, radiotherapy, silicon diode, diamond detector}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/58/22/8121}, stag_bib_extends_levelofaccess = {NA}, author = {Santoni, R and Prestopino, G and Pompili, F and Pimpinella, M and Milani, E and Marinelli, M. and Guerra, A S and Falco, M D and Di Venanzio, C and Bagal{\`a}, P and Tonnetti, A and Verona, C and Verona-Rinati, G} } @Proceedings { , title = {A multi-institute european project for providing improved and simpler traceability to the kelvin}, year = {2013}, month = {10}, day = {7}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2013/01/metrology_metr2013_15006/metrology_metr2013_15006.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Paris}, event_name = {16th International Congress of Metrology}, event_date = {October 7-10, 2013}, language = {30}, DOI = {10.1051/metrology/201315006}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {del Campo, Dolores and Bojkovski, Jovan and Dobre, Miruna and Filipe, Eduarda and Kalemci, Murat and Merlone, Andrea and Pearce, Jonathan and Peruzzi, Andrea and Sparasci, Fernando and Strnad, Radek and Taubert, Dietert and Turz{\'o}-Andr{\'a}s, Emese} } @Proceedings { PiacentiniGMDGBPPKTLRPMBG2013, title = {Some recent progresses in quantum tomography realised at INRIM}, journal = {Proc. SPIE 8875, Quantum Communications and Quantum Imaging XI}, year = {2013}, month = {9}, day = {26}, volume = {8875}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {13}, web_url = {http://spie.org}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Diego, California, United States}, event_name = {Quantum Communications and Quantum Imaging XI}, event_date = {August 25, 2013}, language = {English}, DOI = {10.1117/12.2023067}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F and Goldschmidt, E. A and Mingolla, Maria G and Degiovanni, I. P and Gramegna, M and Berchera, I. R and Polyakov, S. V and Peters, S and K{\"u}ck, S and Taralli, E and Lolli, L and Rajteri, M and Paris, M. G. A and Migdall, A and Brida, G and Genovese, M} } @Article { , title = {Extending the frequency range of free-field reciprocity calibration of measurement microphones to frequencies up to 150 kHz}, journal = {InterNoise 2013}, year = {2013}, month = {9}, day = {15}, volume = {Proceedings of inter.noise 2013}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {9}, keywords = {Free field, Microphone Calibration, Ultrasound}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {INTER-NOISE}, address = {Innsbruck, Austria}, language = {30}, ISBN = {978-1-6326S-267-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {Source-ID: 117330393}, author = {Barrera-Figueroa, S and Torras-Rosell, A and Jacobsen, F} } @Article { , title = {Magnetoencephalography of Deep Lying Auditory Sources Using Acoustical Devices for Infra- and Ultrasound Stimulation}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2013}, month = {9}, day = {7}, volume = {58\verb=^=}, number = {1E}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {2}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Biomedical Engineering / Biomedizinische Technik - DE GRUYTER}, address = {Berlin}, language = {30}, ISSN = {ISSN (Online) 1862-278X, ISSN (Print) 0013-5585}, DOI = {10.1515/bmt-2013-4135}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bauer, M and Baker, C and Barham, R and Hensel, J and Kling, C and Trahms, L and Koch, C and Sander, T} } @Article { , title = {High intrinsic energy resolution photon number resolving detectors}, journal = {Applied Physics Letters}, year = {2013}, month = {7}, day = {23}, volume = {103}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {041107-1-4}, keywords = {n/a}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Applied Physics Letters}, address = {Melville}, language = {30}, ISSN = {n/a}, DOI = {10.1063/1.4815922}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-1-1}, author = {Lolli, L and Tarali, E and Portesi, C and Monticone, E and Rajtei, M} } @Article { BertrandCCRLTSPRV2013, title = {Conversion from dose-to-graphite to dose-to-water in an 80 MeV/A carbon ion beam}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {7}, day = {23}, volume = {58}, number = {16}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {5363-5380}, keywords = {carbon ion beam, graphite to water dose conversion}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/58/16/5363}, stag_bib_extends_levelofaccess = {NA}, author = {Bertrand, D and Cuttone, G and Cirrone, P and Romano, F and Lee, N and Thomas, R and Shipley, D and Palmans, H and Rossomme, S and Vynckier, S} } @Article { BridaDGMPPT2013_2, title = {Reply to comment on the Experimental Test of an Event-Based Corpuscular Model Modification as an Alternative to Quantum Mechanics}, journal = {Physical Society of Japan}, year = {2013}, month = {7}, day = {22}, volume = {82}, number = {3}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {086001 [1]}, keywords = {foundations of quantum mechanics, event-based corpuscular model, quantum interference}, web_url = {http://journals.jps.jp/journal/jpsj}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0031-9015}, DOI = {10.7566/JPSJ.82.086002}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Brida, G. and Degiovanni, I. and Genovese, M. and Migdall, A. and Piacentini, F. and Polyakov, S. and Traina, P.} } @Article { , title = {Anti-antimicrobial Peptides: Folding mediated host-defense antagonists}, journal = {Journal of Biological Chemistry}, year = {2013}, month = {7}, day = {12}, volume = {288}, number = {28}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {20162-20172}, keywords = {Antimicrobial Peptides, Membrane Biophysics Microscopy, Molecular Dynamics, Nuclear Magnetic Resonance, Protein Design, Protein Folding}, web_url = {http://www.jbc.org/content/288/28/20162.short\#corresp-1}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {ASBMB}, address = {Maryland}, language = {30}, DOI = {10.1074/jbc.M113.459560}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ryan, Lloyd and Lamarre, Baptiste and Diu, Ting and Ravi, Jascindra and Judge, Peter J. and Temple, Adam and Carr, Matthew and Cerasoli, Eleonora and Su, Bo and Jenkinson, Howard F. and Martyna, Glenn and Crain, Sason and Watts, Anthony and Ryadnov, Maxim G.} } @Proceedings { , title = {Full characterization of optical Transition-Edge Sensor by impedance spectroscopy measurements in a bandwidth extending to 1 MHz}, journal = {IEEE}, year = {2013}, month = {7}, day = {7}, volume = {n/a}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1-4}, keywords = {transition edge sensors, quantum metrology, single photon detectors}, web_url = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=6604291\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fxpls\%2Fabs_all.jsp\%3Farnumber\%3D6604291}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, event_place = {Cambridge, Masachussetts}, event_name = {IEEE 14th International Superconductive Electronics Conference}, event_date = {07-07-2013 to 11-07-2013}, language = {30}, ISBN = {978-1-4673-6369-3}, ISSN = {n/a}, DOI = {10.1109/ISEC.2013.6604291}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lolli, L and Taralli, E and Monticone, E and Rajteri, M and Callegaro, L and Numata, T and Fukuda, D} } @Article { , title = {CALIBRATION OF ULTRASOUND BACKSCATTER TEMPERATURE IMAGING FOR HIGH-INTENSITY FOCUSED ULTRASOUND TREATMENT PLANNING}, journal = {Ultrasound in Medicine and Biology}, year = {2013}, month = {7}, day = {3}, volume = {39}, number = {9}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1596-612}, keywords = {High-intensity focused ultrasound, Ultrasound thermometry, Diagnostic ultrasound, Liver, Perfusion}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/23830100}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {N/A}, DOI = {10.1016/j.ultrasmedbio.2013.04.001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Civale, J and Rivens, I and Ter Haar, G and Morris, H and Coussios, C and Friend, P and Bamber, J} } @Article { RajkumarMCSTK2013, title = {3-D Mapping of Sensitivity of Graphene Hall Devices to Local Magnetic and Electrical Fields}, journal = {IEEE Transactions on Magnetics}, year = {2013}, month = {7}, volume = {49}, number = {7}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {Epitaxial graphene, Hall sensor, numerical modeling}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6559189}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2013.2243708}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rajkumar, R.K and Manzin, A and Cox, D.C and Silva, S.R.P and Tzalenchuk, A and Kazakova, O} } @Article { TrainaGACCDBG2013, title = {Review on recent groundbreaking experiments on quantum communication with orthogonal states}, journal = {Quantum Matter}, year = {2013}, month = {6}, day = {1}, volume = {2}, number = {3}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {153-166}, web_url = {http://www.ingentaconnect.com/content/asp/qm/2013/00000002/00000003/art00001}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {2164-7615}, DOI = {10.1166/qm.2013.1041}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Traina, P. and Gramegna, M. and Avella, A. and Cavanna, A. and Carpentras, D. and Degiovanni, I. and Brida, G. and Genovese, M.} } @Article { PolyakovPTDMBG2013, title = {Practical implementation of a test of event-based corpuscular model as an alternative to quantum mechanics}, journal = {Foundations of Physics}, year = {2013}, month = {5}, day = {8}, volume = {43}, number = {8}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {913-922}, keywords = {Single photons, Parametric down-conversion, Foundations of quantum mechanics, Local realism tests}, web_url = {http://link.springer.com/article/10.1007/s10701-013-9718-4\#}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0015-9018}, DOI = {10.1007/s10701-013-9718-4}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Polyakov, S. and Piacentini, F. and Traina, P. and Degiovanni, I. and Migdall, A. and Brida, G. and Genovese, M.} } @Proceedings { PiacentiniTDTSRGGPMGBDG2013, title = {An extremely low-noise heralded single-photon source without temporal post-selection}, journal = {SPIE 8773, Photon Counting Applications IV; and Quantum Optics and Quantum Information Transfer and Processing}, year = {2013}, month = {5}, day = {6}, volume = {8773}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {6}, web_url = {http://spie.org}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Prague, Czech Republic}, event_name = {Photon Counting Applications IV; and Quantum Optics and Quantum Information Transfer and Processing}, event_date = {April 15, 2013}, language = {English}, DOI = {10.1117/12.2017378}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F and Traina, P and Della Frera, A and Tosi, A and Scarcella, C and Ruggeri, A and Gulinatti, A and Ghioni, M and Polyakov, S. V and Migdall, A and Giudice, A and Brida, G and Degiovanni, I. P and Genovese, M} } @Proceedings { , title = {Random effects ANOVA in uncertainty evaluation}, year = {2013}, month = {5}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {39-42}, keywords = {random effects, ANOVA, type A uncertainty}, web_url = {http://www.measurement.sk/M2013/doc/proceedings/039_Arendacka-1.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Institute of Measurement Science}, address = {Bratislava}, event_place = {Smolenice, Slovakia}, event_name = {9th International Conference on Measurement}, event_date = {27-05-2013 to 30-05-2013}, language = {30}, ISBN = {978-80-969-672-5-4}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arendack{\'a}, B and T{\"a}ubner, A. and Eichst{\"a}dt, S. and Bruns, T. and Elster, C.} } @Article { AcerbiDTZ2013, title = {Fast Active Quenching Circuit for Reducing Avalanche Charge and Afterpulsing in InGaAs/InP Single-Photon Avalanche Diode}, journal = {Quantum Electronics, IEEE Journal of}, year = {2013}, month = {4}, day = {30}, volume = {49}, number = {7}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {563-569}, keywords = {Afterpulsing, avalanche photodiode, avalanche charge, optical crosstalk, quenching circuit, single photon, singlephoton avalanche diode}, web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6510432}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0018-9197}, DOI = {10.1109/JQE.2013.2260726}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Acerbi, F. and Della Frera, A. and Tosi, A. and Zappa, F.} } @Article { RossommeDMBLSAAPTK2013, title = {Fluence correction factors for graphite calorimetry in a low-energy clinical proton beam: I. Analytical and Monte Carlo simulations}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {4}, day = {30}, volume = {58}, number = {10}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {3481-3499}, keywords = {graphite calorimetry, monte carlo, fluence correction, proton beam}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/58/10/3481}, stag_bib_extends_levelofaccess = {NA}, author = {Rossomme, S and Dobrovodsk{\'y}, J and Martinkovič, J and Bassler, N and L{\"u}hr, A and Shipley, D and Andreo, P and Al-Sulaiti, L and Palmans, H and Thomas, R A S and Kacperek, A} } @Article { , title = {HadISDH: an updateable land surface specific humidity product for climate monitoring}, journal = {Climate of the Past}, year = {2013}, month = {3}, day = {14}, volume = {9}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {657–677}, web_url = {www.clim-past.net/9/657/2013/}, misc2 = {EMRP A169: Call 2010 Environment}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Willett, K. M. and Williams, C. N. Jr. and Dunn, R. J. H. and Thorne, P. W. and Bell, S. and Podesta, M. de and Jones, P. D. and Parker, D. E.} } @Article { , title = {An experimental system for the study of ultrasound exposure of isolated blood vessels}, journal = {PHYSICS IN MEDICINE AND BIOLOGY}, year = {2013}, month = {3}, day = {12}, volume = {58}, number = {7}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {2281-2304}, keywords = {Ultrasound, HIFU, blood vessels}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/23478592}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP publishing}, address = {Bristol}, language = {30}, ISSN = {N/A}, DOI = {10.1088/0031-9155/58/7/2281}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tokarczyk, A and Rivens, I and Van Bavel, E and Symonds-Tayler, R and Ter Haar, G} } @Article { BridaDGMPPT2013, title = {Experimental Test of an Event-Based Corpuscular Model Modification as an Alternative to Quantum Mechanics}, journal = {Physical Society of Japan}, year = {2013}, month = {2}, day = {13}, volume = {82}, number = {3}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {5}, keywords = {foundations of quantum mechanics, event-based corpuscular model, quantum interference}, web_url = {http://journals.jps.jp/journal/jpsj}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0031-9015}, DOI = {10.7566/JPSJ.82.034004}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Brida, G. and Degiovanni, I. and Genovese, M. and Migdall, A. and Piacentini, F. and Polyakov, S. and Traina, P.} } @Article { GutschwagerTMARFH2013, title = {Comparison of the radiation temperature scales of the PTB and the NPL in the temperature range from −57 \(^{\circ}\)C to 50 \(^{\circ}\)C}, journal = {Measurement Science and Technology}, year = {2013}, volume = {24}, number = {6}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {065002 (9pp)}, keywords = {radiation thermometry, infrared, radiometer, blackbody, low temperature,}, web_url = {http://m.iopscience.iop.org/0957-0233/24/6/065002/pdf/0957-0233_24_6_065002.pdf}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {0957-0233/13/065002+09$33.00}, DOI = {10.1088/0957-0233/24/6/065002}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gutschwager, B. and Theocharous, E. and Monte, C. and Adibekyan, A. and Reiniger, M. and Fox, N. and Hollandt, J.} } @Article { BaumannEJCCRT2013, title = {Design of the new METAS watt balance experiment Mark II}, journal = {Metrologia}, year = {2013}, volume = {50}, number = {3}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, keywords = {Kilogram, Planck constant, International System of Units SI, watt balance}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1088/0026-1394/50/3/235}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Baumann, H. and Eichenberger, A. and Jeckelmann, B. and Cosandier, F. and Clavel, R. and Reber, D. and Tommasini, D.} } @Article { FrickeWKKTNHMMDWPS2013, title = {Counting statistics for electron capture in a dynamic quantum dot}, journal = {Physical Review Letters}, year = {2013}, volume = {110}, number = {126803}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {126803-1 - 126803-5}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.110.126803}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Fricke, L. and Wulf, M. and Kaestner, B. and Kashcheyevs, V. and Timoshenko, J. and Nazarov, P. and Hohls, F. and Mirovsky, P. and Mackrodt, B. and Dolata, R. and Weimann, T. and Pierz, K. and Schumacher, H.} } @Article { PraakZTP2013, title = {Perspectives of atmospheric reference leaks calibration by gravimetric method}, journal = {Measurement}, year = {2013}, volume = {46}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, pages = {621-627}, keywords = {vacuum leak; atmospheric leak; vacuum weighing; mass comparator}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2012.08.021}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Praž{\'a}k, D. and Zůda, J. and Tesař, J. and Peksa, L and Vicar, M.} } @Article { JobbagyTVMMPG2013, title = {Preparation of high-resolution 238U \(\alpha\)-sources by electrodeposition: a comprehensive study}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2013}, volume = {298}, number2 = {ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants}, pages = {345-352}, keywords = {238U, High-resolution alpha-spectrometry, Alpha-emission probability, Electrodeposition}, web_url = {http://rd.springer.com/article/10.1007\%2Fs10967-013-2444-8\#}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, ISSN = {0236-5731}, DOI = {10.1007/s10967-013-2444-8}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Jobb{\'a}gy, V. and Teresa Crespo, M. and Van Ammel, R. and Marouli, M. and Moens, A. and Pomm{\'e}, S. and Garc{\'i}a-Tora{\~n}o, E.} } @Article { NabaeiRMKT2013, title = {Optimization of Hall bar response to localized magnetic and electric fields}, journal = {Journal of Applied Physics}, year = {2013}, volume = {113}, number = {6}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {Hall sensors, Scanning probe microscopy, Numerical models}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0021-8979 (print) 1089-7550 (online)}, DOI = {10.1063/1.4790508}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nabaei, V. and Rajkumar, R. K. and Manzin, A. and Kazakova, O. and Tzalenchuk, A.} } @Proceedings { SahagiaLALTG2014, title = {Comparison of analysis methods for the characterisation of the radioactive content of metallurgical slag used within the EURAMET-EMRP JRP IND04 MetroMetal}, year = {2013}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, keywords = {EURAMET.EMRP-JRP IND04, metallurgical samples, natural radioactivity measurement}, web_url = {http://www.infim.ro/rrp}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brasov, Romania}, event_name = {4th International Proficiency Testing Conference}, event_date = {18-20th September 2013}, language = {English}, ISSN = {1221-1451 43 822 on line 1841-8759}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Sahagia, M. and Luca, A. and Antohe, A. and Loan, R. and Tanase, M. and Garcia Torano, E.} } @Proceedings { KungNMT2013, title = {Calibration and uncertainty evaluation of aspherical lens parameters using a virtual CMM}, year = {2013}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {Micro coordinate metrology, asphere, measurement uncertainty, Monte Carlo simulation, virtual CMM}, web_url = {http://www.aspen-soc.org/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Taipei, Taiwan}, event_name = {5th Internat. Conf. of the Asian Society for Precision Engineering and Nanotechnology ASPEN}, event_date = {12-15 November 2013}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ng, A and Nicolet, A and Meli, F and Thalmann, R.} } @Article { , title = {A computationally efficient elastic wave model for media with power-law absorption}, journal = {IEEE International Ultrasonics Symposium}, year = {2013}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1037-1040}, keywords = {ultrasound, modelling}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IEEE}, language = {30}, DOI = {10.1109/ULTSYM.2013.0266}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Treeby, BE and Cox, BT} } @Proceedings { , title = {Experimental apparatus for the measurement of the ultrasound attenuationcoefficient}, year = {2013}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {695-698}, keywords = {ultrasound, tissue mimicking materials, attenuation measurement}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Merano}, event_name = {AIA-DAGA 2013 Merano}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Musacchio, C and Cuccaro, R and Albo, P and Lago, S and Troia, A.} } @Proceedings { , title = {Thermochromic silica gel as tissue mimicking materials for investigation of temperature rise induced by HIFU transducers}, year = {2013}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {691-694}, keywords = {Thermochromic, Tissue Mimicking Materials, HIFU}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Merano}, event_name = {AIA-DAGA 2013 Merano}, event_date = {18-21/03/2013}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Troia, A and Magnetto, C} } @Article { , title = {Understanding the relationship between molecular order and charge transport properties in conjugated polymer based organic blend photovoltaic devices}, journal = {The Journal of Chemical Physics}, year = {2013}, volume = {139}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1-10}, web_url = {http://scitation.aip.org/content/aip/journal/jcp/139/6/10.1063/1.4816706}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {American Institute of Physics (AIP)}, address = {New York}, language = {30}, ISSN = {0021-9606}, DOI = {10.1063/1.4816706}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wood, SW and Kim, JSK and James, DTJ and Tsoi, WCT and Murphy, GEM and Kim, JSK} } @Article { , title = {The optimization of acoustic fields for ablative therapies of tumours in the upper abdomen}, journal = {Physics in Medicine and Biology}, year = {2012}, month = {12}, volume = {57}, number = {24}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {8471-97}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Institue of Physics}, address = {London}, language = {30}, ISSN = {0031-9155}, DOI = {10.1088/0031-9155/57/24/8471}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gelat, PN and ter Haar, G and Saffari, N} } @Article { BridaDGPTDTSSGGPMG2012, title = {An extremely low-noise heralded single-photon source: A breakthrough for quantum technologies}, journal = {Applied Physics Letters}, year = {2012}, month = {11}, day = {27}, volume = {101}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {221112-4}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1063/1.4768288}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Brida, G. and Degiovanni, I. and Genovese, M. and Piacentini, F. and Traina, P. and Della Frera, A. and Tosi, A. and Bahgat Shehata, A. and Scarcella, C. and Gulinatti, A. and Ghioni, M. and Polyakov, S. and Migdall, A. and Giudice, A.} } @Proceedings { AvellaBCCDGGT2012, title = {Report on proof-of-principle implementations of novel QKD schemes performed at INRIM}, journal = {Proc. SPIE 8542, Electro-Optical Remote Sensing, Photonic Technologies, and Applications VI}, year = {2012}, month = {11}, day = {19}, volume = {8542}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {13}, web_url = {http://spie.org}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Edinburgh, United Kingdom}, event_name = {Electro-Optical Remote Sensing, Photonic Technologies, and Applications VI}, event_date = {September 24, 2012}, language = {English}, DOI = {10.1117/12.974608}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Avella, A and Brida, G and Carpentras, D and Cavanna, A and Degiovanni, I. P and Genovese, M and Gramegna, M and Traina, P} } @Article { , title = {LA-ICP-MS and nHPLC-ESI-LTQ-FT-MS/MS for the analysis of cisplatin–protein complexes separated by two dimensional gel electrophoresis in biological samples}, journal = {Journal of analytical atomic spectrometry}, year = {2012}, month = {5}, day = {30}, volume = {27}, number = {9}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1474 - 1483}, keywords = {cisplatin–protein complexes, gel electrophoresis in biological samples, protein separation conditions}, web_url = {https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/26562}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Royal Society of Chemistry}, address = {Cambridge, United Kingdom}, language = {30}, ISSN = {0267-9477 1364-5544}, DOI = {10.1039/c2ja30016h}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Moreno-Gordaliza, Estefania and Esteban-Fernandez, Diego and Giesen, Charlotte and Lehmann, Karola and Lazaro, Alberto and Tejedor, Alberto and Scheler, Christian and Canas, Benito and Jakubowski, Norbert and Linscheid, Michael W. and Gomez-Gomez, M. Milagros} } @Article { PanchalCYTK2012, title = {Small epitaxial graphene devices for magnetosensing applications}, journal = {Journal of Applied Physics}, year = {2012}, month = {3}, volume = {111}, number = {7}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, web_url = {http://jap.aip.org/resource/1/japiau/v111/i7/p07E509_s1}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0021-8979}, DOI = {10.1063/1.3677769}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, V and Cedergren, K and Yakimova, R and Tzalenchuk, A and Kubatkin, S} } @Article { BridaCDGT2012, title = {Experimental realization of counterfactual quantum cryptography}, journal = {Laser Physics Letters}, year = {2012}, volume = {9}, number = {3}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {247-252}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1002/lapl.201110120}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Brida, G. and Cavanna, A. and Degiovanni, I. P. and Genovese, M. and Traina, P.} } @Article { NevasWSET2012, title = {Simultaneous correction of bandpass and stray light effects in array spectroradiometer data}, journal = {Metrologia}, year = {2012}, volume = {49}, number = {2}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, web_url = {http://iopscience.iop.org/0026-1394/49/2/S43}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, ISSN = {ISSN 0026-1394}, DOI = {10.1088/0026-1394/49/2/S43}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nevas, S. and W{\"u}bbeler, G. and Sperling, A. and Elster, C. and Teuber, A.} } @Proceedings { EgliGSPBNGDNT2012, title = {New Technologies to Reduce Stray Light for Measuring Solar UV with Array Spectroradiometers}, journal = {AIP Conference Proceedings}, year = {2012}, number2 = {ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation}, web_url = {http://proceedings.aip.org/resource/2/apcpcs/1531/1/825_1?ver=pdfcov\&bypassSSO=1}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Berlin, Germany}, event_name = {International Radiation Symposium 2012: Radiation Processes in the Atmosphere and Ocean}, event_date = {6 - 10 August 2012}, language = {English}, DOI = {10.1063/1.4804897}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Egli, L. and Gr{\"o}bner, J. and Smid, M. and Porrovecchio, G. and Burnitt, T. and Nield, K. and Gibson, S. and Dubard, J. and Nevas, S. and Tormen, M.} } @Proceedings { GULMEZOGT2012, title = {A Microwave System for Humidity Measurements}, year = {2012}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, keywords = {Electromagnetic sensor, frequency domainmethod, microwave resonance, moisture measurements.}, web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6251098\&tag=1}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Gaylord National Resort, Washington DC; USA}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {1 to 6 July 2012}, language = {English}, ISSN = {978-1-4673-0440-5}, DOI = {10.1109/CPEM.2012.6251098}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"U}LMEZ, Yakup and {\"O}ZKAN, Turgay and G{\"U}LMEZ, G{\"u}lay and TURHAN, Enis} } @Proceedings { HoliastouFT2012, title = {Presentation of the European program EMRP ENG04 ''Metrology for smart electrical grids''}, year = {2012}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, keywords = {energy, power quality, smart meter, phasor measurement unit (PMU), on site network measurements.}, web_url = {http://hdl.handle.net/11637/98}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Athens, Greece}, event_name = {Metrologia 2012}, event_date = {3-4 February 2012}, language = {Greek}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Holiastou, M. and Flouda, E. and Todi, T.} } @Article { ZhaoRT2011, title = {A Multistep Approach for Accurate Permittivity Measurements of Liquids Using a Transmission Line Method}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2011}, month = {7}, volume = {60}, number = {7}, number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive}, pages = {2267-2274}, keywords = {Curve fitting , mean square parameter methods , permittivity measurement , scattering parameter , specific absorption rate (SAR) , transmission line theory , vector network analyzer (VNA)}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zhao, Dongsheng and Rietveld, Gert and Teunisse, George M.} } @Article { BoscoGLPRTVN2011, title = {Phase Comparison of High-Current Shunts uo to 100 kHz}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2011}, month = {7}, volume = {60}, number = {7}, number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques}, pages = {2359-2365}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bosco, Gian Carlo and Garcocz, Martin and Lind, Kare and Pogliano, Umberto and Rietveld, Gert and Tarasso, Valter and Voljc, Bostjan and Novakova Zachovalova, Vera} } @Article { LemarchandTDBCD2011, title = {Progress towards an accurate determination of the Boltzmann constant by Doppler spectroscopy}, journal = {New Journal of Physics}, year = {2011}, month = {7}, volume = {13}, number = {073028}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {1-22}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/1367-2630/13/7/073028}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lemarchand, C. and Triki, M. and Darqui{\'e}, B. and Bord{\'e}, C. and Chardonnet, C. and Daussy, C.} } @Article { LolliBDGMPPRRTT2011, title = {Ti/Au TES as superconducting detector for quantum technologies}, year = {2011}, month = {6}, volume = {9}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, pages = {405-413}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lolli, L. and Brida, G. and Degiovanni, I. P. and Gramegna, M. and Monticone, E. and Piacentini, F. and Portesi, C. and Rajteri, M. and Ruo Berchera, I. and Taralli, E. and Traina, P.} } @Article { TruongSFOP2011, title = {Measuring shell resonances of spherical acoustic resonators}, journal = {International Journal of Thermophysics}, year = {2011}, volume = {32}, number = {1-2}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {427-440}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1007/s10765-010-0846-1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Truong, D. and Sparasci, F. and Foltete, E. and Ouisse, M. and Pitre, L.} } @Article { PitreSTGRH2011, title = {Measurement of the Boltzmann Constant kB Using a Quasi-Spherical Acoustic Resonator}, journal = {International Journal of Thermophysics}, year = {2011}, volume = {32}, number = {9}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {1825-1886}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1007/s10765-011-1023-x}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pitre, L. and Sparasci, F. and Truong, D. and Guillou, A. and Risegari, L. and Himbert, M. E.} } @Article { GaviosoBMGGMPTMC2011, title = {Progress in INRiM Experiment for the Determination of the Boltzmann Constant with a Quasi-spherical Resonator}, journal = {International Journal of Thermophysics}, year = {2011}, volume = {32}, number = {7-8}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {1339-1354}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1007/s10765-011-1032-9}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gavioso, R. M. and Benedetto, G. and Madonna Ripa, D. and Giuliano Albo, P. A. and Guianvarc'h, C. and Merlone, A. and Pitre, L. and Truong, D. and Moro, F. and Cuccaro, R.} } @Article { ThomasDSWC2011, title = {A pump enhanced source of telecom-band correlated photon pairs}, journal = {Journal of Modern Optics}, year = {2011}, volume = {58}, number = {8}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, pages = {631-639}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1080/09500340.2011.561421}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Thomas, P. J. and Dunn, M. H. and Stothard, D. J. M. and Walsh, D. A. and Chunnilall, C. J.} } @Proceedings { ZhaoRTM2011, title = {Accurate Permittivity Measurements of Liquids using a vertical TEM cell with Variable Fluid Level}, journal = {Proceedings of the 10th International Conference of the European Bioelectromagnetic Association, EBEA 2011}, year = {2011}, number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive}, misc2 = {iMERA-Plus: Call 2007 Length}, event_place = {Rome, Italy}, event_name = {10th International Conference of the European Bioelectromagnetic Association, EBEA 2011}, event_date = {21 - 24 February 2011}, language = {English}, ISSN = {978-88-8286-231-2}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zhao, D. and Rietveld, G. and Teunisse, G. and Mubarak, F.} } @Article { PritchardTHQO2010, title = {Investigating microwave hydrolysis for the traceable quantification of peptide standards using GCMS}, journal = {Analytcial Biochemistry}, year = {2010}, month = {12}, day = {23}, volume = {412}, number = {1}, number2 = {T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine}, pages = {40-46}, keywords = {Amino acid (AA) analysis; LC–MS/MS; Isotopic dilution mass spectrometry (IDMS); Protein quantification; SI units; Traceability}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pritchard, C. and Torma, F. A. and Hopley, C. and Quaglia, M. and O'Connor, G.} } @Article { PitreGSRT2010, title = {Progress Towards an Acoustic/Microwave Determination of the Boltzmann Constant at LNE-INM/CNAM}, journal = {International Journal of Thermophysics}, year = {2010}, volume = {29}, number = {5}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {1730-1739}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1007/s10765-008-0481-2}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pitre, L. and Guianvarc'ha, C. and Sparascia, F. and Richard, A. and Truong, D.} } @Article { GaviosoMGBGCPT2010, title = {Shell Perturbations of an acoustic thermomether dteermined from speed of sound in gas mixtures}, journal = {International Journal of Thermophysics}, year = {2010}, volume = {31}, number = {8-9}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {1739-1748}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1007/s10765-010-0831-8}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gavioso, R. M. and Madonna Ripa, D. and Guianvarc'h, C. and Benedetto, G. and Guiliano Albo, P. A. and Cuccaro, R. and Pitre, L. and Truong, D.} } @Proceedings { TarassoZGLMPRV2010, title = {A survey of current shunts for AC power measurements}, journal = {2010 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2010}, number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques}, keywords = {power and energy, ac-dc transfer, shunts, wideband, power coefficient}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, event_place = {Deajeon, Korea}, event_name = {2010 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {13 - 18 June 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Tarasso, V. and Zachovalov{\'a}, V.N. and Garcocz, M. and Lind, K. and Mansten, T. and Pogliano, U. and Rietveld, G. and Voljc, B.} } @Proceedings { JiangTKSPRFJLMMCB2010, title = {Preliminary results of the BIPM relative gravity measurement campaign during the 8th international comparison of absolute gravimeters (2009)}, journal = {Proceedings of TGSMM2010}, year = {2010}, number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram}, keywords = {Absolute gravimetry, relative gravimetry, ICAG, RGC, BIPM, Key comparison}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, event_place = {Saint-Petersburg, Russia}, event_name = {IAG Sypposium on Terrestrial Gravimetry: Static and Mobile Measurements (TG-SMM2010)}, event_date = {22 - 25 June 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Jiang, Z. and Tisserand, L. and Kessler-Schulz, K. U. and Schulz, H. R. and Palinkas, V. and Rothleitner, C. and Francis, O. and Jousset, P. and Lequin, D. and Merlet, S. and M{\"a}kinen, J. and Coulomb, A. and Becker, M.} } @Article { ThomasCCD2010, title = {Measurement of photon indistinguishability to a quantifiable uncertainty using a Hong-Ou-Mandel interferometer}, journal = {Applied Optics}, year = {2010}, volume = {49}, number = {11}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, pages = {2173-2182}, note = {No pdf received}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1364/AO.49.002173}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Thomas, P. J. and Cheung, J. Y. and Chunnnilall, C. J. and Dunn, M. H.} } @Article { ThomasDSWD2010, title = {Production of degenerate polarization entangled photon pairs in the telecom band from a pump enhanced parametric downconversion process}, journal = {Optics Express}, year = {2010}, volume = {18}, number = {25}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, pages = {26600-26612}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1364/OE.18.026600}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Thomas, P. J. and Dunn, M. H. and Stothard, D. J. M. and Walsh, D. A. and Dunn, M. H.} } @Article { TaralliPLMRNB2010, title = {Impedance measurements on fast Transition-Edge Sensor for optical and near-infrared range}, journal = {Superconductor Science and Technology}, year = {2010}, volume = {23}, number = {105012}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0953-2048/23/10/105012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Taralli, E. and Portesi, C. and Lolli, L. and Monticone, E. and Rajteri, M. and Novikov, I. and Beyer, J.} } @Article { TheocharousICC2010, title = {The characterisation of the linearity of response and spatial uniformity of response of two InGaAsP/InP Geiger-mode avalanche photodiodes}, year = {2010}, volume = {46}, number = {11}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, pages = {1561-1567}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1109/JQE.2010.2053196}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Theocharous, E. and Itzler, M. A. and Cheung, J. Y. and Chunnilall, C. J.} } @Proceedings { DuaneBGG2010, title = {Application of Dose Area Product and DAP Ratio to Dosimetry in IMRT and Small Field External Beam Radiotherapy}, journal = {Proceedings IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry}, year = {2010}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, pages = {303}, misc2 = {iMERA-Plus: Call 2007 Health}, event_place = {Vienna, Austria}, event_name = {IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry}, event_date = {09-12 November 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Duane, S. and Graber, F. and Thomas, R.} } @Article { dePodestaMMPGBGTF2010, title = {Characterization of the volume and shape of quasi-spherical resonators using coordinate measuring machines}, journal = {Metrologia}, year = {2010}, volume = {47}, number = {5}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {588-604}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0026-1394/47/5/010}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {de Podesta, M. and May, E. F. and Mehl, J. B. and Pitre, L. and Gavioso, R. M. and Benedetto, G. and Guiliano Albo, P. A. and Truong, D. and Flack, D.} } @Article { SegoviaVMGTd2010, title = {An Apparatus Based on a spehrical resonator for measuring the speed of sound in gases and for determining the Boltzmann constant}, journal = {International Journal of Thermophysics}, year = {2010}, volume = {31}, number = {7}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {1294-1309}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1007/s10765-010-0746-4}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Segovia, J. J. and Vega Maza, D. and Martin, M. C. and Gomez, E. and Tabacaru, C. and del Campo, D.} } @Proceedings { PalmansAATSMK2010, title = {Conversion of dose-to-graphite to dose-to-water in clinical proton beams}, journal = {Proceedings IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry}, year = {2010}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, pages = {107}, misc2 = {iMERA-Plus: Call 2007 Health}, event_place = {Vienna, Austria}, event_name = {IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry}, event_date = {09-12 November 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Palmans, H. and Al-Sulaiti, L. and Andreo, P. and Thomas, R. A. S. and Shipley, D. R. and Martinkovic, J. and Kacperek, A.} } @Article { AlSualitiSTKRP2010, title = {Water equivalence of various materials for clinical proton dosimetry by experiment and Monte Carlo simulation}, journal = {Nuclear Instruments and Methods}, year = {2010}, volume = {A 619}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, pages = {344-347}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Al-Sulaiti, L. and Shipley, D. and Thomas, R. and Kacperek, A. and Regan, P. and Palmans, H.} } @Article { MerletBMLPGT2010, title = {Comparison between two mobile absolute gravimeters :optical versus atomic interferometers}, journal = {Metrologia}, year = {2010}, volume = {47}, number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram}, pages = {L9-11}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Merlet, S{\'e}bastien and Bordat, Q. and Malossi, Nicola and Landragin, Arnaud and Pereira Dos Santos, Franck and Gitlein, O. and Timmen, L.} } @Article { PitreGSGTHH2009, title = {An improved acoustic method for the determination of the Boltzmann constant at LNE-INM/CNAM}, journal = {Comptes Rendus Physique}, year = {2009}, month = {11}, day = {28}, volume = {10}, number = {9}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {835-848}, keywords = {Metrology; Temperature; Boltzmann constant; Acoustics; Thermodynamics; Electromagnetism}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1016/j.crhy.2009.11.001}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pitre, Laurent and Guianvarc'ha, C{\'e}cile and Sparascia, Fernando and Guilloua, Arnaud and Truong, Daniel and Hermiera, Yves and Himbert, Marc E.} } @Article { MaisiPKTP2009, title = {Parallel pumping of electrons}, journal = {New Journal of Physics}, year = {2009}, month = {11}, volume = {11}, number = {113057}, number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere}, pages = {1-9}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/1367-2630/11/11/113057}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Maisi, Ville F. and Pashkin, Yuri A. and Kafanov, Sergey and Tsai, Jaw-Shen and Pekola, Jukka P.} } @Article { KafanovKPMTP2009, title = {Single-Electronic Radio-Frequency Refrigerator}, journal = {Physical Review Letters}, year = {2009}, month = {9}, day = {18}, volume = {103}, number = {120801}, number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere}, pages = {1-4}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1103/PhysRevLett.103.120801}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kafanov, S. and Kemppinen, A. and Pashkin, Yu. A. and Meschke, M. and Tsai, J. S. and Pekola, J. P.} } @Article { MorgunovDTK2009, title = {Electron spin resonance of charge carriers and antiferromagnetic clusters in Ge(0.99)Cr(0.01) nanowires}, journal = {Journal of Applied Physics}, year = {2009}, month = {5}, volume = {105}, number = {9}, number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics}, note = {No pdf received}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, DOI = {10.1063/1.3095489}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Morgunov, R. B. and Dmitriev, A. I. and Tanimoto, Y. and Kazakova, O.} } @Article { KemppinenKPTAP2010, title = {Experimental investigation of hybrid single-electron turnstiles with high charging energy}, journal = {Applied Physics Letters}, year = {2009}, volume = {94}, number = {172108}, number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere}, pages = {1-3}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1063/1.3127229}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kemppinen, A. and Kafanov, S. and Pashkin, Yu. A. and Tsai, J. S. and Averin, D. V. and Pekola, J. P.} } @Article { AlleviABBGGTOPZ2009, title = {State reconstruction by on/off measurements}, journal = {Physical Review A}, year = {2009}, volume = {80}, number = {022114}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1103/PhysRevA.80.022114}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Allevi, A. and Andreoni, A. and Bondani, M. and Brida, G. and Genovese, M. and Gramegna, M. and Traina, P. and Olivares, S. and Paris, M. G. A. and Zambra, G.} } @Article { BridaGGTPOP2009, title = {Toward a full reconstruction of density matrix by on/off measurements}, journal = {Journal of Quantum Information}, year = {2009}, volume = {7}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, pages = {27-32}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Brida, G. and Genovese, M. and Gramegna, M. and Traina, P. and Predazzi, E. and Olivares, S. and Paris, M.} } @Article { RajteriTPMB2009, title = {Photon-number discriminating superconducting transition-edge sensors}, journal = {Metrologia}, year = {2009}, volume = {46}, number = {4}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, keywords = {Superconductivity, Instrumentation and measurement, Optics, quantum optics and lasers}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0026-1394/46/4/S28}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rajteri, M. and Taralli, E. and Portesi, C. and Monticone, E. and Beyer, J.} } @Article { TrincheroSLGFdABTBV2009, title = {Experimental setup for the characterization of field probes performance in presence of digitally modulated radio signals}, journal = {IEEE Antennas and Wireless Propagation Letters}, year = {2009}, volume = {8}, number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive}, pages = {224-227}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Trinchero, D. and Stefanelli, R. and Longobardi, F. and Galardini, A. and Fiorelli, B. and d'Amore, G. and Anglesio, L. and Benedetto, A. and Trinchero, S. and Borsero, M. and Vizio, G.} } @Article { TrincheroSLGFdABTBV2009_2, title = {Field probes performance for the measurement of spread-spectrum radio signals}, journal = {IEEE Antennas and Wireless Propagation Letters}, year = {2009}, volume = {8}, number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive}, pages = {494-497}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Trinchero, D. and Stefanelli, R. and Longobardi, F. and Galardini, A. and Fiorelli, B. and d'Amore, G. and Anglesio, L. and Benedetto, A. and Trinchero, S. and Borsero, M. and Vizio, G.} } @Proceedings { MorgunovTK2008, title = {Microwave magnetoresistance in Ge : Mn nanowires and nanofilms}, journal = {Science and Technology of Advanced Materials}, year = {2008}, month = {6}, volume = {9}, number = {2}, number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics}, note = {No pdf received}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, event_place = {Hiroshima, Japan}, event_name = {International Conference on Magneto-Science}, event_date = {November 2007}, DOI = {10.1088/1468-6996/9/2/024207}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Morgunov, R. and Tanimoto, Y. and Kazakova, O.} } @Article { MorgunovKITKOK2008, title = {Spin solitons and spin waves in chiral and racemic molecular based ferrimagnets}, year = {2008}, month = {5}, volume = {77}, number = {18}, number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics}, note = {No pdf received}, keywords = {RESONANCE; MAGNETS; MODES}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, DOI = {10.1103/PhysRevB.77.184419}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Morgunov, R. and Kirman, M. V. and Inoue, K. and Tanimoto, Y. and Kishine, J. and Ovchinnikov, A. S. and Kazakova, O.} } @Article { WrightBGTPJHAJNR20100, title = {Enhanced current quantization in high-frequency electron pumps in a perpendicular magnetic field}, journal = {Physical Review Letters B}, year = {2008}, volume = {78}, number = {233311}, number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere}, pages = {1-4}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1103/PhysRevB.78.233311}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Wright, S. J. and Blumenthal, M. D. and Gumbs, Godfrey and Thorn, A. L. and Pepper, M. and Janssen, T. J. B. M. and Holmes, S. N. and Anderson, D. and Jones, G. A. C. and Nicoll, C. A. and Ritchie, D. A.} } @Proceedings { ThevenotLCDLP2010_2, title = {Towards a Determination of R\(_{K}\) in Terms of the New LNE Calculable Cross Capacitor}, year = {2008}, number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, event_place = {Santiago de Quer{\'e}taro, Mexico}, event_name = {Simposio de Metrologia 2008}, event_date = {22-24 October 2008}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Thevenot, O. and Lahousse, L. and Consejo, C. and David, J. and Leleu, S. and Piquemal, F.} } @Miscellaneous { RuoBercheraGBLKMTF, subid = {1465}, title = {Feasibility study towards comparison of the g(2)(0) measurement in the visible range}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {single-Photon source}, web_url = {https://zenodo.org/record/3711276\#.XniB2EBFz8c}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, stag_bib_extends_levelofaccess = {NA}, author = {Ruo-Berchera, I. and Gramegna, M. and Brida, G. and L{\'o}pez, M. and Kirkwood, R. and Moreva, E. and Traina, P. and Forneris, J.} } @Miscellaneous { JaksicODPCMTSSDKHLDMGF, subid = {1462}, title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Diamond, leadleadColor Centerssingle-Photon sourceion Implantationphotoluminescence}, web_url = {https://zenodo.org/record/3711266\#.Xnh2CEBFz8c}, misc2 = {EMPIR 2017: Fundamental}, language = {197}, stag_bib_extends_levelofaccess = {NA}, author = {Jakšić, M. and Olivero, P. and Degiovanni, I.P. and Pezzagna, S. and Celegato, F. and Moreva, E. and Traina, P. and Signorile, M. and Santonocito, S. and Damin, A. and Kuepper, J. and Herzig, T. and Luehmann, T. and Ditalia, T. and Meijer, J. and Genovese, P.M. and Forneris, J.} } @Miscellaneous { NaydenovDAEBGJSMTDFJO, subid = {1463}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of N-V Sensors—A Self-Diagnostic Concept}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Crystal defectsQuantum Information with hybrid SystemsQuantum sensingelemantal semiconductorsNitrogen vacancy centers in Diamondwide band gap Systemsoptically detected magnetic resonance}, web_url = {https://zenodo.org/record/3711403\#.Xnh5L0BFz8d}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, stag_bib_extends_levelofaccess = {NA}, author = {Naydenov, B. and Degiovanni, I.P. and Amato, G. and Enrico, E. and Bosia, F. and Grilj, V. and Jakšić, M. and Skukan, N. and Moreva, E. and Traina, P. and Ditalia, T. and Forneris, J. and Jelezko, F. and Olivero, P.} } @Miscellaneous { LangeHSSLTP, subid = {1855}, title = {Additional data for the publication ''Coherent Suppression of Tensor Frequency Shifts through Magnetic Field Rotation''}, journal = {https://oar.ptb.de/resources/show/10.7795/710.20201222}, volume = {-}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {-}, keywords = {Optical clocks, coherent interrogation, quadrupole moments, precision spectroscopy}, web_url = {https://oar.ptb.de/resources/show/10.7795/710.20201222}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {-}, address = {-}, ISSN = {-}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/710.20201222}, author = {Lange, R. and Huntemann, N. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Peik, E.} } @Miscellaneous { LangeHRSSLTWP, subid = {2326}, title = {Additional data for the publication ''Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons''}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {Optical clocks ; Frequency measurements ; Atomic structure}, web_url = {https://oar.ptb.de/resources/show/10.7795/720.20211028}, misc2 = {EMPIR 2018: SI Broader Scope}, DOI = {10.7795/720.20211028}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Rahm, J. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, C. and Weyers, S. and Peik, E.} } @Miscellaneous { MomeniPakdehiSNZWNSPSTS, subid = {2233}, title = {Datasets of Momeni Pakdehi et al, Adv. Funct. Mater. 2004695 (2020), ''Silicon Carbide Stacking-Order-Induced Doping Variation in Epitaxial Graphene''}, journal = {Zenodo}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, keywords = {epitaxial graphene,hexagonal silicon carbide,surface-dependent polarization doping,SiC spontaneous polarization}, misc2 = {EMPIR 2018: SI Broader Scope}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4292224}, author = {Momeni Pakdehi, D. and Sch{\"a}dlich, P. and Nguyen, T.T. and Zakharov, A.A. and Wundrack, S. and Najafidehaghani, E. and Speck, F. and Pierz, K. and Seyller, T. and Tegenkamp, C. and Schumacher, H.W.} } @Miscellaneous { PearceTICFWC, subid = {2430}, title = {Correlation between insulation resistance breakdown and temperature measurement error in Type K and N mineral insulated, metal sheathed thermocouples}, journal = {Zenodo}, volume = {N/A}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {N/A}, keywords = {Insulation resistance breakdown, Mineral insulated metal sheathedthermocouple, Temperature, Thermocouple, Thermoelectric}, misc2 = {EMPIR 2017: Industry}, publisher = {N/A}, address = {N/A}, ISSN = {N/A}, DOI = {10.5281/zenodo.5836197}, stag_bib_extends_levelofaccess = {NA}, author = {Pearce, J. and Tucker, D. and Izquierdo, C.G. and Caballero, R. and Ford, T. and Williams, P. and Cowley, P.} } @Miscellaneous { EdlerBIMTAASZ, subid = {2515}, title = {Pt-40\%Rh Versus Pt-6\%Rh Thermocouples: An emf-Temperature Reference Function for the Temperature Range 0 \(^{\circ}\)C to 1769 \(^{\circ}\)C}, journal = {International Journal of Thermophysics}, volume = {42}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {150}, keywords = {Noble metal thermocouples · Reference function · Thermoelectricstability and homogeneity}, web_url = {https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer}, ISSN = {1572-9567}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5163783}, author = {Edler, F. and Bojkovski, J. and Izquierdo, C.G. and Martin, M.J. and Tucker, D. and Arifovic, N. and Andersen, S.L. and Sindelorva, L. and Žužek, V.} } @Miscellaneous { JostTPBGKDSFKGKKBRLSH, subid = {1982}, title = {Development of white LED illuminants for colorimetry and recommendation of white LED reference spectrum for photometry}, journal = {Not applicable}, volume = {Not applic}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {2}, keywords = {LED, light emitting diode, SSL, solid-state lighting, spectrum, spectral power distribution, illuminant, colorimetry, photometry}, web_url = {https://doi.org/10.1088/1681-7575/aacae7}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {PhotoLED}, address = {photoled.aalto.fi}, ISSN = {Not applicable}, DOI = {10.1088/1681-7575/aacae7}, stag_bib_extends_levelofaccess = {NA}, author = {Jost, S. and Thorseth, A. and Poikonen, T. and Blattner, P. and Gerloff, T. and Kokka, A. and Dekker, P. and Smid, M. and Ferrero, A. and K{\"u}barsepp, T. and Gal, P. and K{\"a}llberg, S. and Klej, A. and Brida, G. and Reiners, T. and Ludwig, K. and Schneider, M. and Hui, L.} } @Miscellaneous { FerreroCBVSYACMT, subid = {2164}, title = {Dataset: Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes}, journal = {Zenodo}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations}, misc2 = {EMPIR 2018: Health}, DOI = {10.5281/zenodo.5040394}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Celegato, F. and Barrera, G. and Vicentini, M. and S{\"o}zeri, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.} } @Miscellaneous { MervioLTHSH, subid = {1329}, title = {Dataset for publication: ''Measuring Losses of an Air-Core Shunt Reactor with an Advanced Loss Measuring System''}, journal = {Zenodo}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {dataset, reactor, loss measurements, voltage divider}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/3521300}, author = {Havunen, J. and Suomalainen, E.-P. and Tornberg, J. and H{\"a}llstr{\"o}m, J. and Lehtonen, T. and Mervi{\"o}, A.} } @Miscellaneous { SudTSBSDSSWZZRCKKC, subid = {2424}, title = {Dataset for the article ''Tailoring interfacial effect in multilayers with Dzyaloshinskii–Moriya interaction by helium ion irradiation'' DOI: 10.1038/s41598-021-02902-y}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {Spintronics, Skyrmions, Dzyaloshinskii–Moriya interaction}, misc2 = {EMPIR 2017: Fundamental}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5791032}, author = {Sud, A. and Tacchi, S. and Sagkovits, D. and Barton, C. and Sall, M. and Diez, L.H. and Stylianidis, E. and Smith, N. and Wright, L. and Zhang, S. and Zhang, X. and Ravelosona, D. and Carlotti, G. and Kurebayashi, H. and Kazakova, O. and Cubukcu, M. } } @Miscellaneous { SilvaniKTC, subid = {2384}, title = {Dataset for ''Impact of the interfacial Dzyaloshinskii-Moriya interaction on the band structure of one-dimensional artificial magnonic crystals: A micromagnetic study''}, journal = {zenodo}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {magnonic, spinwave, DMI}, web_url = {https://doi.org/10.5281/zenodo.5770368}, misc2 = {EMPIR 2017: Fundamental}, DOI = {10.5281/zenodo.5770368}, stag_bib_extends_levelofaccess = {NA}, author = {Silvani, R. and Kuepferling, M. and Tacchi, S. and Carlotti, G.} } @Miscellaneous { SahaZFMTSWBRKH, subid = {2462}, title = {Data set for the article ''Formation of N{\'e}el-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy'' DOI: 10.1103/PhysRevB.100.144435}, journal = {PHYSICAL REVIEW B}, volume = {100}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {144435}, keywords = {Skyrmions, Dzyaloshinskii–Moriya interaction}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, ISSN = {2469-9950}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/3606088}, author = {Saha, S. and Zelent, M. and Finizio, S. and Mruczkiewicz, M. and Tacchi, S. and Suszka, A.K. and Wintz, S. and Bingham, N.S. and Raabe, J. and Krawczyk, M. and Heyderman, L.J. } } @Miscellaneous { KieschnickTIGFTHGMHGB, subid = {1464}, title = {Spectroscopic investigations of negatively charged tin-vacancy centres in diamond}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Colour centresDiamondtin-vacancy centresingle PhotonsFourier-limited Emission lineselectron-phonon scattering}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/3711398}, author = {Kieschnick, M. and Taniguchi, T. and Iwasaki, T. and Gandil, M. and Fuchs, P. and Thiering, G. and Herrmann, D. and Goerlitz, J. and Meijer, J. and Hatano, M. and Gali, A. and Becher, C.} } @Miscellaneous { AqeelSTMMBBGPB, subid = {2456}, title = {Microwave spectroscopy of the low-temperature skyrmion state in Cu2OSeO3}, journal = {Physical Review Letters}, volume = {126}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {017202-1 - 017202-7}, keywords = {Lattice dynamics, Magnetic order, Magnetism, Magnetization dynamics, Skyrmions, Spin waves, Microwave techniques}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, DOI = {10.5281/zenodo.5793226}, stag_bib_extends_levelofaccess = {NA}, author = {Aqeel, A. and Sahliger, J. and Taniguchi, T. and M{\"a}ndl, S. and Mettus, D. and Berger, H. and Bauer, A. and Garst, M. and Pfleiderer, C. and Back, C.H.} } @Miscellaneous { AssoulineJBWTJGKRPR, subid = {2631}, title = {Excitonic nature of magnons in a quantum Hall ferromagnet}, journal = {Nature Physics}, volume = {17}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {1369-1374}, keywords = {Graphene, p-n junction, interferometer, magnons}, web_url = {https://doi.org/10.5281/zenodo.6500310}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, address = {Dordrecht, GX, Netherlands}, language = {1}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-021-01411-z}, stag_bib_extends_levelofaccess = {NA}, author = {Assouline, A. and Jo, M. and Brasseur, P. and Watanabe, K. and Taniguchi, T. and Jolicoeur, Th. and Glattli, D. C. and Kumada, N. and Roche, P. and Parmentier, F. D. and Roulleau, P.} } @Miscellaneous { MingottiCPT, subid = {2581}, title = {Data set of ''Effect of Proximity, Burden, and Position on the Power Quality Accuracy Performance of Rogowski Coils''}, journal = {Zenodo}, volume = {-}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, pages = {-}, keywords = {low-power instrument transformer; Rogowski coil; position; burden; proximity; accuracy; harmonic; power quality}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {-}, address = {-}, ISSN = {-}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6107396}, author = {Mingotti, A. and Costa, F. and Peretto, L. and Tinarelli, R.} } @Miscellaneous { MeierTGOP, subid = {2391}, title = {Energy Levels of ThII in the range of 7 to 10 eV}, journal = {Physical Review A}, volume = {99}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {052514}, keywords = {lines and levels of Th+}, misc2 = {EMPIR 2017: Fundamental}, publisher = {APS}, address = {College Park, MD}, ISSN = {2469-9934}, DOI = {10.5281/zenodo.3369088}, stag_bib_extends_levelofaccess = {NA}, author = {Meier, D-M. and Thielking, J. and Glowacki, P. and Okhapkin, M. and Peik, E.} } @Miscellaneous { GolokolenovGKPT, subid = {2052}, title = {Dataset for the publication ''On the origin of the controversial electrostatic field effect in superconductors''}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, keywords = {superconducting devices, superconductor electronics, electrostatic field effect}, misc2 = {EMPIR 2017: Fundamental}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.17635/lancaster/researchdata/436}, author = {Golokolenov, I. and Guthrie, A. and Kafanov, S. and Pashkin, Y. and Tsepelin, V.} } @Miscellaneous { MelendezTGL, subid = {2514}, title = {Mapping of temperature and CO2 column density in a standard flame by multispectral imaging}, journal = {Proceedings Volume 11743, Thermosense: Thermal Infrared Applications XLIII}, volume = {11743}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {117430V-2}, keywords = {Flame, combustion, thermometry, traceability, temperature}, web_url = {https://www.spiedigitallibrary.org/conference-proceedings-of-spie/11743/2585805/Mapping-of-temperature-and-CO2-column-density-in-a-standard/10.1117/12.2585805.full?SSO=1\&tab=ArticleLinkReference}, misc2 = {EMPIR 2017: Industry}, publisher = {SPIE}, ISSN = {0277-786X}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4789210}, author = {Mel{\'e}ndez, J. and Talavante, J. and Guarnizo, G. and L{\'o}pez, F.} } @Miscellaneous { TiainenVHH, subid = {2265}, title = {Total Rotor Runout Dataset}, number2 = {19ENG07: Met4Wind: Metrology for enhanced reliability and efficiency of wind energy systems}, keywords = {Multi-probe roundness data, Electrical runout data, simultaneous tactile and eddy current probe measurement, Scaling}, misc2 = {EMPIR 2019: Engergy}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5615524}, author = {Tiainen, T. and Viitala, R. and Holopainen, T. and Hemming, B.} } @Miscellaneous { PizzocaroSTUHNTKKRNOTCBBMCCLMRBNRZRLPPCI, subid = {2248}, title = {Dataset for 'Intercontinental comparison of optical atomic clocks through very long baseline interferometry'}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {Optical clocks, Very long baseline interferometry, VLBI, GPS}, misc2 = {EMPIR 2018: SI Broader Scope}, DOI = {10.5281/zenodo.5592085}, stag_bib_extends_levelofaccess = {NA}, author = {Pizzocaro, M. and Sekido, M. and Takefuji, K. and Ujihara, H. and Hachisu, H. and Nemitz, N. and Tsutsumi, M. and Kondo, T. and Kawai, E. and Ryuichi, N. and Namba, K. and Okamoto, Y. and Takahashi, R. and Clivati, C. and Bregolin, F. and Barbieri, P. and Mura, A. and Cantoni, E. and Cerretto, G. and Levi, F. and Maccaferri, G. and Roma, M. and Bortolotti, C. and Negusini, M. and Ricci, R. and Zacchiroli, G. and Roda, J. and Leute, J. and Petit, G. and Perini, F. and Calonico, D. and Ido, T.} } @Miscellaneous { SmorgonFTC, subid = {2465}, title = {SPEA TESTBED TEST DATA FOR ML DEVELOPMENT}, journal = {Zenodo}, volume = {1}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {Met4FoF, MEMS, Temperature, Calibrations, European Union (EU), Horizon 2020, EMPIR}, misc2 = {EMPIR 2017: Industry}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.5524616}, author = {Smorgon, D. and Fernicola, V. and Tamburini, E. and Catto, M.} } @Miscellaneous { SmorgonFTC_2, subid = {2537}, title = {SPEA TESTBED TEST DATA FOR ML DEVELOPMENT}, journal = {Zenodo}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {MET4FOF, MEMS, Temperature Calibrations, European Union (EU), Horizon 2020, EMPIR}, web_url = {https://dx.doi.org/10.5281/zenodo.5524616\&\#10;https://zenodo.org/record/5524617}, misc2 = {EMPIR 2017: Industry}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://dx.doi.org/10.5281/zenodo.5524616}, author = {Smorgon, D. and Fernicola, V. and Tamburini, E. and Catto, M.} } @Miscellaneous { PanniAGT, subid = {2466}, title = {Sensor data set radial forging at AFRC testbed v2}, journal = {Zenodo}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {forming, forge, sensors, uncertainty, European Union (EU), Horizon 2020, EMPIR}, misc2 = {EMPIR 2017: Industry}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.2573860}, author = {Panni, O. and Andonovic, I. and Gourlay, G. and Tachtatzis, C.} } @Miscellaneous { TachtatzisAG, subid = {2538}, title = {DOE1 and DOE2 - Sensor data set radial forging at AFRC testbed}, journal = {Zenodo}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {MEMS, Calibrations, European Union (EU), Horizon 2020, EMPIR}, misc2 = {EMPIR 2017: Industry}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5705521}, author = {Tachtatzis, C. and Andonovic, I. and Gourlay, G.} } @Miscellaneous { KoybasiNTPRPBMSKGOIG, subid = {2649}, title = {High Performance Predictable Quantum Efficient Detector Based on Induced-Junction Photodiodes Passivated with SiO2/SiNx}, journal = {Sensors}, volume = {21}, number2 = {18SIB10: chipS·CALe: Self-calibrating photodiodes for the radiometric linkage to fundamental constants}, pages = {7807}, keywords = {Silicon Photodetector; Inversion Layer Photodiode; Induced-Junction; Surface Pas-Sivation; PECVD Silicon Nitride; Radiometry; Optical Power; Primary Standard; Predictable Quantum Efficiency (1)}, web_url = {https://zenodo.org/record/5720711}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI}, ISSN = {ISSN 1424-8220}, DOI = {10.5281/Zenodo.5720711}, stag_bib_extends_levelofaccess = {NA}, author = {Koybasi, O. and Nordseth, {\O}. and Tran, T. and Povoli, M. and Rajteri, M. and Pepe, C. and Bardalen, E. and Manoocheri, F. and Summanwar, A. and Korpusenko, M. and Getz, M.N. and Ohlckers, P. and Ikonen, E. and Gran, J.} }