% 
% This file was created by the TYPO3 extension
% bib
% --- Timezone: CEST
% Creation date: 2022-07-06
% Creation time: 11-53-59
% --- Number of references
% 991
% 

@Article { KossertLMPRR2022,
   subid = {2702},
   title = {High precision measurement of the 151Sm beta decay by means of a metallic magnetic calorimeter},
   journal = {Applied Radiation and Isotopes},
   year = {2022},
   month = {7},
   volume = {185},
   number2 = {20FUN04: PrimA-LTD: Towards new primary activity standardisation methods based on low-temperature detectors},
   pages = {110237},
   keywords = {Sm-151, 151Sm, Metallic magnetic calorimeter, Beta minus decay, Kurie plot, Beta spectrum shapes},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2022.110237},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kossert, K. and Loidl, M. and Mougeot, X. and Paulsen, M. and Ranitzsch, P. and Rodrigues, M.}
}

@Article { ChambersGWSMRMR2022,
   subid = {2754},
   title = {Portable two-filter dual-flow-loop 222Rn detector: stand-alone monitor and calibration transfer device},
   journal = {Advances in Geosciences},
   year = {2022},
   month = {5},
   day = {18},
   volume = {57},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   pages = {63-80},
   keywords = {Radon monitor, two-filter dual loop detector, traceRadon, calibration, activity concentration},
   misc2 = {EMPIR 2019: Environment},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1680-7359},
   DOI = {10.5194/adgeo-57-63-2022},
   stag_bib_extends_levelofaccess = {NA},
   author = {Chambers, S.D. and Griffiths, A.D. and Williams, A.G. and Sisoutham, O. and Morosh, V. and R{\"o}ttger, S. and Mertes, F. and R{\"o}ttger, A.}
}

@Article { RusantoSFH2022,
   subid = {2787},
   title = {Primary measurement method for the characterisation of impedance standard in the m\(\Omega\) range},
   journal = {Measurement Science and Technology},
   year = {2022},
   month = {5},
   day = {18},
   volume = {33},
   number = {8},
   number2 = {17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications},
   pages = {085016},
   keywords = {low impedance, impedance standard, primary measurement method, uncertainty,comparison},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/ac6a45},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ac6a45},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rusanto, B.H. and Seitz, S. and Funck, T. and Heinrich, M.}
}

@Article { RubenVogtRGDKMKKSBBMPFCRVSH2022,
   subid = {2751},
   title = {PV Module Energy Rating Standard IEC 61853-3 Intercomparison and Best Practice Guidelines for Implementation and Validation},
   journal = {IEEE Journal of Photovoltaics},
   year = {2022},
   month = {5},
   volume = {12},
   number = {3},
   number2 = {19ENG01: Metro-PV: Metrology for emerging PV applications},
   pages = {844-852},
   keywords = {Standards, Meteorology, IEC Standards, Temperature measurement, Power measurement, Photovoltaic systems, Mathematical models},
   web_url = {https://www.techrxiv.org/articles/preprint/PV_module_energy_rating_standard_IEC_61853-3_intercomparison_and_best_practice_guidelines_for_implementation_and_validation/19635333/1},
   misc2 = {EMPIR 2019: Energy},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2156-3381, 2156-3403},
   DOI = {10.1109/JPHOTOV.2021.3135258},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ruben Vogt, M. and Riechelmann, S. and Gracia-Amillo, A.M. and Driesse, A. and Kokka, A. and Maham, K. and K{\"a}rh{\"a}, P. and Kenny, R. and Schinke, C. and Bothe, K. and Blakesley, J. and Music, E. and Plag, F. and Friesen, G. and Corbellini, G. and Riedel-Lyngskar, N. and Valckenborg, R. and Schweiger, M. and Herrmann, W.}
}

@Article { BriantKCLBWRMPCESTHPKKDZWMSNB2022,
   subid = {2714},
   title = {Photonic and Optomechanical Thermometry},
   journal = {Optics},
   year = {2022},
   month = {4},
   day = {29},
   volume = {3},
   number = {2},
   number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry},
   pages = {159-176},
   keywords = {thermometry; photonic; optomechanic; temperature sensors; photonic integrated circuit},
   web_url = {https://doi.org/10.3390/opt3020017},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2673-3269},
   DOI = {10.3390/opt3020017},
   stag_bib_extends_levelofaccess = {NA},
   author = {Briant, T. and Krenek, S. and Cupertino, A. and Loubar, F. and Braive, R. and Weituschat, L. and Ramos, D. and Martin, M.J. and Postigo, P.A. and Casas, A. and Eisermann, R. and Schmid, D. and Tabandeh, S. and Hahtela, O. and Pourjamal, S. and Kozlova, O. and Kroker, S. and Dickmann, W. and Zimmermann, L. and Winzer, G. and Martel, T. and Steeneken, P.G. and Norte, R.A. and Briaudeau, S.}
}

@Article { VolkovaHTBCMARERBPN2022,
   subid = {2712},
   title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars},
   journal = {Nanomaterials},
   year = {2022},
   month = {4},
   day = {29},
   volume = {12},
   number = {9},
   number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology},
   pages = {1516},
   keywords = {color centers, optical quantum technology},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {MDPI},
   language = {30},
   ISSN = {2079-4991},
   DOI = {10.3390/nano12091516},
   stag_bib_extends_levelofaccess = {NA},
   author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.}
}

@Article { VolkovaHTBCMARERBPN2022_2,
   subid = {2721},
   title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars},
   journal = {Nanomaterials},
   year = {2022},
   month = {4},
   day = {29},
   volume = {12},
   number = {9},
   number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology},
   pages = {1516},
   keywords = {NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2079-4991},
   DOI = {10.3390/nano12091516},
   stag_bib_extends_levelofaccess = {NA},
   author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.}
}

@Article { RaupachDGMHGGKL2022,
   subid = {2765},
   title = {Detection rate dependence of the inherent detection efficiency in single-photon detectors based on avalanche diodes},
   journal = {Physical Review A},
   year = {2022},
   month = {4},
   day = {25},
   volume = {105},
   number = {4},
   number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware},
   pages = {042615},
   keywords = {Single-photon counting, Metrology for quantum technologies, QKD implementation security, standardisation},
   web_url = {https://journals.aps.org/pra/pdf/10.1103/PhysRevA.105.042615},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.105.042615},
   stag_bib_extends_levelofaccess = {NA},
   author = {Raupach, S.M.F. and Degiovanni, I.P. and Georgieva, H. and Meda, A. and Hofer, H. and Gramegna, M. and Genovese, M. and K{\"u}ck, S. and L{\'o}pez, M.}
}

@Article { HoflingBHRHWTJBGR2022,
   subid = {2713},
   title = {Numerical optimization of single-mode fiber-coupled single-photon sources based on semiconductor quantum dots},
   journal = {Optics Express},
   year = {2022},
   month = {4},
   day = {25},
   volume = {30},
   number = {10},
   number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology},
   pages = {15913},
   keywords = {single photon source; optical quantum technology},
   web_url = {https://arxiv.org/abs/2202.09562},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {Optica Publishing Group},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.456777},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"o}fling, S. and Burger, S. and Herkommer, Al. and Rodt, S. and Huber, T. and Weber, K. and Thiele, S. and Jimenez, C. and Bremer, L. and Giessen, H. and Reitzenstein, S.}
}

@Article { RubinSZHFABKLZA2022,
   subid = {2709},
   title = {Thermodynamic effects in a gas modulated Invar-based dual Fabry–P{\'e}rot cavity refractometer},
   journal = {Metrologia},
   year = {2022},
   month = {4},
   day = {14},
   volume = {59},
   number = {3},
   number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal},
   pages = {035003},
   keywords = {quantumpascal, GAMOR, optical pressure standard, gas refractometry, pV-work, Invar-based},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ac5ef9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rubin, T. and Silander, I. and Zakrisson, J. and Hao, M. and Forss{\'e}n, C. and Asbahr, P. and Bernien, M. and Kussicke, A. and Liu, K. and Zelan, M. and Axner, O.}
}

@Article { RabagoQVSRICCRCFFRG2022,
   subid = {2671},
   title = {Intercomparison of Radon Flux Monitors at Low and at High Radium Content Areas under Field Conditions},
   journal = {International Journal of Environmental Research and Public Health},
   year = {2022},
   month = {4},
   volume = {19},
   number = {7},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   pages = {4213},
   keywords = {exhalation; traceRadon; proficiency test; interlaboratory comparison},
   misc2 = {EMPIR 2019: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1660-4601},
   DOI = {10.3390/ijerph19074213},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rabago, D. and Quindos, L. and Vargas, A. and Sainz, C. and Radulescu, I. and Ioan, M-R. and Cardellini, F. and Capogni, M. and Rizzo, A. and Celaya, S. and Fuente, I. and Fuente, M. and Rodriguez, M. and Grossi, C.}
}

@Article { LivreriEFGRVFMG2022,
   subid = {2789},
   title = {Microwave Quantum Radar using a Josephson Traveling Wave Parametric Amplifier},
   journal = {2022 IEEE Radar Conference (RadarConf22)},
   year = {2022},
   month = {3},
   day = {21},
   number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology},
   keywords = {Microwave quantum radar, Josephson traveling parametric amplifier, quantum microwave illumination, two-mode squeezing, non-classical light source, entanglement},
   web_url = {https://arxiv.org/abs/2111.03409},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/RadarConf2248738.2022.9764353},
   stag_bib_extends_levelofaccess = {NA},
   author = {Livreri, P. and Enrico, E. and Fasolo, L. and Greco, A. and Rettaroli, A. and Vitali, D. and Farina, A. and Marchetti, Com. F. and Giacomin, A. Sq. D.}
}

@Article { McManusRRBSPS2022,
   subid = {2661},
   title = {Determination of beam quality correction factors for the Roos plane-parallel ionisation chamber exposed to very high energy electron (VHEE) beams using Geant4},
   journal = {Physics in Medicine \& Biology},
   year = {2022},
   month = {3},
   day = {17},
   volume = {67},
   number = {6},
   number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates},
   pages = {065011},
   keywords = {geant4, Monte Carlo, perturbation factors, beam quality correction, VHEE},
   misc2 = {EMPIR 2018: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/ac5a94},
   stag_bib_extends_levelofaccess = {NA},
   author = {McManus, M. and Romano, F. and Royle, G. and Botnariuc, D. and Shipley, D. and Palmans, H. and Subiel, A.}
}

@Article { RottgerRGVKCCKRMR2022,
   subid = {2625},
   title = {Radon metrology for use in climate change observation and radiation protection at the environmental level},
   journal = {Advances in Geosciences},
   year = {2022},
   month = {3},
   day = {10},
   volume = {57},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   pages = {37-47},
   keywords = {Radon, climate observation, radon monitor, radiation protection, radon tracer method (RTM), radon emanation source, activity concentration, traceability},
   misc2 = {EMPIR 2019: Environment},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1680-7359},
   DOI = {10.5194/adgeo-57-37-2022},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"o}ttger, S. and R{\"o}ttger, A. and Grossi, C. and Vargas, A. and Karstens, U. and Cinelli, G. and Chung, E. and Kikaj, D. and Rennick, C. and Mertes, F. and Radulescu, I.}
}

@Article { GarciaYipSRBBG2022,
   subid = {2620},
   title = {Characterization of small active detectors for electronic brachytherapy dosimetry},
   journal = {Journal of Instrumentation},
   year = {2022},
   month = {3},
   volume = {17},
   number = {03},
   number2 = {18NRM02: PRISM-eBT: Primary standards and traceable measurement methods for X-ray emitting electronic brachytherapy devices},
   pages = {P03001},
   keywords = {Detector alignment and calibration methods (lasers, sources, particle-beams), X-ray detectors, Diamond Detectors},
   web_url = {https://doi.org/10.1088/1748-0221/17/03/P03001},
   misc2 = {EMPIR 2018: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/17/03/P03001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garcia Yip, F. and Schneider, T. and Reginatto, M. and Behrens, R. and B{\"u}ermann, L. and Grote, F.}
}

@Article { MuruganORWB2022,
   subid = {2722},
   title = {Vision for a European metrology network for energy gases},
   journal = {Environmental Research: Infrastructure and Sustainability},
   year = {2022},
   month = {3},
   volume = {2},
   number = {1},
   number2 = {18NET01: Energy Gases: Support for a European Metrology Network for energy gases},
   pages = {012003},
   keywords = {metrology, energy gases, hydrogen, biomethane, natural gas, CCS},
   tags = {ENG},
   misc2 = {EMPIR 2018: Support for Networks},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2634-4505},
   DOI = {10.1088/2634-4505/ac57f6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Murugan, A. and Omoniyi, O. and Richardson, E. and Workamp, M. and Baldan, A.}
}

@Article { MarlettoVKPBRAGDG2022,
   subid = {2679},
   title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment},
   journal = {Physical Review Letters},
   year = {2022},
   month = {2},
   day = {23},
   volume = {128},
   number = {8},
   number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology},
   pages = {080401},
   keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics},
   web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401},
   misc2 = {EMPIR 2020: Industry},
   publisher = {American Physical Society (APS)},
   address = {Ridge, NY, United States},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.128.080401},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.}
}

@Article { MarlettoVKPBRAGDG20220,
   subid = {2679},
   title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment},
   journal = {Physical Review Letters},
   year = {2022},
   month = {2},
   day = {23},
   volume = {128},
   number = {8},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {080401},
   keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics},
   web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   address = {Ridge, NY, United States},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.128.080401},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.}
}

@Article { MarlettoVKPBRAGDG20221,
   subid = {2679},
   title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment},
   journal = {Physical Review Letters},
   year = {2022},
   month = {2},
   day = {23},
   volume = {128},
   number = {8},
   number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology},
   pages = {080401},
   keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics},
   web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {American Physical Society (APS)},
   address = {Ridge, NY, United States},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.128.080401},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.}
}

@Article { LibrizziURGRDDdP2022,
   subid = {2595},
   title = {Ultrasounds induce blood–brain barrier opening across a sonolucent polyolefin plate in an in vitro isolated brain preparation},
   journal = {Scientific Reports},
   year = {2022},
   month = {2},
   day = {21},
   volume = {12},
   number = {1},
   number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept},
   keywords = {Ultrasounds, blood–brain barrier},
   misc2 = {EMPIR 2018: Health},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-022-06791-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Librizzi, L. and Uva, L. and Raspagliesi, L. and Gionso, M. and Regondi, M.C. and Durando, G. and DiMeco, F. and de Curtis, M. and Prada, F.}
}

@Article { ZutzBKHR2022,
   subid = {2630},
   title = {DEVELOPMENT OF A EUROPEAN METROLOGY NETWORK FOR RELIABLE RADIATION PROTECTION: PULSED HIGH ENERGY PHOTON REFERENCE FIELD AS A METROLOGICAL GAP IN RADIATION PROTECTION},
   journal = {Physica Medica},
   year = {2022},
   month = {2},
   volume = {94},
   number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation},
   pages = {S113},
   keywords = {high energy pulsed fields, European Metrology Network for Radiation Protection, photon reference field, metrological gaps, supportBSS},
   misc2 = {EMPIR 2019: Support for Networks},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1120-1797},
   DOI = {10.1016/S1120-1797(22)01699-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zutz, H. and Busse, J. and Khanbabaee, B. and Hupe, O. and R{\"o}ttger, A.}
}

@Article { RicciardiM2022,
   subid = {2558},
   title = {In Materia Should Be Used Instead of In Materio},
   journal = {Frontiers in Nanotechnology},
   year = {2022},
   month = {2},
   volume = {4},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   pages = {850561},
   keywords = {neuromorphic devices, nanowire networks, in materio computing, Latin phrases, reservoir computing},
   web_url = {https://www.frontiersin.org/articles/10.3389/fnano.2022.850561/full},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {Frontiers Media SA},
   language = {30},
   ISSN = {2673-3013},
   DOI = {10.3389/fnano.2022.850561},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ricciardi, C. and Milano, G.}
}

@Article { WeingartnerHVVROKMD2022,
   subid = {2519},
   title = {Comparing black-carbon- and aerosol-absorption-measuring instruments – a new system using lab-generated soot coated with controlled amounts of secondary organic matter},
   journal = {Atmospheric Measurement Techniques},
   year = {2022},
   month = {2},
   number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants},
   keywords = {soot , black carbon, absorption photometer, photo-thermal interferometer, calibration},
   misc2 = {EMPIR 2018: Health},
   language = {30},
   DOI = {10.5194/amt-15-561-2022},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weingartner, E. and Hyv{\"a}rinen, A-P. and Vasilatou, K. and Visser, B. and R{\"o}rhbein, J. and Oscity, M. and Kalbermatter, D. and Močnik, G. and Drinovec, L.}
}

@Article { MilanoBVR2022,
   subid = {2556},
   title = {Memristive devices based on single ZnO nanowires—from material synthesis to neuromorphic functionalities},
   journal = {Semiconductor Science and Technology},
   year = {2022},
   month = {1},
   day = {28},
   volume = {37},
   number = {3},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   pages = {034002},
   keywords = {nanowires, ZnO, chemical vapor deposition (CVD), resistive switching,memristive devices, neuromorphic devices},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6641/ac4b8a},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0268-1242, 1361-6641},
   DOI = {10.1088/1361-6641/ac4b8a},
   stag_bib_extends_levelofaccess = {NA},
   author = {Milano, G. and Boarino, L. and Valov, I. and Ricciardi, C.}
}

@Article { KuckLHGCRPSGBFLTTCMDTRR2022,
   subid = {2486},
   title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art},
   journal = {Applied Physics B},
   year = {2022},
   month = {1},
   day = {23},
   volume = {128},
   number = {2},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {Single photon sources, quantum radiometry, quantum metrology},
   web_url = {https://doi.org/10.1007/s00340-021-07734-2},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0946-2171, 1432-0649},
   DOI = {10.1007/s00340-021-07734-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.}
}

@Article { KuckLHGCRPSGBFLTTCMDTRR2022_2,
   subid = {2752},
   title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art},
   journal = {Applied Physics B},
   year = {2022},
   month = {1},
   day = {23},
   volume = {128},
   number = {2},
   number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology},
   keywords = {Single-photon sources, quantum radiometry, calibration, single photon detectors. defect centres, (nano-)diamonds, molecule semiconductor quantum dots, photon flux, single-photon purity, spectral power distribution},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0946-2171, 1432-0649},
   DOI = {10.1007/s00340-021-07734-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.}
}

@Article { TongBKRGGGCHC2022,
   subid = {2570},
   title = {Cathodoluminescence mapping of electron concentration in MBE-grown GaAs:Te nanowires},
   journal = {Nanotechnology},
   year = {2022},
   month = {1},
   day = {22},
   volume = {33},
   number = {18},
   number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices},
   pages = {185704},
   keywords = {nanowires, GaAs, doping, cathodoluminescence},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/ac4d58},
   misc2 = {EMPIR 2019: Energy},
   publisher = {IOP},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://hal.archives-ouvertes.fr/hal-03539939},
   author = {Tong, C. and Bidaud, T. and Koivusalo, E. and Rizzo Piton, M. and Guina, M. and Galeti, H. and Galvao Gobato, Y. and Cattoni, A. and Hakkarainen, T. and Collin, S.}
}

@Article { MontanoMR2022,
   subid = {2557},
   title = {Grid-graph modeling of emergent neuromorphic dynamics and heterosynaptic plasticity in memristive nanonetworks},
   journal = {Neuromorphic Computing and Engineering},
   year = {2022},
   month = {1},
   day = {20},
   volume = {2},
   number = {1},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   pages = {014007},
   keywords = {nanoarchitectures, nanowire networks, memristive networks, heterosynaptic plasticity, neuromorphic systems, self-organizing systems},
   web_url = {https://iopscience.iop.org/article/10.1088/2634-4386/ac4d86},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2634-4386},
   DOI = {10.1088/2634-4386/ac4d86},
   stag_bib_extends_levelofaccess = {NA},
   author = {Montano, K. and Milano, G. and Ricciardi, C.}
}

@Article { KellerSKFCVCOBHMMNORBCNCDDGLVWZK2022,
   subid = {2778},
   title = {RNA reference materials with defined viral RNA loads of SARS-CoV-2—A useful tool towards a better PCR assay harmonization},
   journal = {PLOS ONE},
   year = {2022},
   month = {1},
   day = {20},
   volume = {17},
   number = {1},
   number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis},
   pages = {e0262656},
   keywords = {SARS-CoV-2, RNA, PCR},
   misc2 = {EMPIR 2018: Health},
   publisher = {Public Library of Science (PLoS)},
   language = {30},
   ISSN = {1932-6203},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6637818},
   author = {Keller, T. and Schellenberg, I. and Kummrow, A. and Falak, S. and Cleveland, M.H. and Vallone, P.M. and Cowen, S. and O’Sullivan, D. and Busby, E. and Huggett, J. and Mielke, M. and Michel, J. and Nitsche, A. and Obermeier, M. and Rabenau, H.F. and Berger, A. and Ciesek, S. and Niemeyer, D. and Corman, V. and Duehring, U. and Drosten, C. and Grunert, H-P. and Lindig, V. and Vierbaum, L. and Wojtalewicz, N. and Zeichhardt, H. and Kammel, M.}
}

@Article { BeckhoffURHTHE2022,
   subid = {2463},
   title = {Investigating Membrane‐Mediated Antimicrobial Peptide Interactions with Synchrotron Radiation Far‐Infrared Spectroscopy},
   journal = {ChemPhysChem},
   year = {2022},
   month = {1},
   day = {14},
   number2 = {HLT10: BiOrigin: Metrology for biomolecular origin of disease},
   pages = {1-11},
   keywords = {antimicrobialpeptides, electrostatic interactions, IR spectroscopy, phospholipid membranes, protein folding},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Wiley},
   language = {30},
   ISSN = {1439-4235, 1439-7641},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.1002/cphc.202100815},
   author = {Beckhoff, B. and Ulm, G. and Ryadnov, M.G. and Hoehl, A. and Tiersch, B. and Hornemann, A. and Eichert, D.M.}
}

@Article { MertesRR2022,
   subid = {2442},
   title = {Development of 222Rn Emanation Sources with Integrated Quasi 2pi Active Monitoring},
   journal = {International Journal of Environmental Research and Public Health},
   year = {2022},
   month = {1},
   day = {12},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   keywords = {222Rn emanation; physical vapor deposition; silicon detectors},
   misc2 = {EMPIR 2019: Environment},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {10.3390/ijerph19020840},
   author = {Mertes, F. and R{\"o}ttger, S. and R{\"o}ttger, A.}
}

@Article { MertesRR2022_2,
   subid = {2480},
   title = {Development of 222Rn Emanation Sources with Integrated Quasi 2\(\pi\) Active Monitoring},
   journal = {International Journal of Environmental Research and Public Health},
   year = {2022},
   month = {1},
   day = {12},
   volume = {19},
   number = {2},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   pages = {840},
   keywords = {222Rn emanation; physical vapor deposition; silicon detectors},
   misc2 = {EMPIR 2019: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1660-4601},
   DOI = {10.3390/ijerph19020840},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mertes, F. and R{\"o}ttger, S. and R{\"o}ttger, A.}
}

@Article { ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022,
   subid = {2567},
   title = {2022 roadmap on neuromorphic computing and engineering},
   journal = {Neuromorphic Computing and Engineering},
   year = {2022},
   month = {1},
   day = {12},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   keywords = {neuromorphic computing, neuromorphic engineering},
   web_url = {https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2634-4386},
   DOI = {10.1088/2634-4386/ac4a83},
   stag_bib_extends_levelofaccess = {NA},
   author = {Christensen, D.V. and Dittmann, R. and Linares-Barranco, B. and Sebastian, A. and Le Gallo, M. and Redaelli, A. and Slesazeck, S. and Mikolajick, T. and Spiga, S. and Menzel, S. and Valov, I. and Milano, G. and Ricciardi, C. and Liang, S-J. and Miao, F. and Lanza, M. and Quill, T.J. and Keene, S.T. and Salleo, A. and Grollier, J. and Markovic, D. and Mizrahi, A. and Yao, P. and Yang, J.J. and Indiveri, G. and Strachan, J.P. and Datta, S. and Vianello, E. and Valentian, A. and Feldmann, J. and Li, X. and Pernice, W.H.P. and Bhaskaran, H. and Furber, S. and Neftci, E. and Scherr, F. and Maass, W. and Ramaswamy, S. and Tapson, J. and Panda, P. and Kim, Y. and Tanaka, G. and Thorpe, S. and Bartolozzi, C. and Cleland, T.A. and Posch, C. and Liu, S-C. and Panuccio, G. and Mahmud, M. and Mazumder, A.N. and Hosseini, M. and Mohsenin, T. and Donati, E. and Tolu, S. and Galeazzi, R. and Christensen, M.E. and Holm, S. and Ielmini, D. and Pryds, N.}
}

@Article { ChristinckRLGHGK2022,
   subid = {2506},
   title = {Comparison of back focal plane imaging of nitrogen vacancy centers in nanodiamond and core-shell CdSe/CdS quantum dots},
   journal = {Journal of Physics: Conference Series},
   year = {2022},
   month = {1},
   volume = {2149},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {012014},
   keywords = {nitrogen vacancy center, nanodiamond, CdSe/CdS quantum dots, back focal imaging},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/2149/1/012014},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/2149/1/012014},
   stag_bib_extends_levelofaccess = {NA},
   author = {Christinck, J. and Rodiek, B. and L{\'o}pez, M. and Georgieva, H. and Hofer, H. and G{\"o}tzinger, S. and K{\"u}ck, S.}
}

@Article { RadulescuCLRGDI2022,
   subid = {2290},
   title = {Inter-comparison of commercial continuous radon monitors responses},
   journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment},
   year = {2022},
   month = {1},
   volume = {1021},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   pages = {165927},
   keywords = {Radon monitoringTransfer standardMetrological traceability},
   misc2 = {EMPIR 2019: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0168-9002},
   DOI = {10.1016/j.nima.2021.165927},
   stag_bib_extends_levelofaccess = {NA},
   author = {Radulescu, I. and Calin, M.R. and Luca, A. and R{\"o}ttger, A. and Grossi, C. and Done, L. and Ioan, M.R.}
}

@Article { CelikovicPVNiCGBQR2022,
   subid = {2428},
   title = {Outdoor Radon as a Tool to Estimate Radon Priority Areas—A Literature Overview},
   journal = {International Journal of Environmental Research and Public Health},
   year = {2022},
   month = {1},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   keywords = {outdoor radon concentrations; literature overview; radiation risk; indoor radonconcentrations; radon priority areas},
   misc2 = {EMPIR 2019: Environment},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.3390/ijerph19020662},
   author = {Čeliković, I. and Pantelić, G. and Vukanac, I. and Nikolić, J.K. and Živanović, M. and Cinelli, G. and Gruber, V. and Baumann, S. and Quindos Poncela, L.S. and Rabago, D.}
}

@Article { FasoloBBCCCCCDEFFFFGGGGKLLLMMMMMMMNOPPPRRRSUV2022,
   subid = {2612},
   title = {Bimodal Approach for Noise Figures of Merit Evaluation in Quantum-Limited Josephson Traveling Wave Parametric Amplifiers},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2022},
   number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology},
   keywords = {Physics, Gain, Microwave amplifiers, Noise figure, Superconducting microwave devices, Microwave photonics, Bandwidth},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {1051-8223, 1558-2515, 2378-707},
   DOI = {10.1109/TASC.2022.3148692},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fasolo, L. and Barone, C. and Borghesi, M. and Carapella, G. and Caricato, A.P. and Carusotto, I. and Chung, W. and Cian, A. and Di Gioacchino, D. and Enrico, E. and Falferi, P. and Faverzani, M. and Ferri, E. and Filatrella, G. and Gatti, C. and Giachero, A. and Giubertoni, D. and Greco, A. and Kutlu, C. and Leo, A. and Ligi, C. and Livreri, P. and Maccarone, G. and Margesin, B. and Maruccio, G. and Matlashov, A. and Mauro, C. and Mezzena, R. and Monteduro, A.G. and Nucciotti, A. and Oberto, L. and Pagano, S. and Pierro, V. and Piersanti, L. and Rajteri, M. and Rettaroli, A. and Rizzato, S. and Semertzidis, Y.K. and Uchaikin, S.V. and Vinante, A.}
}

@Article { HrabinaHRCPZLC2022,
   subid = {2785},
   title = {Absolute frequencies of H13C14N hydrogen cyanide hyper-fine transitions in 1,5 \(\mu\)m region with saturated spectroscopy and sub-kHz scanning laser},
   journal = {Optics Letters},
   year = {2022},
   volume = {TBD},
   number = {TBD},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   pages = {TBD},
   keywords = {saturated spectroscopy, hydrogen cyanide, scanning laser},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Optica},
   language = {30},
   ISSN = {1539-4794},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2206.09232},
   author = {Hrabina, J. and Hošek, M. and Rerucha, S. and Č{\'i}žek, M. and Pilat, Z. and Zucco, M. and Lazar, J. and Č{\'i}p, O.}
}

@Article { MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022,
   subid = {2764},
   title = {Versailles project on advanced materials and standards (VAMAS) interlaboratory study on measuring the number concentration of colloidal gold nanoparticles},
   journal = {Nanoscale},
   year = {2022},
   volume = {14},
   number = {12},
   number2 = {18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration},
   pages = {4690-4704},
   keywords = {nanoparticle, concentration, standardization, VAMAS,  interlaboratory},
   misc2 = {EMPIR 2018: Support for Impact},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2040-3364, 2040-3372},
   DOI = {10.1039/D1NR07775A},
   stag_bib_extends_levelofaccess = {NA},
   author = {Minelli, C. and Wywijas, M. and Bartczak, D. and Cuello-Nu{\~n}ez, S. and Infante, H.G. and Deumer, J. and Gollwitzer, C. and Krumrey, M. and Murphy, K.E. and Johnson, M.E. and Montoro Bustos, A.R. and Strenge, I.H. and Faure, B. and H{\o}gh{\o}j, P. and Tong, V. and Burr, L. and Norling, K. and H{\"o}{\"o}k, F. and Roesslein, M. and Kocic, J. and Hendriks, L. and Kestens, V. and Ramaye, Y. and Contreras Lopez, M.C. and Auclair, G. and Mehn, D. and Gilliland, D. and Potthoff, A. and Oelschl{\"a}gel, K. and Tentschert, J. and Jungnickel, H. and Krause, B.C. and Hachenberger, Y.U. and Reichardt, P. and Luch, A. and Whittaker, T.E. and Stevens, M.M. and Gupta, S. and Singh, A. and Lin, F-h. and Liu, Y-H. and Costa, A.L. and Baldisserri, C. and Jawad, R. and Andaloussi, S.E.L. and Holme, M.N. and Lee, T.G. and Kwak, M. and Kim, J. and Ziebel, J. and Guignard, C. and Cambier, S. and Contal, S. and Gutleb, A.C. and “Kuba” Tatarkiewicz, J. and Jankiewicz, B.J. and Bartosewicz, B. and Wu, X. and Fagan, J.A. and Elje, E. and Rund{\'e}n-Pran, E. and Dusinska, M. and Kaur, I.P. and Price, D. and Nesbitt, I. and O\(\prime\) Reilly, S. and Peters, R.J.B. and Bucher, G. and Coleman, D. and Harrison, A.J. and Ghanem, A. and Gering, A. and McCarron, E. and Fitzgerald, N. and Cornelis, G. and Tuoriniemi, J. and Sakai, M. and Tsuchida, H. and Maguire, C. and Prina-Mello, A. and Lawlor, A.J. and Adams, J. and Schultz, C.L. and Constantin, D. and Thanh, N.T.K. and Tung, L.D. and Panariello, L. and Damilos, S. and Gavriilidis, A. and Lynch, I. and Fryer, B. and Carrazco Quevedo, A. and Guggenheim, E. and Briffa, S. and Valsami-Jones, E. and Huang, Y. and Keller, A.A. and Kinnunen, V-T. and Per{\"a}m{\"a}ki, S. and Krpetic, Z. and Greenwood, M. and Shard, A.G.}
}

@Article { RobertIK2021,
   subid = {2163},
   title = {Variable Launch System for the Metrology of EOCBs},
   journal = {International Journal of Optics and Photonic Engineering},
   year = {2021},
   month = {12},
   day = {31},
   volume = {6},
   number = {1},
   number2 = {19SIP05: TTPWC: Technology Transfer of Photonic Waveguide Characterisation},
   pages = {6:037},
   keywords = {Optical metrology, EOCB, Optical interconnect},
   web_url = {https://vibgyorpublishers.org/content/ijope/ijope-6-037.pdf},
   misc2 = {EMPIR 2019: Support for Impact},
   publisher = {VIBGYOR ePress},
   language = {30},
   ISSN = {2631-5092},
   DOI = {10.35840/2631-5092/4537},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robert, F. and Irshaad, F. and Ka-ming, L.}
}

@Article { MiloroABBZFR2021,
   subid = {2444},
   title = {A standard test phantom for the performance assessment of magnetic resonance guided high intensity focused ultrasound (MRgHIFU) thermal therapy devices},
   journal = {International Journal of Hyperthermia},
   year = {2021},
   month = {12},
   day = {22},
   volume = {39},
   number = {1},
   number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept},
   pages = {57-68},
   keywords = {HIFU; thermal ablation; quality control; phantom; thermal dosimetry},
   web_url = {https://www.tandfonline.com/doi/full/10.1080/02656736.2021.2017023},
   misc2 = {EMPIR 2018: Health},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {0265-6736, 1464-5157},
   DOI = {10.1080/02656736.2021.2017023},
   stag_bib_extends_levelofaccess = {NA},
   author = {Miloro, P and Ambrogio, S. and Bosio, F. and Ba{\^e}sso, R.M. and Zeqiri, B. and Fedele, F. and Ramnarine, K.V.}
}

@Article { McManusRRPS2021,
   subid = {2658},
   title = {A Geant4 Fano test for novel very high energy electron beams},
   journal = {Physics in Medicine \& Biology},
   year = {2021},
   month = {12},
   day = {21},
   volume = {66},
   number = {24},
   number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates},
   pages = {245023},
   keywords = {Fano, VHEE, dosimetry, geant4},
   misc2 = {EMPIR 2018: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/ac3e0f},
   stag_bib_extends_levelofaccess = {NA},
   author = {McManus, M. and Romano, F. and Royle, G. and Palmans, H. and Subiel, A.}
}

@Article { HirtCHRK2021,
   subid = {2505},
   title = {Sample fabrication and metrological characterization of single-photon emitters based on nitrogen vacancy centers in nanodiamonds},
   journal = {Engineering Research Express},
   year = {2021},
   month = {12},
   volume = {3},
   number = {4},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {045038},
   keywords = {nitrogen vacancy center, nanodiamond, single-photon source, fabrication},
   web_url = {https://iopscience.iop.org/article/10.1088/2631-8695/ac34c2},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2631-8695},
   DOI = {10.1088/2631-8695/ac34c2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hirt, F. and Christinck, J. and Hofer, H. and Rodiek, B. and K{\"u}ck, S.}
}

@Article { GersakSNJFDRPSP2021,
   subid = {2330},
   title = {Physiology-based patient simulator for blood pressure meter testing},
   journal = {Measurement: Sensors},
   year = {2021},
   month = {12},
   volume = {18},
   number2 = {18RPT02: adOSSIG: Developing an infrastructure for improved and harmonised metrological checks of blood-pressure measurements in Europe},
   pages = {100260},
   keywords = {Blood pressure, Sphygmomanometer, Simulator, Patient simulator, Oscillometry, Metrology},
   misc2 = {EMPIR 2018: Research Potential},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2665-9174},
   DOI = {10.1016/j.measen.2021.100260},
   stag_bib_extends_levelofaccess = {NA},
   author = {Geršak, G. and Schiebl, M. and Nawotka, M. and Jugo, E. and Ferreira, M. do C. and Duffy, A. and Rosu, D.M. and Pavlasek, P. and Sedl{\'a}k, V. and Praž{\'a}k, D.}
}

@Article { SedlakPSNJFDRPG2021,
   subid = {2331},
   title = {Smart specialisation concept in metrology for blood and intraocular pressure measurements},
   journal = {Measurement: Sensors},
   year = {2021},
   month = {12},
   volume = {18},
   number2 = {18RPT02: adOSSIG: Developing an infrastructure for improved and harmonised metrological checks of blood-pressure measurements in Europe},
   pages = {100283},
   keywords = {Medical metrology, Smart specialisation concept, Metrological traceability, Intraocular pressure, Blood pressure},
   misc2 = {EMPIR 2018: Research Potential},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2665-9174},
   DOI = {10.1016/j.measen.2021.100283},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sedl{\'a}k, V. and Praž{\'a}k, D. and Schiebl, M. and Nawotka, M. and Jugo, E. and Ferreira, M. do C. and Duffy, A. and Rosu, D.M. and Pavlasek, P. and Geršak, G.}
}

@Article { OgrincRDBMBKOAGQMUOG2021,
   subid = {2701},
   title = {Support for a European metrology network on food safety Food-MetNet},
   journal = {Measurement: Sensors},
   year = {2021},
   month = {12},
   volume = {18},
   number2 = {20NET02: Food-MetNet: Support for a European Metrology Network on Food Safety},
   pages = {100285},
   keywords = {Food; Metrology; Network; Safety; Stakeholders},
   misc2 = {EMPIR 2020: Support for Networks},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2665-9174},
   DOI = {10.1016/j.measen.2021.100285},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ogrinc, N. and Rossi, A.M. and Durbiano, F. and Becker, R. and Milavec, M. and Bogožalec Košir, A. and Kakoulides, E. and Ozer, H. and Ak\c{c}adag, F. and Goenaga-Infante, H. and Quaglia, M. and Mallia, S. and Umbricht, G. and O'Connor, G. and Guettler, B.}
}

@Article { MertesKHKSWRRWW2021,
   subid = {2423},
   title = {Ion implantation of 226Ra for a primary 222Rn emanation standard},
   journal = {Applied Radiation and Isotopes},
   year = {2021},
   month = {12},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   keywords = {Ion implantation222Rn emanationLaser ionizationDefined solid-angle alpha-particle spectrometry},
   misc2 = {EMPIR 2019: Environment},
   language = {30},
   DOI = {10.1016/j.apradiso.2021.110093},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mertes, F. and Kneip, N. and Heinke, R. and Kieck, T. and Studer, D. and Weber, F. and R{\"o}ttger, S. and R{\"o}ttger, A. and Wendt, K. and Walther, C.}
}

@Article { AssoulineJBWTJGKRPR2021,
   subid = {2371},
   title = {Excitonic nature of magnons in a quantum Hall ferromagnet},
   journal = {Nature Physics},
   year = {2021},
   month = {12},
   volume = {17},
   number = {12},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {1369-1374},
   keywords = {Graphene, mangons, interferometry, p-n-junction},
   web_url = {https://arxiv.org/abs/2102.02068},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1745-2473, 1745-2481},
   DOI = {10.1038/s41567-021-01411-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Assouline, A. and Jo, M. and Brasseur, P. and Watanabe, K. and Taniguchi, T. and Jolicoeur, Th. and Glattli, D.C. and Kumada, N. and Roche, P. and Parmentier, F.D. and Roulleau, P.}
}

@Article { SudTSBSDSSWZZRCKKC2021,
   subid = {2383},
   title = {Tailoring interfacial effect in multilayers with Dzyaloshinskii–Moriya interaction by helium ion irradiation},
   journal = {Scientific Reports},
   year = {2021},
   month = {12},
   volume = {11},
   number = {23626},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   keywords = {Spintronics, Nano magnetism, Magnetic skyrmions, Dzyaloshinskii–Moriya interaction},
   web_url = {https://www.nature.com/articles/s41598-021-02902-y.pdf},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   DOI = {10.1038/s41598-021-02902-y},
   stag_bib_extends_levelofaccess = {NA},
   author = { Sud, A. and Tacchi, S. and Sagkovits, D.  and Barton, C. and Sall, M. and Diez, L.H.  and Stylianidis,  E.  and Smith, N. and Wright, L. and Zhang,  S.  and Zhang, X. and Ravelosona, D.  and Carlotti, G. and Kurebayashi, H.  and Kazakova, O. and Cubukcu, M. }
}

@Article { RosnerWGB2021,
   subid = {2603},
   title = {Uncertainty evaluation for complex GPS characteristics},
   journal = {Measurement: Sensors},
   year = {2021},
   month = {12},
   volume = {18},
   number = {-},
   number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry},
   pages = {100323},
   keywords = {Coordinate measuring systems, Measurement uncertainty, Geometrical product specification, Sensitivity analysis, GUM uncertainty Framework},
   web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421002865},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2665-9174},
   DOI = {10.1016/j.measen.2021.100323},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rosner, P. and Wojtyła, M. and Gomez-Acedo, E. and Balsamo, A.}
}

@Article { WojtyaRFSB2021,
   subid = {2605},
   title = {Verification of sensitivity analysis method of measurement uncertainty evaluation},
   journal = {Measurement: Sensors},
   year = {2021},
   month = {12},
   volume = {18},
   number = {Part of sp},
   number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry},
   pages = {100274},
   keywords = {Coordinate measuring machines, Measurement uncertainty, Geometrical product specification, Sensitivity analysis, GUM uncertainty Framework, Uncertainty evaluating software},
   web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421002373},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2665-9174},
   DOI = {10.1016/j.measen.2021.100274},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wojtyła, M. and Rosner, P. and Forbes, A.B. and Savio, E. and Balsamo, A.}
}

@Article { KoybasiNTPRPBMSKGOIG2021,
   subid = {2601},
   title = {High Performance Predictable Quantum Efficient Detector Based on Induced-Junction Photodiodes Passivated with SiO2/SiNx},
   journal = {Sensors},
   year = {2021},
   month = {11},
   day = {24},
   volume = {21},
   number = {23},
   number2 = {18SIB10: chipS·CALe: Self-calibrating photodiodes for the radiometric linkage to fundamental constants},
   pages = {7807},
   keywords = {silicon photodetector; inversion layer photodiode; induced-junction; surface passivation;PECVD silicon nitride; radiometry; optical power; primary standard; predictable quantum efficiency},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s21237807},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koybasi, O. and Nordseth, {\O}. and Tran, T. and Povoli, M. and Rajteri, M. and Pepe, C. and Bardalen, E. and Manoocheri, F. and Summanwar, A. and Korpusenko, M. and Getz, M.N. and Ohlckers, P. and Ikonen, E. and Gran, J.}
}

@Proceedings { MierR2019,
   subid = {2398},
   title = {Test Bench and Frequency Response of a Magnetic Antenna used in GIS PD Measurements},
   journal = {2021 IEEE Electrical Insulation Conference},
   year = {2021},
   month = {11},
   day = {21},
   number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission},
   pages = {269-272},
   keywords = {Partial discharge, VHF, UHF, gas insulated substation, magnetic antenna, loop antenna, test bench, frequency response},
   tags = {SEG},
   misc2 = {EMPIR 2019: Energy},
   publisher = {IEEE},
   event_place = {Denver, Colorado},
   event_name = {2021 IEEE Electrical Insulation Conference},
   event_date = {07-06-2021 to 28-06-2021},
   language = {30},
   ISBN = {978-1-6654-1564-4},
   ISSN = {2576-6791},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5815711},
   author = {Mier, C. and Rodrigo, A.}
}

@Article { NugrohoHPRYIKPWS2021,
   subid = {2473},
   title = {Vertically Aligned n-Type Silicon Nanowire Array as a Free-Standing Anode for Lithium-Ion Batteries},
   journal = {Nanomaterials},
   year = {2021},
   month = {11},
   day = {20},
   volume = {11},
   number = {11},
   number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices},
   pages = {3137},
   keywords = {silicon nanowire, nanowire array, silicon anode, n-type silicon anode, Li-ion battery},
   misc2 = {EMPIR 2019: Energy},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2079-4991},
   DOI = {10.3390/nano11113137},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nugroho, A.P. and Hawari, N.H. and Prakoso, B. and Refino, A.D. and Yulianto, N. and Iskandar, F. and Kartini, E. and Peiner, E. and Wasisto, H.S. and Sumboja, A.}
}

@Article { RottgerVSPDISBAGGBWPiN2021,
   subid = {2317},
   title = {Metrology for radiation protection: a new European network  in the foundation phase},
   journal = {Advances in Geosciences},
   year = {2021},
   month = {11},
   day = {17},
   volume = {57},
   number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation},
   pages = {1-7},
   keywords = {supportBSS, EMN for Radiation Protection, metrology, regulation, EURAMET, EURATOM},
   misc2 = {EMPIR 2019: Support for Networks},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1680-7359},
   DOI = {10.5194/adgeo-57-1-2021},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"o}ttger, A. and Veres, A. and Sochor, V. and Pinto, M. and Derlacinski, M. and Ioan, M-R. and Sabeta, A. and Bernat, R. and Adam-Guillermin, C. and Gracia Alves, J.H. and Glavič-Cindro, D. and Bell, S. and Wens, B. and Persson, L. and Živanović, M. and Nylund, R.}
}

@Article { RiemannAEBMSSRIF2021,
   subid = {2569},
   title = {Assessment of measurement precision in single‐voxel spectroscopy at 7 T: Toward minimal detectable changes of metabolite concentrations in the human brain in vivo},
   journal = {Magnetic Resonance in Medicine},
   year = {2021},
   month = {11},
   day = {16},
   volume = {87},
   number = {3},
   number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases},
   pages = {1119-1135},
   keywords = {CRLBs, measurement precision, minimal detectable change, MR spectroscopy, reproducibility/repeatability, SPECIAL},
   web_url = {https://onlinelibrary.wiley.com/doi/10.1002/mrm.29034},
   misc2 = {EMPIR 2018: Health},
   publisher = {Wiley},
   language = {30},
   ISSN = {0740-3194, 1522-2594},
   DOI = {10.1002/mrm.29034},
   stag_bib_extends_levelofaccess = {NA},
   author = {Riemann, L.T. and Aigner, C.S. and Ellison, S.L.R. and Br{\"u}hl, R. and Mekle, R. and Schmitter, S. and Speck, O. and Rose, G. and Ittermann, B. and Fillmer, A.}
}

@Article { RazoukBHH2021,
   subid = {2324},
   title = {Towards accurate measurements of specific heat of solids by drop calorimetry up to 3000 \(^{\circ}\)C},
   journal = {Thermal Science and Engineering Progress},
   year = {2021},
   month = {11},
   volume = {26},
   number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties},
   pages = {101130},
   keywords = {Drop calorimetry, Specific heat, High temperature, Metrology},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2451-9049},
   DOI = {10.1016/j.tsep.2021.101130},
   stag_bib_extends_levelofaccess = {NA},
   author = {Razouk, R. and Beaumont, O. and Hameury, J. and Hay, B.}
}

@Article { RagusaAFd2021,
   subid = {2397},
   title = {Anisotropy of losses in grain-oriented Fe–Si},
   journal = {AIP Advances},
   year = {2021},
   month = {11},
   volume = {11},
   number = {11},
   number2 = {19ENG06: HEFMAG: Metrology of magnetic losses in electrical steel sheets for high-efficiency energy conversion},
   pages = {115208},
   keywords = {Magnetic hysteresis,Magnetic properties,Electrical grid,Magnetization dynamics,Eddy current,Magnetic materials,Magneto-optical imaging,Transformer Ferromagnetic materials},
   misc2 = {EMPIR 2019: Energy},
   publisher = {AIP},
   address = {College Park, Maryland},
   language = {30},
   ISSN = {2158-3226},
   DOI = {10.1063/5.0066131},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ragusa, C. and Appino, C. and Ferrara, E. and de la Barri{\`e}re, O.}
}

@Article { HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021,
   subid = {2336},
   title = {Frequency drift in MR spectroscopy at 3T},
   journal = {NeuroImage},
   year = {2021},
   month = {11},
   volume = {241},
   number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases},
   pages = {118430},
   keywords = {Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site},
   misc2 = {EMPIR 2018: Health},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1053-8119},
   DOI = {10.1016/j.neuroimage.2021.118430},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hui, S.C.N. and Mikkelsen, M. and Z{\"o}llner, H.J. and Ahluwalia, V. and Alcauter, S. and Baltusis, L. and Barany, D.A. and Barlow, L.R. and Becker, R. and Berman, J.I. and Berrington, A. and Bhattacharyya, P.K. and Blicher, J.U. and Bogner, W. and Brown, M.S. and Calhoun, V.D. and Castillo, R. and Cecil, K.M. and Choi, Y.B. and Chu, W.C.W. and Clarke, W.T. and Craven, A.R. and Cuypers, K. and Dacko, M. and de la Fuente-Sandoval, C. and Desmond, P. and Domagalik, A. and Dumont, J. and Duncan, N.W. and Dydak, U. and Dyke, K. and Edmondson, D.A. and Ende, G. and Ersland, L. and Evans, C.J. and Fermin, A.S.R. and Ferretti, A. and Fillmer, A. and Gong, T. and Greenhouse, I. and Grist, J.T. and Gu, M. and Harris, A.D. and Hat, K. and Heba, S. and Heckova, E. and Hegarty, J.P. and Heise, K-F. and Honda, S. and Jacobson, A. and Jansen, J.F.A. and Jenkins, C.W. and Johnston, S.J. and Juchem, C. and Kangarlu, A. and Kerr, A.B. and Landheer, K. and Lange, T. and Lee, P. and Levendovszky, S.R. and Limperopoulos, C. and Liu, F. and Lloyd, W. and Lythgoe, D.J. and Machizawa, M.G. and MacMillan, E.L. and Maddock, R.J. and Manzhurtsev, A.V. and Martinez-Gudino, M.L. and Miller, J.J. and Mirzakhanian, H. and Moreno-Ortega, M. and Mullins, P.G. and Nakajima, S. and Near, J. and Noeske, R. and Nordh{\o}y, W. and Oeltzschner, G. and Osorio-Duran, R. and Otaduy, M.C.G. and Pasaye, E.H. and Peeters, R. and Peltier, S.J. and Pilatus, U. and Polomac, N. and Porges, E.C. and Pradhan, S. and Prisciandaro, J.J. and Puts, N.A. and Rae, C.D. and Reyes-Madrigal, F. and Roberts, T.P.L. and Robertson, C.E. and Rosenberg, J.T. and Rotaru, D-G. and O'Gorman Tuura, R.L. and Saleh, M.G. and Sandberg, K. and Sangill, R. and Schembri, K. and Schrantee, A. and Semenova, N.A. and Singel, D. and Sitnikov, R. and Smith, J. and Song, Y. and Stark, C. and Stoffers, D. and Swinnen, S.P. and Tain, R. and Tanase, C. and Tapper, S. and Tegenthoff, M. and Thiel, T. and Thioux, M. and Truong, P. and van Dijk, P. and Vella, N. and Vidyasagar, R. and Vovk, A. and Wang, G. and Westlye, L.T. and Wilbur, T.K. and Willoughby, W.R. and Wilson, M. and Wittsack, H-J. and Woods, A.J. and Wu, Y-C. and Xu, J. and Lopez, M.Y. and Yeung, D.K.W. and Zhao, Q. and Zhou, X. and Zupan, G. and Edden, R.A.E.}
}

@Article { RipaIGSGFBLDG2021_2,
   subid = {2694},
   title = {Corrigendum: Refractive index gas thermometry between 13.8 K and 161.4 K (2021 Metrologia                   58 025008)},
   journal = {Metrologia},
   year = {2021},
   month = {10},
   day = {25},
   volume = {58},
   number = {6},
   number2 = {18SIB02: Real-K: Realising the redefined kelvin},
   pages = {069501},
   keywords = {refractive index gas thermometry},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ac2d9e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ripa, D.M. and Imbraguglio, D. and Gaiser, C. and Steur, P.P.M. and Giraudi, D. and Fogliati, M. and Bertinetti, M. and Lopardo, G. and Dematteis, R. and Gavioso, R.M.}
}

@Proceedings { HosekRHCC2021,
   subid = {2703},
   title = {Measurement of the Hydrogen Cyanide Absorption Lines' Centers with the Potential for Mise en Pratique},
   journal = {Conference IEEE EFTF IFCS 2021},
   year = {2021},
   month = {10},
   day = {19},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   keywords = {hydrogen cyanide, linear absorption spectroscopy, optical frequency comb, frequency reference, frequency stabilized lasers, SI unit meter},
   web_url = {https://zenodo.org/record/6497486},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IEEE Service Center},
   event_place = {Online},
   event_name = {Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)},
   event_date = {07-07-2021 to 17-07-2021},
   language = {30},
   ISBN = {978-1-6654-3935-0},
   ISSN = {2327-1949},
   DOI = {10.1109/EFTF/IFCS52194.2021.9604261},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hošek, M. and Rerucha, S. and Hrabina, J. and Č{\'i}žek, M. and Č{\'i}p, O.}
}

@Proceedings { HrabinaHRPLCP2021,
   subid = {2704},
   title = {Saturated Spectroscopy of HCN},
   journal = {Conference IEEE EFTF IFCS 2021},
   year = {2021},
   month = {10},
   day = {19},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   keywords = {saturated spectroscopy, optical frequency standard, hydrogen cyanide},
   web_url = {https://zenodo.org/record/6497501},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IEEE Service Center},
   event_place = {Online},
   event_name = {Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)},
   event_date = {07-07-2021 to 17-07-2021},
   language = {30},
   ISBN = {978-1-6654-3935-0},
   ISSN = {2327-1949},
   DOI = {10.1109/EFTF/IFCS52194.2021.9604272},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hrabina, J. and Hošek, M. and Rerucha, S. and Pravdova, L. and Lazar, J. and Č{\'i}p, O. and Pilat, Z.}
}

@Article { HayBFFGRDH2021,
   subid = {2250},
   title = {Uncertainty Assessment for Very High Temperature Thermal Diffusivity Measurements on Molybdenum, Tungsten and Isotropic Graphite},
   journal = {International Journal of Thermophysics},
   year = {2021},
   month = {10},
   day = {17},
   volume = {43},
   number = {1},
   number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties},
   keywords = {High temperature, Isotropic graphite, Molybdenum, Thermal diffusivity, Tungsten, Uncertainty},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-021-02926-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hay, B. and Beaumont, O. and Failleau, G. and Fleurence, N. and Grelard, M. and Razouk, R. and Dav{\'e}e, G. and Hameury, J.}
}

@Article { ArrheniusABMBWBGLCSBNR2021,
   subid = {2482},
   title = {Strategies for the sampling of hydrogen at refuelling stations for purity assessment},
   journal = {International Journal of Hydrogen Energy},
   year = {2021},
   month = {10},
   day = {11},
   volume = {46},
   number = {70},
   number2 = {19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2},
   pages = {34839-34853},
   keywords = {Hydrogen,Refuelling stations,Sampling device,Fuel quality assessment},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0360319921031694},
   misc2 = {EMPIR 2019: Energy},
   publisher = {Elsevier},
   language = {30},
   ISSN = {0360-3199},
   DOI = {10.1016/j.ijhydene.2021.08.043},
   stag_bib_extends_levelofaccess = {NA},
   author = {Arrhenius, K. and Aarhaug, T.A. and Bacquart, T. and Morris, A. and Bartlett, S. and Wagner, L. and Blondeel, C. and Gozlan, B. and Lescornes, Y. and Chramosta, N. and Spitta, C. and Basset, E. and Nouvelot, Q. and Rizand, M.}
}

@Article { MilanoPMRHBIR2021,
   subid = {2676},
   title = {In materia reservoir computing with a fully memristive architecture based on self-organizing nanowire networks},
   journal = {Nature Materials},
   year = {2021},
   month = {10},
   volume = {21},
   number = {2},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   pages = {195-202},
   keywords = {memristive devices, memristive networks, nanowire networks, reservoir computing, physical computing},
   web_url = {https://iris.polito.it/retrieve/handle/11583/2936403/537201/05_Manuscript.pdf},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1476-1122, 1476-4660},
   DOI = {10.1038/s41563-021-01099-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Milano, G. and Pedretti, G. and Montano, K. and Ricci, S. and Hashemkhani, S. and Boarino, L. and Ielmini, D. and Ricciardi, C.}
}

@Article { RefinoYSNHSKIVSPW2021,
   subid = {2474},
   title = {Versatilely tuned vertical silicon nanowire arrays by cryogenic reactive ion etching as a lithium-ion battery anode},
   journal = {Scientific Reports},
   year = {2021},
   month = {10},
   volume = {11},
   number = {1},
   number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices},
   keywords = {high-aspect-ratio silicon (Si), nanowire array, lithium ion batteries, ICP-RIE},
   web_url = {https://www.nature.com/articles/s41598-021-99173-4},
   misc2 = {EMPIR 2019: Energy},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-021-99173-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Refino, A.D. and Yulianto, N. and Syamsu, I. and Nugroho, A.P. and Hawari, N.H. and Syring, A. and Kartini, E. and Iskandar, F. and Voss, T. and Sumboja, A. and Peiner, E. and Wasisto, H.S.}
}

@Article { RottgerRGVCOHCCBIRKCAYFMM2021,
   subid = {2224},
   title = {New metrology for radon at the environmental level},
   journal = {Measurement Science and Technology},
   year = {2021},
   month = {9},
   day = {23},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   keywords = {radon, metrology, tracer, environmental measurements},
   misc2 = {EMPIR 2019: Environment},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ac298d},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"o}ttger, A. and R{\"o}ttger, S. and Grossi, C. and Vargas, A. and Curcoll, R. and Ot{\'a}hal, P. and Hern{\'a}ndez-Ceballos, M.{\'A}. and Cinelli, G. and Chambers, S. and Barbosa, S.A. and Ioan, M-R. and Radulescu, I. and Kikaj, D. and Chung, E. and Arnold, T. and Yver Kwok, C. and Fuente, M. and Mertes, F. and Morosh, V.}
}

@Article { BuonacorsiSSTKHHRWB2021,
   subid = {2168},
   title = {Non-adiabatic single-electron pumps in a dopant-free GaAs/AlGaAs 2DEG},
   journal = {Applied Physics Letters},
   year = {2021},
   month = {9},
   day = {13},
   volume = {119},
   number = {11},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {114001},
   keywords = {Single electron transport, quantum dot, dopant-free GaAs/AlGaAs system, quantum transport, single electron pump},
   web_url = {https://arxiv.org/abs/2102.13320},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/5.0062486},
   stag_bib_extends_levelofaccess = {NA},
   author = {Buonacorsi, B. and Sfigakis, F. and Shetty, A. and Tam, M.C. and Kim, H.S. and Harrigan, S.R. and Hohls, F. and Reimer, M.E. and Wasilewski, Z.R. and Baugh, J.}
}

@Article { EisermannKWR2021,
   subid = {2243},
   title = {Photonic contact thermometry using silicon ring resonators and tuneable laser-based spectroscopy},
   journal = {tm - Technisches Messen},
   year = {2021},
   month = {9},
   volume = {88},
   number = {10},
   number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry},
   pages = {640-654},
   keywords = {Thermometry; photonic; temperature sensor; optical ring resonator},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Walter de Gruyter GmbH},
   language = {30},
   ISSN = {2196-7113, 0171-8096},
   DOI = {10.1515/teme-2021-0054},
   stag_bib_extends_levelofaccess = {NA},
   author = {Eisermann, R. and Krenek, S. and Winzer, G. and Rudtsch, S.}
}

@Article { YamakawaATBFBKRD2021,
   subid = {2038},
   title = {Hg isotopic composition of one-year-old spruce shoots: Application to long-term Hg atmospheric monitoring in Germany},
   journal = {Chemosphere},
   year = {2021},
   month = {9},
   volume = {279},
   number2 = {16ENV01: MercOx: Metrology for oxidised mercury},
   pages = {130631},
   keywords = {Hg isotopic composition,  spruce shoots,  Hg atmospheric monitoring},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0045-6535},
   DOI = {10.1016/j.chemosphere.2021.130631},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yamakawa, A. and Amouroux, D. and Tessier, E. and B{\'e}rail, S. and Fettig, I. and Barre, J.P.G. and Koschorreck, J. and R{\"u}del, H. and Donard, O.F.X.}
}

@Article { MierEscurraRV2021,
   subid = {2366},
   title = {Design and Characterization of a Magnetic Loop Antenna for Partial Discharge Measurements in Gas Insulated Substations},
   journal = {IEEE Sensors Journal},
   year = {2021},
   month = {9},
   volume = {21},
   number = {17},
   number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission},
   pages = {18618-18625},
   keywords = {Magnetic loop antenna, partial discharges, transfer function, electric circuit, GIS, broadband antenna, VHF, high voltage},
   tags = {SEG},
   misc2 = {EMPIR 2019: Energy},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {1530-437X, 1558-1748, 2379-915},
   DOI = {10.1109/JSEN.2021.3089084},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mier Escurra, C. and Rodrigo Mor, A. and Vaessen, P.}
}

@Article { FerreiroVilaMWGPR2021,
   subid = {2241},
   title = {Micro-Kelvin Resolution at Room Temperature Using Nanomechanical Thermometry},
   journal = {ACS Omega},
   year = {2021},
   month = {8},
   day = {27},
   volume = {6},
   number = {36},
   number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry},
   pages = {23052-23058},
   keywords = {stress, membranes, power, resonance structures, lasers},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2470-1343, 2470-1343},
   DOI = {10.1021/acsomega.1c02045},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ferreiro-Vila, E. and Molina, J. and Weituschat, L.M. and Gil-Santos, E. and Postigo, P.A. and Ramos, D.}
}

@Article { DorstRESS2021,
   subid = {2170},
   title = {Influence of synchronization within a sensor network on machine learning results},
   journal = {Journal of Sensors and Sensor Systems},
   year = {2021},
   month = {8},
   day = {24},
   volume = {10},
   number = {2},
   number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future},
   pages = {233-245},
   keywords = {synchronization, machine learning, sensor network},
   web_url = {https://jsss.copernicus.org/articles/10/233/2021/},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {2194-878X},
   DOI = {10.5194/jsss-10-233-2021},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dorst, T. and Robin, Y. and Eichst{\"a}dt, S. and Sch{\"u}tze, A. and Schneider, T.}
}

@Article { SilemekSPHPSRIW2021,
   subid = {2173},
   title = {Rapid safety assessment and mitigation of radiofrequency induced implant heating using small root mean square sensors and the sensor matrix              Q              s},
   journal = {Magnetic Resonance in Medicine},
   year = {2021},
   month = {8},
   day = {16},
   number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations},
   keywords = {magnetic resonance imaging, MR safety, implant safety, parallel transmission, sensor-equipped implants, rms sensors},
   web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/mrm.28968},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Wiley},
   language = {30},
   ISSN = {0740-3194, 1522-2594},
   DOI = {10.1002/mrm.28968},
   stag_bib_extends_levelofaccess = {NA},
   author = {Silemek, B. and Seifert, F. and Petzold, J. and Hoffmann, W. and Pfeiffer, H. and Speck, O. and Rose, G. and Ittermann, B. and Winter, L.}
}

@Article { SousaBDFPRM2021,
   subid = {2153},
   title = {Uncertainty calculation methodologies in microflow measurements: Comparison of GUM, GUM-S1 and Bayesian approach},
   journal = {Measurement},
   year = {2021},
   month = {8},
   volume = {181},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   pages = {109589},
   keywords = {Uncertainty evaluation; Accuracy; Microflow measurement; Syringe pump; Gravimetric method; Bayesian approach},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2021.109589},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sousa, J.A. and Batista, E. and Demeyer, S. and Fischer, N. and Pellegrino, O. and Ribeiro, A.S. and Martins, L.L.}
}

@Article { GallianaCR2021,
   subid = {2333},
   title = {Towards a traceable divider for composite voltage waveforms below 1 kV},
   journal = {Electrical Engineering},
   year = {2021},
   month = {8},
   number2 = {19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes},
   keywords = {Voltage divider · Composite and combined voltages · Traceability · Scale factor calibration · Step response ·Measurement uncertainty},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0948-7921, 1432-0487},
   DOI = {10.1007/s00202-021-01368-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Galliana, F. and Caria, S.E. and Roccato, P.E.}
}

@Article { BarrattRCSKE2021,
   subid = {2167},
   title = {Asymmetric arms maximize visibility in hot-electron interferometers},
   journal = {Physical Review B},
   year = {2021},
   month = {7},
   day = {30},
   volume = {104},
   number = {3},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {035436},
   keywords = {single electrons, electron interferometry, quantum transport, electron quantum optics},
   web_url = {https://arxiv.org/abs/2104.01653},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/PhysRevB.104.035436},
   stag_bib_extends_levelofaccess = {NA},
   author = {Barratt, C.J. and Ryu, S. and Clark, L.A. and Sim, H.-S. and Kataoka, M. and Emary, C.}
}

@Article { RadtkeCKLSDAHNVRQLDBUL2021,
   subid = {2285},
   title = {A unified pH scale for all solvents: part I – intention and reasoning (IUPAC Technical Report)},
   journal = {Pure and Applied Chemistry},
   year = {2021},
   month = {7},
   day = {30},
   volume = {93},
   number = {9},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   pages = {1049-1060},
   keywords = {Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Walter de Gruyter GmbH},
   language = {30},
   ISSN = {0033-4545, 1365-3075},
   DOI = {10.1515/pac-2019-0504},
   stag_bib_extends_levelofaccess = {NA},
   author = {Radtke, V. and Cam{\~o}es, F. and Krossing, I. and Leito, I. and Stoica, D. and Deleebeeck, L. and Anes, B. and Heering, A. and N{\"a}ykki, T. and Veltz{\'e}, S. and Rozikov{\'a}, M. and Quendera, R. and Liv, L. and D{\'a}niel, N. and Bastkowski, F. and Uysal, E. and Lawrence, N.}
}

@Article { MilanoLLBRV2021,
   subid = {2236},
   title = {Structure‐Dependent Influence of Moisture on Resistive Switching Behavior of ZnO Thin Films},
   journal = {Advanced Materials Interfaces},
   year = {2021},
   month = {7},
   day = {28},
   volume = {8},
   number = {16},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   pages = {2100915},
   keywords = {effect of moisture on electroforming, electrical conductivity, memristors, nanostructures, resistive switching},
   web_url = {https://onlinelibrary.wiley.com/doi/10.1002/admi.202100915},
   misc2 = {EMPIR 2020: Fundamental},
   publisher = {Wiley},
   language = {30},
   ISSN = {2196-7350, 2196-7350},
   DOI = {10.1002/admi.202100915},
   stag_bib_extends_levelofaccess = {NA},
   author = {Milano, G. and Luebben, M. and Laurenti, M. and Boarino, L. and Ricciardi, C. and Valov, I.}
}

@Article { RibeiroACSMLBSS2021,
   subid = {2198},
   title = {Role of measurement uncertainty in the comparison of average areal rainfall methods},
   journal = {Metrologia},
   year = {2021},
   month = {7},
   day = {23},
   volume = {58},
   number = {4},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   pages = {044001},
   keywords = {measurement uncertainty, rainfall, precipitation, estimating, arithmetic mean method, Thiessen polygon method, isohyetal method},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IOP Publishing},
   address = {Bristol, United Kingdom},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ac0d49},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ribeiro, A.S. and Almeida, M.C. and Cox, M.G. and Sousa, J.A. and Martins, L. and Loureiro, D. and Brito, R. and Silva, M. and Soares, A.C.}
}

@Article { TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021,
   subid = {2260},
   title = {A multicentre and multi-national evaluation of the accuracy of quantitative Lu-177 SPECT/CT imaging performed within the MRTDosimetry project},
   journal = {EJNMMI Physics},
   year = {2021},
   month = {7},
   day = {23},
   volume = {8},
   number = {1},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   keywords = {Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2197-7364},
   DOI = {10.1186/s40658-021-00397-0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tran-Gia, J. and Denis-Bacelar, A.M. and Ferreira, K.M. and Robinson, A.P. and Calvert, N. and Fenwick, A.J. and Finocchiaro, D. and Fioroni, F. and Grassi, E. and Heetun, W. and Jewitt, S.J. and Kotzassarlidou, M. and Ljungberg, M. and McGowan, D.R. and Scott, N. and Scuffham, J. and Gleisner, K.S. and Tipping, J. and Wevrett, J. and Bardi{\`e}s, M. and Berenato, S. and Bilas, I. and Bobin, C. and Capogni, M. and Chauvin, M. and COLLINS, S. and Cox, M. and Dabin, J. and D’Arienzo, M. and Gustafsson, J. and Hallam, A. and Kalathas, T. and Kayal, G. and Lorusso, G. and Maringer, F-J. and Morgan, D. and Smyth, V. and Solc, J. and Štemberkov{\'a}, L. and Struelens, L. and Vergara-Gil, A. and Wiedner, H. and Lassmann, M.}
}

@Techreport { KlingKRBRBS2021,
   subid = {2126},
   title = {Specifications and testing strategies for measurement devices for noise exposure determination in the infrasound frequency range},
   journal = {PTB Open Access Repository},
   year = {2021},
   month = {7},
   volume = {n. a.},
   number = {n. a.},
   number2 = {19ENV03: Infra-AUV: Metrology for low-frequency sound and vibration},
   pages = {20210609},
   keywords = {Sound level meters, Infrasound, Type approval, Noise exposure},
   web_url = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19ENV03.RE.20210609},
   misc2 = {EMPIR 2019: Environment},
   publisher = {PTB},
   language = {30},
   ISBN = {n. a.},
   ISSN = {n. a.},
   DOI = {10.7795/EMPIR.19ENV03.RE.20210609},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kling, C. and Koch, C. and Rust, M. and Barham, R. and Rodrigues, D. and Barrera  Figueroa, S. and Sandermann Olsen, E.}
}

@Article { GeorgievaLHKKRRK2021,
   subid = {2504},
   title = {Absolute calibration of a single-photon avalanche detector using a bright triggered single-photon source based on an InGaAs quantum dot},
   journal = {Optics Express},
   year = {2021},
   month = {7},
   volume = {29},
   number = {15},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {23500},
   keywords = {calibration, single-photon avalanche detector, triggered single-photon source, InGaAs quantum dot},
   web_url = {https://opg.optica.org/oe/fulltext.cfm?uri=oe-29-15-23500\&id=453180},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.430680},
   stag_bib_extends_levelofaccess = {NA},
   author = {Georgieva, H. and L{\'o}pez, M. and Hofer, H. and Kanold, N. and Kaganskiy, A. and Rodt, S. and Reitzenstein, S. and K{\"u}ck, S.}
}

@Article { VargasCMRPLNSL2021,
   subid = {2114},
   title = {Comparison of airborne radiation detectors carried by rotary-wing unmanned aerial systems},
   journal = {Radiation Measurements},
   year = {2021},
   month = {7},
   volume = {145},
   number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident},
   pages = {106595},
   keywords = {Airborne radiological detectorUnmanned aerial systemEnvironmental radioactivity mappingSource localization},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1350-4487},
   DOI = {10.1016/j.radmeas.2021.106595},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vargas, A. and Costa, D. and Macias, M. and Royo, P. and Pastor, E. and Luchkov, M. and Neumaier, S. and St{\"o}hlker, U. and Luff, R.}
}

@Article { KruskopfBPCPREPPGS2021,
   subid = {2113},
   title = {Graphene Quantum Hall Effect Devices for AC and DC Electrical Metrology},
   journal = {IEEE Transactions on Electron Devices},
   year = {2021},
   month = {7},
   volume = {68},
   number = {7},
   number2 = {18SIB07: GIQS: Graphene impedance quantum standard},
   pages = {3672-3677},
   keywords = {Alternating current, dissipation factor,double-shield, epitaxial graphene, magnetocapacitance,magnetotransport, precision measurements, quantized Hallresistance (QHR) standards, quantum Hall effect (QHE),superconducting contacts},
   web_url = {https://ieeexplore.ieee.org/document/9446081},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9383, 1557-9646},
   DOI = {10.1109/TED.2021.3082809},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kruskopf, M. and Bauer, S. and Pimsut, Y. and Chatterjee, A. and Patel, D.K. and Rigosi, A.F. and Elmquist, R.E. and Pierz, K. and Pesel, E. and G{\"o}tz, M. and Schurr, J.}
}

@Article { SaccoPGR2021,
   subid = {2618},
   title = {Graphene edge method for three‐dimensional probing of Raman microscopes focal volumes},
   journal = {Journal of Raman Spectroscopy},
   year = {2021},
   month = {6},
   day = {23},
   volume = {52},
   number = {10},
   number2 = {19NRM04: ISO-G-SCoPe: Standardisation of structural and chemical properties of graphene},
   pages = {1671-1684},
   keywords = {Raman spectroscopy, Metrology, graphene, graphene edge, confocal volume, focal volume, Raman quantification},
   web_url = {https://analyticalsciencejournals.onlinelibrary.wiley.com/doi/10.1002/jrs.6187},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   publisher = {Wiley},
   language = {30},
   ISSN = {0377-0486, 1097-4555},
   DOI = {10.1002/jrs.6187},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sacco, A. and Portesi, C. and Giovannozzi, A.M. and Rossi, A.M.}
}

@Article { PrzyklenkBOEYAFPZCMRB2021,
   subid = {2104},
   title = {New European Metrology Network for Advanced Manufacturing},
   journal = {Measurement Science and Technology},
   year = {2021},
   month = {6},
   day = {21},
   number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing},
   keywords = {Advance Manufacturing, Metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), Stakeholder},
   misc2 = {EMPIR 2019: Support for Networks},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ac0d25},
   stag_bib_extends_levelofaccess = {NA},
   author = {Przyklenk, A. and Balsamo, A. and O'Connor, D. and Evans, A. and Yandayan, T. and Akg{\"o}z, A. and Flys, O. and Phillips, D. and Zelen{\'y}, V. and Czułek, D. and Meli, F. and Ragusa, C. and Bosse, H.}
}

@Proceedings { ThompsonRSEHL2021,
   subid = {2410},
   title = {Calibration of X-ray computed tomography for surface topography measurement using metrological characteristics},
   journal = {Proceedings 21st euspen International Conference and Exhibition},
   year = {2021},
   month = {6},
   day = {10},
   number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry},
   keywords = {Metrology, surface topography, metrological characteristics, X-ray computed tomography},
   misc2 = {EMPIR 2017: Industry},
   event_place = {Online Conference},
   event_name = {21st euspen International Conference and Exhibition},
   event_date = {07-06-2021 to 10-06-2021},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE21165.pdf},
   author = {Thompson, A. and Rodr{\'i}guez-S{\'a}nchez, {\'A}. and Senin, N. and Eifler, M. and Hering, J. and Leach, R.}
}

@Article { euchaHSHOiL2021,
   subid = {1981},
   title = {Compact differential plane interferometer with in-axis mirror tilt detection},
   journal = {Optics and Lasers in Engineering},
   year = {2021},
   month = {6},
   volume = {141},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   pages = {106568},
   keywords = {Laser interferometryOptical metrologyDimensional measurementCommon path interferometerDifferential interferometerTilt compensationLarge volume metrology},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0143-8166},
   DOI = {10.1016/j.optlaseng.2021.106568},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rerucha, S. and Hola, M. and Sarbort, M. and Hrabina, J. and Oulehla, J. and Č{\'i}p, O. and Lazar, J.}
}

@Article { KhamlichiGOAR2021,
   subid = {2488},
   title = {Error in the measurement of partial discharge pulses according to the frequency response of HFCT sensors},
   journal = {2021 IEEE Electrical Insulation Conference (EIC)},
   year = {2021},
   month = {6},
   volume = {.},
   number = {.},
   number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission},
   pages = {.},
   keywords = {sensor phenomena and characterization, performance evaluation, partial discharges, insulation testing,condition monitoring},
   tags = {SEG},
   web_url = {https://zenodo.org/record/5906679},
   misc2 = {EMPIR 2019: Energy},
   publisher = {IEEE},
   language = {30},
   ISSN = {2576-6791},
   DOI = {10.1109/EIC49891.2021.9612353},
   stag_bib_extends_levelofaccess = {NA},
   author = {Khamlichi, A. and Garnacho, F. and Ortego, J. and Alvarez, F. and Rovira, J.}
}

@Article { DeleebeeckSNSRVHBLQCS2021,
   subid = {2183},
   title = {Unified pH Measurements of Ethanol, Methanol, and Acetonitrile, and Their Mixtures with Water},
   journal = {Sensors},
   year = {2021},
   month = {6},
   volume = {21},
   number = {11},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   pages = {3935},
   keywords = {pHabs; ionic liquid salt bridge; commercial glass electrodes; water–alcohol mixture;non-aqueous pH},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s21113935},
   stag_bib_extends_levelofaccess = {NA},
   author = {Deleebeeck, L. and Snedden, A. and Nagy, D. and Szil{\'a}gyi Nagyn{\'e}, Z. and Rozikov{\'a}, M. and Vičarov{\'a}, M. and Heering, A. and Bastkowski, F. and Leito, I. and Quendera, R. and Cabral, V. and Stoica, D.}
}

@Proceedings { PrzyklenkBOEYAFZCPMRB2021,
   subid = {2123},
   title = {AdvManuNet: Support for a European Metrology Network for Advanced Manufacturing},
   journal = {Proceedings 21st euspen International Conference and Exhibition},
   year = {2021},
   month = {6},
   volume = {2021},
   number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing},
   keywords = {advanced manufacturing, metrology, European metrology networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0},
   misc2 = {EMPIR 2019: Support for Networks},
   event_place = {Online Conference},
   event_name = {21st euspen International Conference and Exhibition},
   event_date = {07-06-2021 to 10-06-2021},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base//ICE21292.pdf},
   author = {Przyklenk, A. and Balsamo, A. and O’Connor, D. and Evans, A. and Yandayan, T. and Akg{\"o}z, S. and Flys, O. and Zelen{\'y}, V. and Czułek, D. and Phillips, D. and Meli, F. and Ragusa, C. and Bosse, H.}
}

@Article { PicolloBBSORR2021,
   subid = {2266},
   title = {Creation of pure non-crystalline diamond nanostructures via room-temperature ion irradiation and subsequent thermal annealing},
   journal = {Nanoscale Advances},
   year = {2021},
   month = {6},
   volume = {3},
   number = {14},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {4156-4165},
   keywords = {Diamond, Irradiation, Carbon, Imaging},
   web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2021/NA/D1NA00136A},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2516-0230},
   DOI = {10.1039/d1na00136a},
   stag_bib_extends_levelofaccess = {NA},
   author = {Picollo, F. and Battiato, A. and Bosia, F. and Scaffidi Muta, F. and Olivero, P. and Rigato, V. and Rubanov, S.}
}

@Article { PicolloBBSORR20210,
   subid = {2266},
   title = {Creation of pure non-crystalline diamond nanostructures via room-temperature ion irradiation and subsequent thermal annealing},
   journal = {Nanoscale Advances},
   year = {2021},
   month = {6},
   volume = {3},
   number = {14},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {4156-4165},
   keywords = {Diamond, Irradiation, Carbon, Imaging},
   web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2021/NA/D1NA00136A},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2516-0230},
   DOI = {10.1039/d1na00136a},
   stag_bib_extends_levelofaccess = {NA},
   author = {Picollo, F. and Battiato, A. and Bosia, F. and Scaffidi Muta, F. and Olivero, P. and Rigato, V. and Rubanov, S.}
}

@Article { RebufelloPASGDCVDG2021,
   subid = {2446},
   title = {Anomalous weak values via a single photon detection},
   journal = {Light: Science \& Applications},
   year = {2021},
   month = {5},
   day = {25},
   volume = {10},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {Quantum Measurement, Weak Values, Single Photons, Quantum Metrology},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2047-7538},
   DOI = {10.1038/s41377-021-00539-0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rebufello, E. and Piacentini, F. and Avella, A. and Souza, M.A. de and Gramegna, M. and Dziewior, J. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.}
}

@Article { LanzaMCCSDGNKRCMBP2021,
   subid = {2392},
   title = {Calibration of non-catching precipitation measurement instruments: A review},
   journal = {Meteorological Applications},
   year = {2021},
   month = {5},
   day = {25},
   volume = {28},
   number = {3},
   number2 = {18NRM03: INCIPIT: Calibration and accuracy of non-catching instruments to measure liquid/solid atmospheric precipitation},
   pages = {e2002},
   keywords = {calibration, hydro-meteorology, meteomet, non-catching gauges, precipitation, precipitation measurement and analysis, uncertainty analysis, verification},
   web_url = {https://onlinelibrary.wiley.com/doi/10.1002/met.2002},
   misc2 = {EMPIR 2018: Pre-Co-Normative},
   publisher = {RMets},
   language = {30},
   ISSN = {14698080},
   DOI = {10.1002/met.2002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lanza, L.G. and Merlone, A. and Cauteruccio, A. and Chinchella, E. and Stagnaro, M. and Dobre, M. and Garcia Izquierdo, M.C. and Nielsen, J. and Kjeldsen, H. and Roulet, Y.A. and Coppa, G. and Musacchio, C. and Bordianu, C. and Parrondo, M.}
}

@Article { RebufelloPALVTGBCVDG2021,
   subid = {2447},
   title = {Protective Measurement—A New Quantum Measurement Paradigm: Detailed Description of the First Realization},
   journal = {Applied Sciences},
   year = {2021},
   month = {5},
   volume = {11},
   number = {9},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {4260},
   keywords = {Quantum Measurement, Weak Measurement, Quantum Metrology, Single Photons},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2076-3417},
   DOI = {10.3390/app11094260},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rebufello, E. and Piacentini, F. and Avella, A. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.}
}

@Article { RousselCFD2021,
   subid = {2219},
   title = {Processing Quantum Signals Carried by Electrical Currents},
   journal = {PRX Quantum},
   year = {2021},
   month = {5},
   volume = {2},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {020314},
   keywords = {Edge states, Integer quantum Hall effect, Mesoscopics, Quantum information processing, Quantum transport, Quasiparticles \& collective excitations},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2691-3399},
   DOI = {10.1103/PRXQuantum.2.020314},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roussel, B. and Cabart, C. and F{\`e}ve, G. and Degiovanni, P.}
}

@Article { ManskePKRP2021,
   subid = {2044},
   title = {Monte-Carlo Analysis of Challenges and Limitations of Dispersion-based Optical Thermometry},
   journal = {SMSI 2021 - Sensors and Instrumentation},
   year = {2021},
   month = {5},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   pages = {203-204},
   keywords = {dispersive thermometry, measurement uncertainty modelling, multi-wavelength interferometry, Monte-Carlo Simulation},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {AMA Service GmbH, Von-M{\"u}nchhausen-Str. 49, 31515 Wunstorf, Germany},
   language = {30},
   DOI = {10.5162/SMSI2021/C4.4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Manske, E. and Prellinger, G. and K{\"o}chert, P. and Rose, A. and Pollinger, F.}
}

@Article { KazemipourHWHRSAGZ2021,
   subid = {2048},
   title = {Standard Load Method: A New Calibration Technique for Material Characterization at Terahertz Frequencies},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2021},
   month = {5},
   volume = {70},
   number = {N/A},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {1007310},
   keywords = {Material characterization, measurement uncertainty, parameter extraction, standard load, vector network analyzer (VNA) time gating},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2021.3077660},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Hudlicka, M. and R{\"u}fenacht, J. and Stalder, D. and Allal, D. and G{\"a}umann, G. and Zeier, M.}
}

@Techreport { CoxJR2021,
   subid = {2192},
   title = {Statistical analysis of temperature rise in passive medical implants in a magnetic resonance imaging environment},
   journal = {National Physical Laboratory},
   year = {2021},
   month = {4},
   day = {28},
   number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations},
   keywords = {implant safety, magnetic resonance imaging, MR safety},
   misc2 = {EMPIR 2017: Industry},
   publisher = {National Physical Laboratory},
   language = {30},
   DOI = {10.47120/npl.MS28},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cox, M. and Jagan, K. and Rajan, S.}
}

@Article { GeorgievaMRHGDGLK2021,
   subid = {2092},
   title = {Detection of ultra-weak laser pulses by free-running single-photon detectors: Modeling dead time and dark counts effects},
   journal = {Applied Physics Letters},
   year = {2021},
   month = {4},
   day = {26},
   volume = {118},
   number = {17},
   number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware},
   pages = {174002},
   keywords = {Quantum commutation, QKD, Non-Classical Light Emitters, Single-Photon Detectors, RadiometryMetrology for Quantum Technologies},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/5.0046014},
   stag_bib_extends_levelofaccess = {NA},
   author = {Georgieva, H. and Meda, A. and Raupach, S.M.F. and Hofer, H. and Gramegna, M. and Degiovanni, I.P. and Genovese, M. and L{\'o}pez, M. and K{\"u}ck, S.}
}

@Article { RussellS2021,
   subid = {2024},
   title = {mmSIM: An open toolbox for accessible structured illumination microscopy},
   journal = {Philosophical Transactions of the Royal Society A},
   year = {2021},
   month = {4},
   day = {26},
   number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants},
   keywords = {Structured illumination microscopy, SIM hardware control, image acquisition, Micro-Manager microscope control package},
   web_url = {https://www.biorxiv.org/content/10.1101/2021.01.18.427184v1},
   misc2 = {EMPIR 2018: Health},
   language = {30},
   DOI = {10.1101/2021.01.18.427184},
   stag_bib_extends_levelofaccess = {NA},
   author = {Russell, C.T. and Shaw, M.}
}

@Article { PeruzziRPEBu2021,
   subid = {2057},
   title = {Survey of subrange inconsistency of long-stem standard platinum resistance thermometers},
   journal = {Metrologia},
   year = {2021},
   month = {4},
   day = {14},
   volume = {58},
   number = {3},
   number2 = {18SIB02: Real-K: Realising the redefined kelvin},
   pages = {035009},
   keywords = {platinum resistance thermometers (SPRTs), statistical test, fixed-point uncertainty propagation (PoU)},
   web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/abe8c1/pdf},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol, United Kingdom},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/abe8c1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Peruzzi, A and Rusby, R L and Pearce, J V and Eusebio, L and Bojkovski, J and Žužek, V}
}

@Article { MoroshRNKiKPIMSBIKS2021,
   subid = {2017},
   title = {Investigation into the performance of dose rate measurement instruments used in non-governmental networks},
   journal = {Radiation Measurements},
   year = {2021},
   month = {4},
   number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident},
   pages = {106580},
   keywords = {Dosimetry networks.Dose rate meters.Environmental Radiation.Geiger counter.Metrological evaluation},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1350-4487},
   DOI = {10.1016/j.radmeas.2021.106580},
   stag_bib_extends_levelofaccess = {NA},
   author = {Morosh, V. and R{\"o}ttger, A. and Neumaier, S. and Krasniqi, F. and Živanović, M. and Kržanović, N. and Pantelić, G. and Iurlaro, G. and Mariotti, F. and Sperandio, L. and Bell, S. and Ioannidis, S. and Kelly, M. and Sangiorgi, M.}
}

@Article { GanikiRJKH2021,
   subid = {2034},
   title = {Validating an Evaporative Calibrator for Gaseous Oxidized Mercury},
   journal = {Sensors},
   year = {2021},
   month = {4},
   volume = {21},
   number = {7},
   number2 = {16ENV01: MercOx: Metrology for oxidised mercury},
   pages = {2501},
   keywords = {Gaseous oxidized mercury, calibration, traceability, 197-Hg},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s21072501},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gačnik, J. and Živković, I. and Ribeiro Guevara, S. and Jaćimović, R. and Kotnik, J. and Horvat, M.}
}

@Article { JoBAFSWTDRGKPR2021,
   subid = {2125},
   title = {Quantum Hall Valley Splitters and a Tunable Mach-Zehnder Interferometer in Graphene},
   journal = {Physical Review Letters},
   year = {2021},
   month = {4},
   volume = {126},
   number = {14},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {146803},
   keywords = {Graphene, electron interferometer, Mach-Zehnder, Quantum Hall Valley Beam Splitter},
   web_url = {https://arxiv.org/abs/2011.04958},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.126.146803},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jo, M. and Brasseur, P. and Assouline, A. and Fleury, G. and Sim, H-S. and Watanabe, K. and Taniguchi, T. and Dumnernpanich, W. and Roche, P. and Glattli, D.C. and Kumada, N. and Parmentier, F.D. and Roulleau, P.}
}

@Article { RobertsonSPJ2021,
   subid = {2728},
   title = {ARC 3.0: An expanded Python toolbox for atomic physics calculations},
   journal = {Computer Physics Communications},
   year = {2021},
   month = {4},
   volume = {261},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   pages = {107814},
   keywords = {Alkaline earth atomsDivalent atomsAlkali atomsRydberg statesAtom–surface van der Waals interactionQuantum technologiesNeutral-atom quantum computingAtom-based sensors},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0010-4655},
   DOI = {10.1016/j.cpc.2020.107814},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robertson, E.J. and Šibalić, N. and Potvliege, R.M. and Jones, M.P.A. }
}

@Article { LoslerEKR2021,
   subid = {2007},
   title = {ILRS Reference Point Determination Using Close Range Photogrammetry},
   journal = {Applied Sciences},
   year = {2021},
   month = {3},
   day = {20},
   volume = {11},
   number = {6},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   pages = {2785},
   keywords = {close range photogrammetry, bundle adjustment, reference point determination, unscentedtransformation, stochastic model, satellite laser ranging, GeoMetre},
   web_url = {https://www.mdpi.com/2076-3417/11/6/2785},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2076-3417},
   DOI = {10.3390/app11062785},
   stag_bib_extends_levelofaccess = {NA},
   author = {L{\"o}sler, M. and Eschelbach, C. and Kl{\"u}gel, T. and Riepl, S.}
}

@Article { SchmidtGNBvZMBSHWR2021,
   subid = {2616},
   title = {Bimodal behavior of microlasers investigated with a two-channel photon-number-resolving transition-edge sensor system},
   journal = {Physical Review Research},
   year = {2021},
   month = {3},
   day = {19},
   volume = {3},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {013263},
   keywords = {microlaser, transition-edge sensor, photon statistics, photon counting, nanophotonics},
   web_url = {https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.3.013263},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2643-1564},
   DOI = {10.1103/PhysRevResearch.3.013263},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmidt, M. and Grothe, I.H. and Neumeier, S. and Bremer, L. and von Helversen, M. and Zent, W. and Melcher, B. and Beyer, J. and Schneider, C. and H{\"o}fling, S. and Wiersig, J. and Reitzenstein, S.}
}

@Article { WuRSM2021,
   subid = {1999},
   title = {Assessing the Impact of Data Filtering Techniques on Material Characterization at Millimeter-Wave Frequencies},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2021},
   month = {3},
   day = {18},
   volume = {70},
   number = {N/A},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {6005904},
   keywords = {Data filtering, dielectric constant, loss tangent, millimeter-wave measurements, time-domain gating, vector network analyzer (VNA)},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IEEE},
   language = {30},
   ISSN = {1557-9662},
   DOI = {10.1109/TIM.2021.3067224},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wu, W. and Ridler, N. and Shang, X. and Ma, D.}
}

@Article { CliffordMFHHKPRSP2021,
   subid = {2013},
   title = {The importance of international standards for the graphene community},
   journal = {Nature Reviews Physics},
   year = {2021},
   month = {3},
   day = {15},
   volume = {3},
   number = {4},
   number2 = {19NRM04: ISO-G-SCoPe: Standardisation of structural and chemical properties of graphene},
   pages = {233-235},
   keywords = {graphene, standards, ISO, IEC, 2D materials, standardisation},
   web_url = {https://www.nature.com/articles/s42254-021-00278-6.epdf?sharing_token=_RIs5V6Xm7w_YnHU36ykhtRgN0jAjWel9jnR3ZoTv0NPpzni0dDHfaSDxkLVCOVw58FsyO6wELZUo5O32Eh0l-PBSDtirSTDnDrgEzBq40IQw69h7pcwLtLVCw2MuYIUVmHN0-WNNYkKy_jgkRmTZPKe2I2wUTrJd-QYBiq-ZrQ\%3D},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2522-5820},
   DOI = {dx.doi.org/10.1038/s42254-021-00278-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clifford, C.A. and Martins Ferreira, E.H. and Fujimoto, T. and Herrmann, J. and Hight Walker, A.R. and Koltsov, D. and Punckt, C. and Ren, L. and Smallwood, G.J. and Pollard, A.J.}
}

@Article { Rovira2021,
   subid = {1978},
   title = {Calibration set-up for energy measuring systems installed in AC railway systems},
   journal = {IEEE Vehicle Power and Propulsion Conference},
   year = {2021},
   month = {3},
   day = {12},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   keywords = {Energy measurement, calibration set-up, on-board calibration, railway system, energy measuring system, phantom source, harmonic wave-shape, distorted regime},
   misc2 = {EMPIR 2016: Energy},
   language = {30},
   DOI = {10.5281/zenodo.4588726},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rovira, J.}
}

@Article { Rovira2021_2,
   subid = {1977},
   title = {Reference Energy Measuring System for On-Board Calibration of EMS Installed in Locomotives},
   journal = {International Conference on Sensors Engineering and Electronics Instrumentation Advances},
   year = {2021},
   month = {3},
   day = {12},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   keywords = {Energy measurement, energy measuring system, calibration set-up, on-board calibration, railway system, harmonic, distorted regime.},
   misc2 = {EMPIR 2016: Energy},
   language = {30},
   DOI = {10.5281/zenodo.4588736},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rovira, J.}
}

@Article { RodtR2021,
   subid = {2615},
   title = {High-performance deterministic in situ electron-beam lithography enabled by cathodoluminescence spectroscopy},
   journal = {Nano Express},
   year = {2021},
   month = {3},
   volume = {2},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {014007},
   keywords = {in situ EBL, deterministic processing, cathodoluminescence spectroscopy, quantum dots, nanophotonics},
   web_url = {https://iopscience.iop.org/article/10.1088/2632-959X/abed3c},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2632-959X},
   DOI = {10.1088/2632-959X/abed3c},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rodt, S. and Reitzenstein, S.}
}

@Article { FailleauFBRHH2021,
   subid = {1993},
   title = {Metal-carbon eutectic high temperature fixed points for in-situ calibration of radiation thermometers},
   journal = {High Temperatures-High Pressures},
   year = {2021},
   month = {3},
   volume = {50},
   number = {2},
   number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties},
   pages = {149-165},
   keywords = {Thermal Diffusivity, High Temperature, Radiation Thermometry, Fixed-Point},
   web_url = {https://www.oldcitypublishing.com/journals/hthp-home/hthp-issue-contents/hthp-volume-50-number-2-2021/19302-2/},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Old City Publishing},
   language = {30},
   ISSN = {1472-3441},
   DOI = {10.32908/hthp.v50.1013},
   stag_bib_extends_levelofaccess = {NA},
   author = {Failleau, G. and Fleurence, N. and Beaumont, O. and Razouk, R. and Hameury, J. and Hay, B.}
}

@Article { RuhleKH2021,
   subid = {2046},
   title = {Workflow towards automated segmentation of agglomerated, non-spherical particles from electron microscopy images using artificial neural networks},
   journal = {Scientific Reports},
   year = {2021},
   month = {3},
   volume = {11},
   number = {1},
   number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements},
   pages = {10},
   keywords = {Artificial intelligence;Automated image analysis;Electron microscopy;Image segmentation;Neural networks},
   web_url = {https://www.nature.com/articles/s41598-021-84287-6.pdf},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-021-84287-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"u}hle, B. and Krumrey, J.F. and Hodoroaba, V-D.}
}

@Article { RipaIGSGFBLDG2021,
   subid = {2645},
   title = {Refractive index gas thermometry between 13.8 K and 161.4 K},
   journal = {Metrologia},
   year = {2021},
   month = {3},
   volume = {58},
   number = {2},
   number2 = {18SIB02: Real-K: Realising the redefined kelvin},
   pages = {025008},
   keywords = {refractive index gas thermometry, thermodynamic temperature, ITS-90,microwave resonator},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/abe249},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ripa, D.M. and Imbraguglio, D. and Gaiser, C. and Steur, P.P.M. and Giraudi, D. and Fogliati, M. and Bertinetti, M. and Lopardo, G. and Dematteis, R. and Gavioso, R.M.}
}

@Article { PanSPRDRGP2021,
   subid = {2056},
   title = {Direct comparison of ITS-90 and PLTS-2000 from 0.65 K to 1 K at LNE-CNAM},
   journal = {Metrologia},
   year = {2021},
   month = {2},
   day = {19},
   volume = {58},
   number = {2},
   number2 = {18SIB02: Real-K: Realising the redefined kelvin},
   pages = {025005},
   keywords = {temperature range between 0.65 K and 1 K, uncertainty component, resistance thermometer},
   web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/abd845/pdf},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/abd845},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pan, C. and Sparasci, F. and Plimmer, M. and Risegari, L. and Daugas, J-M. and Rouille, G. and Gao, B. and Pitre, L.}
}

@Article { FernandezScarioniBCSHALRCKS2021,
   subid = {2055},
   title = {Thermoelectric Signature of Individual Skyrmions},
   journal = {Physical Review Letters},
   year = {2021},
   month = {2},
   day = {16},
   volume = {126},
   number = {7},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {1-6/077202},
   keywords = {Magnetism, Nernst effect, Skyrmions, Thermomagnetic effects},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.126.077202},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fern{\'a}ndez Scarioni, A. and Barton, C. and Corte-Le{\'o}n, H. and Sievers, S. and Hu, X. and Ajejas, F. and Legrand, W. and Reyren, N. and Cros, V. and Kazakova, O. and Schumacher, H.W.}
}

@Article { BuonincontriKKMGCDCCMFMGSRZ2021,
   subid = {1697},
   title = {Three dimensional MRF obtains highly repeatable and reproducible multi-parametric estimations in the healthy human brain at 1.5T and 3T},
   journal = {NeuroImage},
   year = {2021},
   month = {2},
   volume = {226},
   number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers},
   pages = {117573},
   keywords = {MRI, Quantitation, Relaxometry, Brain, MR fingerprinting, Three dimensional, 3D},
   web_url = {https://www.sciencedirect.com/science/article/pii/S1053811920310582?via\%3Dihub},
   misc2 = {EMPIR 2018: Health},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1053-8119},
   DOI = {10.1016/j.neuroimage.2020.117573},
   stag_bib_extends_levelofaccess = {NA},
   author = {Buonincontri, G. and Kurzawski, J.W. and Kaggie, J.D. and Matys, T. and Gallagher, F.A. and Cencini, M. and Donatelli, G. and Cecchi, P. and Cosottini, M. and Martini, N. and Frijia, F. and Montanaro, D. and G{\'o}mez, P.A. and Schulte, R.F. and Retico, A. and Zilberti, L.}
}

@Article { LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021,
   subid = {2093},
   title = {Roadmap on quantum nanotechnologies},
   journal = {Nanotechnology},
   year = {2021},
   month = {2},
   volume = {32},
   number = {16},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {162003},
   keywords = {Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-4484, 1361-6528},
   DOI = {10.1088/1361-6528/abb333},
   stag_bib_extends_levelofaccess = {NA},
   author = {Laucht, A. and Hohls, F. and Ubbelohde, N. and Fernando Gonzalez-Zalba, M. and Reilly, D.J. and Stobbe, S. and Schr{\"o}der, T. and Scarlino, P. and Koski, J.V. and Dzurak, A. and Yang, C-H. and Yoneda, J. and Kuemmeth, F. and Bluhm, H. and Pla, J. and Hill, C. and Salfi, J. and Oiwa, A. and Muhonen, J.T. and Verhagen, E. and LaHaye, M.D. and Kim, H.H. and Tsen, A.W. and Culcer, D. and Geresdi, A. and Mol, J.A. and Mohan, V. and Jain, P.K. and Baugh, J.}
}

@Article { GutierrezRivasTRD2021,
   subid = {2061},
   title = {Enhancing White Rabbit Synchronization Stability and Scalability using P2P Transparent and Hybrid Clocks},
   journal = {IEEE Transactions on Industrial Informatics},
   year = {2021},
   month = {1},
   day = {25},
   number2 = {17IND14: WRITE: Precision Time for Industry},
   pages = {1-1},
   keywords = {White RabbitPTPSyncEScalabilityStabilityAcceleratorsTelecom5G},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {1551-3203, 1941-0050},
   DOI = {10.1109/TII.2021.3054365},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gutierrez-Rivas, J.L. and Torres-Gonzalez, F. and Ros, E. and Diaz, J.}
}

@Manual { ShangRDG2021,
   subid = {2128},
   title = {Introductory guide to making Planar S-parameter measurements at millimetre-wave frequencies},
   year = {2021},
   month = {1},
   day = {13},
   number2 = {19SIP02: PlanarMeT: Knowledge transfer of planar calibration and measurement techniques at millimetre-wave frequencies},
   keywords = {Calibration, on-wafer measurement, planar measurement, S-parameters, millimetre-wave, probes, traceability, vector network analyzer (VNA)},
   misc2 = {EMPIR 2019: Support for Impact},
   publisher = {National Physical Laboratory},
   language = {30},
   DOI = {10.47120/npl.9001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Shang, X. and Ridler, N.M. and Ding, J. and Geen, M.}
}

@Article { PreetzmannEVLR2021,
   subid = {2667},
   title = {Laboratory‐scale liquefiers for natural gas: A design and assessment study},
   journal = {AIChE Journal},
   year = {2021},
   month = {1},
   day = {11},
   volume = {67},
   number = {4},
   number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel},
   pages = {1-12},
   keywords = {composition analysis, liquefaction, liquefied natural gas, optical spectroscopy, vapor–liquid-equilibrium},
   web_url = {https://aiche.onlinelibrary.wiley.com/doi/epdf/10.1002/aic.17128},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Wiley},
   language = {30},
   ISSN = {0001-1541, 1547-5905},
   DOI = {10.1002/aic.17128},
   stag_bib_extends_levelofaccess = {NA},
   author = {Preetzmann, N. and Eckmann, P. and Veen, A.M.H. and Li, J. and Richter, M.}
}

@Article { KrasniqiKLETRT2021,
   subid = {1827},
   title = {Standoff UV-C imaging of alpha particle emitters},
   journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment},
   year = {2021},
   month = {1},
   volume = {987},
   number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities},
   pages = {164821},
   keywords = {Optical remote detection, alpha radiation},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0168-9002},
   DOI = {10.1016/j.nima.2020.164821},
   stag_bib_extends_levelofaccess = {NA},
   author = {Krasniqi, F.S. and Kerst, T. and Leino, M. and Eisheh, J-T. and Toivonen, H. and R{\"o}ttger, A. and Toivonen, J.}
}

@Proceedings { RitzmannWMKDF2021,
   subid = {1861},
   title = {Measurement of 2-150 kHz Conducted Emissions in Power Networks},
   journal = {Proceedings of CPEM 2020},
   year = {2021},
   month = {1},
   number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods},
   keywords = {Electromagnetic compatibility,measurement standards,measurement techniques,power quality,power system measurements,supraharmonics},
   tags = {SEG},
   misc2 = {EMPIR 2018: Pre-Co-Normative},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   event_place = {Bolder},
   event_name = {Conference of Precession Electromagnetic MeasurementsPEM},
   event_date = {01-08-2020 to 07-08-2020},
   language = {30},
   DOI = {10.36227/techrxiv.13536830.v1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ritzmann, D. and Wright, P. and Meyer, J. and Khokhlov, V. and De La Vega, D. and Fernandez, I.}
}

@Article { JenningerABBDGISJKRSSSTTW2021,
   subid = {1775},
   title = {Development of a design for an ionisation vacuum gauge suitable as a reference standard},
   journal = {Vacuum},
   year = {2021},
   month = {1},
   volume = {183},
   number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge},
   pages = {109884},
   keywords = {Ionisation gauge, Hot cathode, Sensitivity, Simulation, Reference standard},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0042-207X},
   DOI = {10.1016/j.vacuum.2020.109884},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jenninger, B. and Anderson, J. and Bernien, M. and Bundaleski, N. and Dimitrova, H. and Granovskij, M. and Illgen, C. and Šetina, J. and Jousten, K. and Kucharski, P. and Reinhardt, C. and Scuderi, F. and Silva, R.A.S. and St{\"o}ltzel, A. and Teodoro, O.M.N.D. and Trzpil-Jurgielewicz, B. and W{\"u}est, M.}
}

@Article { BagherRENWMZDHBL2021,
   subid = {1796},
   title = {Crosstalk between Mast Cells and Lung Fibroblasts Is Modified by Alveolar Extracellular Matrix and Influences Epithelial Migration},
   journal = {International Journal of Molecular Sciences},
   year = {2021},
   month = {1},
   volume = {22},
   number = {2},
   number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants},
   pages = {506},
   keywords = {lung fibroblasts, mast cells, epithelial cells, extracellular matrix, IL-6; tryptase, vascular endothelial growth factor, hepatocyte growth factor, idiopathic pulmonary fibrosis},
   misc2 = {EMPIR 2018: Health},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1422-0067},
   DOI = {10.3390/ijms22020506},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bagher, M. and Rosmark, O. and Elowsson Rendin, L. and Nybom, A. and Wasserstrom, S. and M{\"u}ller, C. and Zhou, X-H. and Dellgren, G. and Hallgren, O. and Bjermer, L. and Larsson-Callerfelt, A-K.}
}

@Article { LangeHRSSLTWP2021,
   subid = {1854},
   title = {Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons},
   journal = {Physical Review Letters},
   year = {2021},
   month = {1},
   volume = {126},
   number = {1},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   pages = {011102},
   keywords = {Optical clocks, Tests of fundamental principles, Time \& frequency standards, Quantum metrology},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.126.011102},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lange, R. and Huntemann, N. and Rahm, J.M. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Weyers, S. and Peik, E.}
}

@Article { LangeHRSSLTWP20210,
   subid = {1854},
   title = {Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons},
   journal = {Physical Review Letters},
   year = {2021},
   month = {1},
   volume = {126},
   number = {1},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   pages = {011102},
   keywords = {Optical clocks, Tests of fundamental principles, Time \& frequency standards, Quantum metrology},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.126.011102},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lange, R. and Huntemann, N. and Rahm, J.M. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Weyers, S. and Peik, E.}
}

@Inbook { BELLGAABSIDPSVRIWPNKSD2021,
   subid = {2552},
   title = {A NEW EUROPEAN RADIATION PROTECTION NETWORK DEVELOPED BY THE SUPPORT BSS JOINT NETWORK PROJECT},
   year = {2021},
   month = {1},
   number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation},
   keywords = {radiation protection, metrology, national regulation, European regulation, supportBSS, ENM for Radiation Protection},
   web_url = {https://vinar.vin.bg.ac.rs/bitstream/handle/123456789/10125/309-314.pdf},
   misc2 = {EMPIR 2019: Support for Networks},
   booktitle = {RADIATION PROTECTION SOCIETY OF SERBIA AND MONTENEGRO, PROCEEDINGS, XXXI SYMPOSIUM RPSSM, 2021},
   language = {30},
   ISBN = {78-86-7306-161-0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bell, S. and Glavič-Cindro, D. and ALVES, J. and Adam-Guillermin, C. and Bernat, R. and Sabeta, A. and Ioan, M-R. and DERLACINSKI,  M. and Pinto, M. and Sochor, V. and Veres, A. and R{\"O}TTGER, .A. and Živanović, M. and Wens, B. and Persson, L. and Nylund, R. and Kržanović, N. and STANKOVIĆ, S. and DIMOVIĆ, S.}
}

@Article { YeZR2021,
   subid = {2533},
   title = {Verification of a Capacitive Voltage Divider With 6-\(\mu\)rad Uncertainty Up To 100 kV},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2021},
   volume = {70},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   pages = {1-9},
   keywords = {Uncertainty, Voltage measurement, Calibration, Capacitors, Current measurement, Power transformers,Loss measurement},
   tags = {SEG},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2021.3056647},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ye, G. and Zhao, W. and Rietveld, G.}
}

@Article { OrtolanoMDMRKKMCCKP2021,
   subid = {2054},
   title = {A Comprehensive Analysis of Error Sources in Electronic Fully Digital Impedance Bridges},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2021},
   volume = {70},
   number2 = {17RPT04: VersICaL: A versatile electrical impedance calibration laboratory based on digital impedance bridges},
   pages = {1-14},
   keywords = {Impedance measurement, bridge circuits, measurement errors, measurement uncertainty, calibration},
   misc2 = {EMPIR 2017: Research Potential},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2020.3034115},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ortolano, M. and Marzano, M. and D'Elia, V. and Mai Tran, N.T. and Rybski, R. and Kaczmarek, J. and Koziol, M. and Musiol, K. and Christensen, A.E. and Callegaro, L. and Kucera, J. and Power, O.}
}

@Article { GeislerNSTR2021,
   subid = {2177},
   title = {Analyzing the surface of functional nanomaterials – how to quantify the total and derivatizable number of functional groups and ligands},
   journal = {Microchimica Acta},
   year = {2021},
   volume = {188},
   number = {10},
   number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses},
   pages = {321},
   keywords = {Functional group quantification, Surface ligand, Nanomaterial, Nanoparticle, Bead, Dye-based assay, Opticaldetection, Electrochemical titration, Instrumental analysis, Nanosafety, Safe-by-design},
   misc2 = {EMPIR 2018: Health},
   publisher = {Springer Nature},
   language = {30},
   DOI = {10.1007/s00604-021-04960-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gei{\ss}ler, D. and Nirmalananthan-Budau, N. and Scholtz, L. and Tavernaro, I. and Resch-Genger, U.}
}

@Article { GeislerNSTR20210,
   subid = {2177},
   title = {Analyzing the surface of functional nanomaterials – how to quantify the total and derivatizable number of functional groups and ligands},
   journal = {Microchimica Acta},
   year = {2021},
   volume = {188},
   number = {10},
   number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants},
   pages = {321},
   keywords = {Functional group quantification, Surface ligand, Nanomaterial, Nanoparticle, Bead, Dye-based assay, Opticaldetection, Electrochemical titration, Instrumental analysis, Nanosafety, Safe-by-design},
   misc2 = {EMPIR 2018: Health},
   publisher = {Springer Nature},
   language = {30},
   DOI = {10.1007/s00604-021-04960-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gei{\ss}ler, D. and Nirmalananthan-Budau, N. and Scholtz, L. and Tavernaro, I. and Resch-Genger, U.}
}

@Article { MertesRR2021,
   subid = {2225},
   title = {D3.3 Approximate Sequential Bayesian Filtering to Estimate Rn-222 Emanation from Ra-226 Sources from Spectra},
   journal = {SMSI 2021 - Measurement Science},
   year = {2021},
   number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level},
   keywords = {State-Space model, switched linear dynamical system, Rn-222, integrating measurements},
   misc2 = {EMPIR 2019: Environment},
   publisher = {AMA Service GmbH, Von-M{\"u}nchhausen-Str. 49, 31515 Wunstorf, Germany},
   language = {30},
   DOI = {10.5162/SMSI2021/D3.3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mertes, F. and R{\"o}ttger, S. and R{\"o}ttger, A.}
}

@Proceedings { KhanbabaeeRBRFHZTLdBGGCA2021,
   subid = {2377},
   title = {SUPPORT FOR A EUROPEAN METROLOGY NETWORK ON RELIABLE RADIATION PROTECTION: GAPS IN RADIATION PROTECTION AND RELATED METROLOGY},
   journal = {RAD Conference Proceedings},
   year = {2021},
   number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation},
   keywords = {Activity standards, new operational quantities in radiation protection, type testing, calibration, radon,reference field, pulsed radiation, dosimetry, standards, radiological emergency response},
   misc2 = {EMPIR 2019: Support for Networks},
   publisher = {RAD Centre},
   event_place = {Herceg Novi, Montenegro},
   event_name = {9th international conference on Radiation in various fields of research},
   event_date = {14-06-2021 to 18-06-2021},
   language = {30},
   DOI = {10.21175/RadProc.2021.04},
   stag_bib_extends_levelofaccess = {NA},
   author = {Khanbabaee, B. and R{\"o}ttger, A. and Behrens, R. and R{\"o}ttger, S. and Feige, S. and Hupe, O. and Zutz, H. and Toroi, P. and Leonard, P. and de la Fuente Rosales, L. and Burgess, P. and Gressier, V. and Guti{\'e}rrez Villanueva, J–L. and Cruz Su{\'a}rez, R. and Arnold, D.}
}

@Proceedings { FordRA2021,
   subid = {2705},
   title = {A Study of the stability exhibited by hydrophones when exposed to variations in temperature and hydrostatic pressure},
   journal = {6th Underwater Acoustics Conference and Exhibition},
   year = {2021},
   volume = {Volume 44},
   number = {1},
   number2 = {19ENV03: Infra-AUV: Metrology for low-frequency sound and vibration},
   pages = {070024},
   keywords = {stability exhibited by hydrophones, variations in temperature, hydrostatic pressure},
   web_url = {https://asa.scitation.org/doi/abs/10.1121/2.0001491},
   misc2 = {EMPIR 2019: Environment},
   publisher = {ASA},
   event_place = {Teddington, Surrey},
   event_name = {Meetings on Acoustics},
   event_date = {03-09-2021 to 04-09-2021},
   language = {30},
   ISSN = {1939-800X},
   DOI = {10.1121/2.0001491},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ford, B. and Robinson, S. and Ablitt, J.}
}

@Article { RehbehnRBBSKMGMSC2021,
   subid = {2408},
   title = {Sensitivity to new physics of isotope-shift studies using the coronal lines of highly charged calcium ions},
   journal = {Physical Review A},
   year = {2021},
   volume = {103},
   number = {4},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   pages = {L040801},
   keywords = {research areas, dark matter, electronic transitions, particle interactions, techniques, spectroscopy, nuclear physics, atomic, molecular and optical},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society},
   language = {30},
   ISSN = {ISSN 2469-9934 (online), 2469-},
   DOI = {10.1103/PhysRevA.103.L040801},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rehbehn, N-H. and Rosner, M.K. and Bekker, H. and Berengut, J.C. and Schmidt, P.O. and King, S.A. and Micke, P. and Gu,  M.F. and M{\"u}ller, R. and Surzhykov, A. and Crespo L{\'o}pez-Urrutia, J.R.}
}

@Article { LovenDBKTRWI2021,
   subid = {1897},
   title = {Toxicological effects of zinc oxide nanoparticle exposure: an in vitro comparison between dry aerosol air-liquid interface and submerged exposure systems},
   journal = {Nanotoxicology},
   year = {2021},
   number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants},
   keywords = {Air-liquid interface; NACIVT, aerosol, cell response, toxicity},
   web_url = {https://www.tandfonline.com/doi/full/10.1080/17435390.2021.1884301},
   misc2 = {EMPIR 2018: Health},
   language = {30},
   DOI = {10.1080/17435390.2021.1884301},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lov{\'e}n , K.  and Dobric, J. and B{\"o}l{\"u}kbas,  D.A.  and K{\aa}redal, M. and Tas, S. and Rissler, J. and Wagner, D.E.  and Isaxon, C. }
}

@Article { FergusonFLBHPR2021,
   subid = {2378},
   title = {Metrology and Standardization of High Speed Pluggable Optical Interconnects},
   journal = {Proceedings of the 9th International Conference on Photonics, Optics and Laser Technology},
   year = {2021},
   volume = {PHOTOPTICS},
   number = {PHOTOPTICS},
   number2 = {19SIP05: TTPWC: Technology Transfer of Photonic Waveguide Characterisation},
   pages = {63-67},
   keywords = {Electro Optical Circuit Board (EOCB), Polymer Waveguides, Attenuation, Encircled Flux, BER.},
   web_url = {https://zenodo.org/record/5777190},
   misc2 = {EMPIR 2019: Support for Impact},
   publisher = {SCITEPRESS - Science and Technology Publications},
   language = {30},
   ISSN = {2184-4364},
   DOI = {10.5220/0010171900630067},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ferguson, R. and Fatadin, I. and Liu, K-M. and Barbeito, I. and Hart, C. and Pitwon, R. and Robinson, D.}
}

@Article { StarkWBCDKRGNOSSLSKLMSPC2021,
   subid = {2407},
   title = {An ultralow-noise superconducting radio-frequency ion trap for frequency metrology with highly charged ions},
   journal = {AIP Review of Scientific Instruments},
   year = {2021},
   volume = {92},
   number = {8},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   pages = {083203},
   keywords = {Radio frequency cavities, radio-frequency quadrupole},
   misc2 = {EMPIR 2017: Fundamental},
   language = {30},
   DOI = {10.1063/5.0046569},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stark, J. and Warnecke, C. and Bogen, S. and Chen, S. and Dijck, E.A. and K{\"u}hn, S. and Rosner, M. K. and Graf, A. and Nauta, J. and Oelmann, J-H. and Schm{\"o}ger, L. and Schwarz, M. and Liebert, D. and Spie{\ss}, L.J. and King, S.A. and Leopold, T. and Micke, P. and Schmidt, P.O. and Pfeifer, T. and Crespo L{\'o}pez-Urrutia, J.R.}
}

@Proceedings { ClivatiRRTBCL2021,
   subid = {2740},
   title = {INRIM Sr Optical Clock: An Optically Loaded Apparatus for High-Stability Metrology},
   journal = {Proceedings EFTF 2021},
   year = {2021},
   volume = {1},
   number = {1},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   keywords = {OLC, Sr, 2D-MOT},
   misc2 = {EMPIR 2017: Fundamental},
   event_place = {on line},
   event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)},
   event_date = {07-07-2022 to 16-07-2022},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip},
   author = {Clivati, C. and Risaro, M. and Rullo, F. and Tarallo, M.G. and Barbiero, M. and Calonico, D. and Levi, F.}
}

@Proceedings { ClivatiRRTBCL2021_2,
   subid = {2740},
   title = {INRIM Sr Optical Clock: An Optically Loaded Apparatus for High-Stability Metrology},
   journal = {Proceedings EFTF 2021},
   year = {2021},
   volume = {1},
   number = {1},
   number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems},
   keywords = {OLC, Sr, 2D-MOT},
   misc2 = {EMPIR 2017: Fundamental},
   event_place = {on line},
   event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)},
   event_date = {07-07-2022 to 16-07-2022},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip},
   author = {Clivati, C. and Risaro, M. and Rullo, F. and Tarallo, M.G. and Barbiero, M. and Calonico, D. and Levi, F.}
}

@Article { ZakrissonSFSMPKARA2020,
   subid = {1787},
   title = {Simulation of pressure-induced cavity deformation – the 18SIB04 Quantumpascal EMPIR project},
   journal = {ACTA IMEKO},
   year = {2020},
   month = {12},
   day = {31},
   volume = {9},
   number = {5},
   number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal},
   pages = {281-286},
   keywords = {EMPIR; QuantumPascal; FEM; Pressure; Refractometry; Deformation.},
   web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-58},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IMEKO International Measurement Confederation},
   language = {30},
   ISSN = {2221-870X},
   DOI = {10.21014/acta_imeko.v9i5.985},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zakrisson, J. and Silander, I. and Forss{\'e}n, C. and Silvestri, Z. and Mari, D. and Pasqualin, S. and Kussicke, A. and Asbahr, P. and Rubin, T. and Axner, O.}
}

@Proceedings { FurtadoPQSLMAARLBCLA2020,
   subid = {1898},
   title = {First density comparison on viscoelastic samples by oscillation-type densimetry},
   journal = {ACTA IMEKO},
   year = {2020},
   month = {12},
   day = {31},
   volume = {9},
   number = {5},
   number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements},
   pages = {79},
   keywords = {EMPIR rhoLiq Project; oscillation-type density meter; viscoelasticity; comparison},
   misc2 = {EMPIR 2017: Research Potential},
   publisher = {IMEKO International Measurement Confederation},
   event_place = {-},
   event_name = {IMEKO TC3, TC5, TC16 and TC2},
   event_date = {16-11-2020 to 18-11-2020},
   language = {30},
   ISSN = {2221-870X},
   DOI = {10.21014/acta_imeko.v9i5.943},
   stag_bib_extends_levelofaccess = {NA},
   author = {Furtado, A. and Pereira, J. and Quendera, R. and Schiebl, M. and Lenard, E. and Malejczyk, E. and Alic, A. and Alisic, S. and Rauch, J. and Lorenz, F. and Bescupschii, A. and Ciubara, A. and Laky, B. and Ams{\"u}ss, R.}
}

@Article { VisserRSDMW2020,
   subid = {2009},
   title = {A single-beam photothermal interferometer for in situ measurements of aerosol light absorption},
   journal = {Atmospheric Measurement Techniques},
   year = {2020},
   month = {12},
   day = {23},
   volume = {13},
   number = {12},
   number2 = {16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols},
   pages = {7097-7111},
   keywords = {single-beam photothermal interferometer; measurement; aerosol light absorption; standard dual-beam photothermal interferometers; light-absorbing gases; NO2; black carbon; concentration; detection limits},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-13-7097-2020},
   stag_bib_extends_levelofaccess = {NA},
   author = {Visser, B. and R{\"o}hrbein, J. and Steigmeier, P. and Drinovec, L. and Močnik, G. and Weingartner, E.}
}

@Article { RidlerSSSSW2020,
   subid = {1833},
   title = {Establishing waveguide lines as primary standards for scattering parameter measurements at submillimetre wavelengths},
   journal = {Metrologia},
   year = {2020},
   month = {12},
   day = {14},
   volume = {58},
   number = {1},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {1-13},
   keywords = {metrological traceability, vector network analyser, calibration, waveguide, sub-millimetre-wave measurements, scattering parameters},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/abd371},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ridler, N. and Susan Johny, A. and Salter, M. and Shang, X. and Sun, W. and Wilson, A.}
}

@Article { MarschallHWHRKE2020,
   subid = {1801},
   title = {Compressed FTIR spectroscopy using low-rank matrix reconstruction},
   journal = {Optics Express},
   year = {2020},
   month = {12},
   volume = {28},
   number = {26},
   number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept},
   pages = {38762},
   keywords = {Fourier transform infrared; FTIR spectroscopy; low-rank matrix reconstruction},
   web_url = {https://www.osapublishing.org/oe/fulltext.cfm?uri=oe-28-26-38762\&id=444648},
   misc2 = {EMPIR 2018: Health},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.404959},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marschall, M. and Hornemann, A. and W{\"u}bbeler, G. and Hoehl, A. and Ruhl, E. and K{\"a}stner, B. and Elster, C.}
}

@Article { SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020,
   subid = {1841},
   title = {The European Joint Research Project UHDpulse – Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates},
   journal = {Physica Medica},
   year = {2020},
   month = {12},
   volume = {80},
   number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates},
   pages = {134-150},
   keywords = {Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project},
   misc2 = {EMPIR 2018: Health},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1120-1797},
   DOI = {10.1016/j.ejmp.2020.09.020},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sch{\"u}ller, A. and Heinrich, S. and Fouillade, C. and Subiel, A. and De Marzi, L. and Romano, F. and Peier, P. and Trachsel, M. and Fleta, C. and Kranzer, R. and Caresana, M. and Salvador, S. and Busold, S. and Sch{\"o}nfeld, A. and McEwen, M.  and Gomez, F. and Solc, J. and Bailat, C. and Linhart, V. and Jakubek, J. and Pawelke, J. and Borghesi, M. and Kapsch, R-P. and Knyziak, A. and Boso, A. and Olsovcova, V. and Kottler, C. and Poppinga, D. and Ambrozova, I. and Schmitzer, C-S. and Rossomme, S. and Vozenin, M-C.}
}

@Article { PetrovRCG2020,
   subid = {2037},
   title = {Evaluating the performance of oxidized Hg reference gas generators in the range ng m−3 to \(\mu\)g m−3 by improved coupling with ICP-MS},
   journal = {Atmospheric Environment: X},
   year = {2020},
   month = {12},
   volume = {8},
   number2 = {16ENV01: MercOx: Metrology for oxidised mercury},
   pages = {100090},
   keywords = {gaseous oxidized mercury, validation, ICP-MS},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2590-1621},
   DOI = {10.1016/j.aeaoa.2020.100090},
   stag_bib_extends_levelofaccess = {NA},
   author = {Petrov, P. and Rajamaki, T. and Corns, W.T. and Goenaga-Infante, H.}
}

@Inbook { IoanRZTB2020,
   subid = {2624},
   title = {Proiecte nationale si europene de metrologia radiatiilor, suport pentru implementarea Directivei 2013/59, in sanatate si protectia mediului},
   year = {2020},
   month = {12},
   number2 = {19ENV02: RemoteALPHA: Remote and real-time optical detection of alpha-emitting radionuclides in the environment},
   keywords = {Remote detection, optical detection, alpha particles},
   web_url = {https://srrp.ro/wp-content/uploads/2020/12/Conf.Nat_._SRRp_-2020-A4-ver.12.pdf},
   misc2 = {EMPIR 2019: Environment},
   booktitle = {Conferinta Nationala Aniversara a Societatii Romane de Radioprotectie –„SRRp-30”},
   language = {30},
   ISBN = {978-973-1985-64-0},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {978-973-1985-64-0},
   author = {Ioan, M-R. and Radulescu, I. and Zadehrafi, M. and Tugulan, L. and Barna, C.}
}

@Article { MeddingsHOLRNSHRGP2020,
   subid = {1986},
   title = {Application of electrochemical impedance spectroscopy to commercial Li-ion cells: A review},
   journal = {Journal of Power Sources},
   year = {2020},
   month = {12},
   volume = {480},
   number2 = {17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications},
   pages = {228742},
   keywords = {Lithium-ion batteryEISInterpretationValidationMetrologyDegradation},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0378-7753},
   DOI = {10.1016/j.jpowsour.2020.228742},
   stag_bib_extends_levelofaccess = {NA},
   author = {Meddings, N. and Heinrich, M. and Overney, F. and Lee, J-S. and Ruiz, V. and Napolitano, E. and Seitz, S. and Hinds, G. and Raccichini, R. and Gaberšček, M. and Park, J.}
}

@Article { PiliaSRGDKCL2020,
   subid = {2455},
   title = {Quantification and classification of potassium and calcium disorders with the electrocardiogram: What do clinical studies, modeling, and reconstruction tell us?},
   journal = {APL Bioengineering},
   year = {2020},
   month = {12},
   volume = {4},
   number = {4},
   number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management},
   pages = {041501},
   keywords = {Electrolytes, Medical diagnosis, Computational models, Wearable technology, Medical tests, Artificial neural networks, Artificial intelligence, Machine learning, Dialysis},
   misc2 = {EMPIR 2018: Health},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {2473-2877},
   DOI = {10.1063/5.0018504},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pilia, N. and Severi, S. and Raimann, J.G. and Genovesi, S. and D{\"o}ssel, O. and Kotanko, P. and Corsi, C. and Loewe, A.}
}

@Article { FinizioWMHLBBMR2020,
   subid = {2380},
   title = {Time-resolved visualization of the magnetization canting induced by field-like spin–orbit torques},
   journal = {Applied Physics Letters},
   year = {2020},
   month = {11},
   day = {23},
   volume = {117},
   number = {21},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {212404},
   keywords = {X-ray microscopy, Ferromagnetic materials, Time resolved imaging, Spin-orbit interactions, Spin Hall effect},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/5.0029816},
   stag_bib_extends_levelofaccess = {NA},
   author = {Finizio, S. and Wintz, S. and Mayr, S. and Huxtable, A.J. and Langer, M. and Bailey, J. and Burnell, G. and Marrows, C.H. and Raabe, J.}
}

@Article { SachsePVSRBBHKSKH2020,
   subid = {1704},
   title = {Assessing Optical and Electrical Properties of Highly Active IrOx Catalysts for the Electrochemical Oxygen Evolution Reaction via Spectroscopic Ellipsometry},
   journal = {ACS Catalysis},
   year = {2020},
   month = {11},
   day = {20},
   number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications},
   pages = {14210-14223},
   keywords = {spectroscopic ellipsometry, electrocatalysis, oxygen evolution reaction, mesoporous iridium oxidefilms, non-destructive ambient analysis, intrinsic OER activity, complementary methodology and metrology},
   misc2 = {EMPIR 2016: Energy},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2155-5435, 2155-5435},
   DOI = {10.1021/acscatal.0c03800},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sachse, R. and Pfl{\"u}ger, M. and Velasco-V{\'e}lez, J-J. and Sahre, M. and Radnik, J. and Bernicke, M. and Bernsmeier, D. and Hodoroaba, V-D. and Krumrey, M. and Strasser, P. and Kraehnert, R. and Hertwig, A.}
}

@Article { RitzmannLDKGWMFK2020,
   subid = {1754},
   title = {Comparison of Measurement Methods for 2-150 kHz Conducted Emissions in Power Networks},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2020},
   month = {11},
   day = {19},
   number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods},
   pages = {1-1},
   keywords = {High frequency distortion,power quality,harmonics,supraharmonics,measurement techniques,voltage distortion},
   tags = {SEG},
   misc2 = {EMPIR 2018: Pre-Co-Normative},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2020.3039302},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ritzmann, D. and Lodetti, S. and De La Vega, D. and Khokhlov, V. and Gallarreta, A. and Wright, P. and Meyer, J. and Fernandez, I. and Klingbeil, D.}
}

@Article { WrightR2020,
   subid = {1753},
   title = {A Digital Heterodyne 2 kHz to 150 kHz Measurement Method based on Multi Resolution Analysis},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2020},
   month = {11},
   day = {16},
   volume = {Early Acce},
   number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods},
   pages = {1-1},
   keywords = {Power system measurements,digital filters,digital signal processing,electromagnetic compatibility \& interference,power quality,wavelets},
   tags = {SEG},
   misc2 = {EMPIR 2018: Pre-Co-Normative},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {445 Hoes Lane Piscataway NJ 08855-1331 United States},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2020.3038290},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wright, P.S. and Ritzmann, D.}
}

@Proceedings { MeisnerGSHSEGRMLBOGS2020,
   subid = {1922},
   title = {Support for standardisation of high voltage testing with composite and combined wave shapes},
   journal = {VDE High Voltage Technology 2020, ETG-Symposium},
   year = {2020},
   month = {11},
   day = {11},
   number2 = {19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes},
   keywords = {Electricity grids, high voltage testing, traceability, combined wave shapes, composite wave shapes, universal dividers, calibration},
   tags = {SEG},
   web_url = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   publisher = {VDE},
   event_place = {online},
   event_name = {VDE High Voltage Technology 2020},
   event_date = {09-11-2020 to 11-11-2020},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215},
   author = {Meisner, J. and Gockenbach, E. and Saadeddine, H. and Havunen, J. and Schichler, U. and Elg, A-P. and Garnacho, F. and Roccato, P.E. and Merev, A. and Lahti, K. and Backhaus, K. and Orrea, A. and Gamlin, M. and Steiner, T.}
}

@Article { IstrateATRG2020,
   subid = {1755},
   title = {Traceable measurements of harmonic (2 to 150) kHz emissions in smart grids: uncertainty calculation},
   journal = {Journal of Sensors and Sensor Systems},
   year = {2020},
   month = {11},
   day = {10},
   volume = {9},
   number = {2},
   number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods},
   pages = {375-381},
   keywords = {Supraharmonics, Measurement, Uncertainty, Smart Grids},
   web_url = {https://jsss.copernicus.org/articles/9/375/2020/},
   misc2 = {EMPIR 2018: Pre-Co-Normative},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {2194-878X},
   DOI = {10.5194/jsss-9-375-2020},
   stag_bib_extends_levelofaccess = {NA},
   author = {Istrate, D. and Amaripadath, D. and Toutain, E. and Roche, R. and Gao, F.}
}

@Miscellaneous { PennecchiRAE,
   subid = {1659},
   title = {EMUE-D2-3-TSP Concentration},
   year = {2020},
   month = {11},
   day = {3},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Conformity assessment; Producer’s and consumer’s risk; Total suspended particulates in air; Mass Concentration; Measurement uncertainty; Log-normal prior distribution},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.5281/zenodo.4242988},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pennecchi, F. and Rolle, F. and Allard, A. and Ellison, S.L.R.}
}

@Article { PellegrinoIPSROMHM2020,
   subid = {1658},
   title = {Machine learning approach for elucidating and predicting the role of synthesis parameters on the shape and size of TiO2 nanoparticles},
   journal = {Scientific Reports},
   year = {2020},
   month = {11},
   volume = {10},
   number = {1},
   number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements},
   pages = {18910-1-11},
   keywords = {nanoparticles, titanium dioxide, size, shape, machine learning, synthesis},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-020-75967-w},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pellegrino, F. and Isopescu, R. and Pelluti{\`e}, L. and Sordello, F. and Rossi, A.M. and Ortel, E. and Martra, G. and Hodoroaba, V-D. and Maurino, V.}
}

@Article { IstrateKSRFSSG2020,
   subid = {1960},
   title = {Laboratory Calibration of Energy Measurement Systems (EMS) under AC Distorted Waveforms},
   journal = {Sensors},
   year = {2020},
   month = {11},
   volume = {20},
   number = {21},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   pages = {6301},
   keywords = {energy measurement; railway system; calibration setup; fictive power source; distorted regime; harmonic waveform; calibration procedure; energy measuring system},
   misc2 = {EMPIR 2016: Energy},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s20216301},
   stag_bib_extends_levelofaccess = {NA},
   author = {Istrate, D. and Khamlichi, A. and Soccalingame, S. and Rovira, J. and Fortune, D. and Š{\'i}ra, M. and Simon, P. and Garnacho, F.}
}

@Article { IstrateKSRFSS2020,
   subid = {1930},
   title = {Laboratory Calibration of Energy Measurement Systems (EMS) under AC Distorted Waveforms},
   journal = {Sensors},
   year = {2020},
   month = {11},
   volume = {20},
   number = {21},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   pages = {6301},
   keywords = {energy measurement; railway system; calibration setup; fictive power source; distorted regime; harmonic waveform; calibration procedure; energy measuring system},
   misc2 = {EMPIR 2016: Energy},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s20216301},
   stag_bib_extends_levelofaccess = {NA},
   author = {Istrate, D. and Khamlichi, A. and Soccalingame, S. and Rovira, J. and Fortune, D. and Š{\'i}ra, M. and Simon, P.}
}

@Article { HuntRSK2020,
   subid = {1692},
   title = {High-speed density measurement for LNG and other cryogenic fluids using electrical capacitance tomography},
   journal = {Cryogenics},
   year = {2020},
   month = {10},
   day = {24},
   volume = {113},
   number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel},
   pages = {103207},
   keywords = {Liquefied natural gasLNGElectrical capacitance tomographyECTDensity measurement},
   tags = {EnG},
   web_url = {https://doi.org/10.1016/j.cryogenics.2020.103207},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0011-2275},
   DOI = {10.1016/j.cryogenics.2020.103207},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hunt, A. and Rusli, I. and Schakel, M. and Kenbar, A.}
}

@Article { SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI2020,
   subid = {1664},
   title = {Intercontinental comparison of optical atomic clocks through very long baseline interferometry},
   journal = {Nature Physics},
   year = {2020},
   month = {10},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   keywords = {Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology},
   web_url = {http://hdl.handle.net/11696/64130},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1745-2473, 1745-2481},
   DOI = {10.1038/s41567-020-01038-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sekido, M. and Takefuji, K. and Ujihara, H. and Hachisu, H. and Nemitz, N. and Tsutsumi, M. and Kondo, T. and Kawai, E. and Ichikawa, R. and Namba, K. and Okamoto, Y. and Takahashi, R. and Komuro, J. and Clivati, C. and Bregolin, F. and Barbieri, P. and Mura, A. and Cantoni, E. and Cerretto, G. and Levi, F. and Maccaferri, G. and Roma, M. and Bortolotti, C. and Negusini, M. and Ricci, R. and Zacchiroli, G. and Roda, J. and Leute, J. and Petit, G. and Perini, F. and Calonico, D. and Pizzocaro, M. and Ido, T.}
}

@Article { BremerWFTSKRHSPMGR2020,
   subid = {1803},
   title = {Quantum dot single-photon emission coupled into single-mode fibers with 3D printed micro-objectives},
   journal = {APL Photonics},
   year = {2020},
   month = {10},
   volume = {5},
   number = {10},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {106101},
   keywords = {Quantum dot single-photon emission},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {2378-0967},
   DOI = {10.1063/5.0014921},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bremer, L. and Weber, K. and Fischbach, S. and Thiele, S. and Schmidt, M. and Kaganskiy, A. and Rodt, S. and Herkommer, A. and Sartison, M. and Portalupi, S.L. and Michler, P. and Giessen, H. and Reitzenstein, S.}
}

@Article { RomanoSMLPTMMBMAFGS2020,
   subid = {1839},
   title = {Challenges in dosimetry of particle beams with ultra-high pulse dose rates},
   journal = {Journal of Physics: Conference Series},
   year = {2020},
   month = {10},
   volume = {1662},
   number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates},
   pages = {012028},
   keywords = {ultra-high pulse dose rates, dosimetry, metrology, electrons},
   misc2 = {EMPIR 2018: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1662/1/012028},
   stag_bib_extends_levelofaccess = {NA},
   author = {Romano, F. and Subiel, A. and McManus, M. and Lee, N. D. and Palmans, H. and Thomas, R. and McCallum, S. and Milluzzo, G. and Borghesi, M. and McIlvenny, A. and Ahmed, H. and Farabolini, W. and Gilardi, A. and Sch{\"u}ller, A.}
}

@Thesis { Roccato2020,
   subid = {1921},
   title = {Sistema di misura per prove di tensione composite e combinate (Measuring system for composite and combined voltage tests)},
   year = {2020},
   month = {10},
   number2 = {19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes},
   keywords = {High Voltage, Measuring System, Combined waveform, Uncertainty},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   school = {Politecnico di Torino},
   language = {59},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://webthesis.biblio.polito.it/15631/},
   author = {Roccato, P.}
}

@Article { SikorskyGHKGEMRDWBRSKSF2020,
   subid = {1642},
   title = {Measurement of the Th229 Isomer Energy with a Magnetic Microcalorimeter},
   journal = {Physical Review Letters},
   year = {2020},
   month = {9},
   day = {28},
   volume = {125},
   number = {14},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   keywords = {Th229 Isomer Energy, Magnetic Microcalorimeter},
   web_url = {https://arxiv.org/abs/2005.13340},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.125.142503},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sikorsky, T. and Geist, J. and Hengstler, D. and Kempf, S. and Gastaldo, L. and Enss, C. and Mokry, C. and Runke, J. and D{\"u}llmann, C.E. and Wobrauschek, P. and Beeks, K. and Rosecker, V. and Sterba, J.H. and Kazakov, G. and Schumm, T. and Fleischmann, A.}
}

@Article { JandaGOPUHRSMRNCHWEACDMORONJKZ2020,
   subid = {1683},
   title = {Magneto-Seebeck microscopy of domain switching in collinear antiferromagnet CuMnAs},
   journal = {Physical Review Materials},
   year = {2020},
   month = {9},
   day = {28},
   volume = {4},
   number = {9},
   number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications},
   pages = {094413-1 to 094413-9},
   keywords = {-},
   web_url = {https://arxiv.org/abs/2004.05460},
   misc2 = {EMPIR 2016: Energy},
   publisher = {American Physical Society (APS)},
   address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States},
   language = {30},
   ISSN = {2475-9953},
   DOI = {10.1103/PhysRevMaterials.4.094413},
   stag_bib_extends_levelofaccess = {NA},
   author = {Janda, T. and Godinho, J. and Ostatnicky, T. and Pfitzner, E. and Ulrich, G. and Hoehl, A. and Reimers, S. and Šob{\'a}ň, Z. and Metzger, T. and Reichlov{\'a}, H. and Nov{\'a}k, V. and Campion, R. P. and Heberle, J. and Wadley, P. and Edmonds, K. W. and Amin, O. J. and Chauhan, J. S. and Dhesi, S. S. and Maccherozzi, F. and Otxoa, R. M. and Roy, P. E. and Olejn{\'i}k, K. and Němec, P. and Jungwirth, T. and Kaestner, B. and Ziade, Francois}
}

@Article { EckmannvCLvKR2020,
   subid = {1605},
   title = {Density Measurements of (0.99 Methane + 0.01 Butane) and (0.98 Methane + 0.02 Isopentane) over the Temperature Range from (100 to 160) K at Pressures up to 10.8 MPa},
   journal = {International Journal of Thermophysics},
   year = {2020},
   month = {9},
   day = {23},
   volume = {41},
   number = {11},
   number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel},
   pages = {1-19/156},
   keywords = {Cryogenic state · Density measurement · Liquefied binary mixtures ·Magnetic-suspension coupling · Single-sinker densimeter},
   tags = {EnG},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-020-02728-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Eckmann, P. and von Preetzmann, N. and Cavuoto, G. and Li, J. and van der Veen, A. and Kleinrahm, R. and Richter, M.}
}

@Article { ChristinckRLHGK2020,
   subid = {1880},
   title = {Characterization of the angular-dependent emission of nitrogen-vacancy centers in nanodiamond},
   journal = {Applied Physics B},
   year = {2020},
   month = {9},
   day = {18},
   volume = {126},
   number = {10},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {Single-photon sources},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0946-2171, 1432-0649},
   DOI = {10.1007/s00340-020-07508-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Christinck, J. and Rodiek, B. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and K{\"u}ck, S.}
}

@Article { WinterSVMRPKHLHDBBBBBBKSR2020,
   subid = {1950},
   title = {Results of the Bifacial PV Cells and PV Modules Power Measurement Round Robin Activity of the PV-Enerate Project},
   journal = {37th European Photovoltaic Solar Energy Conference and Exhibition},
   year = {2020},
   month = {9},
   day = {11},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   pages = {877 - 882},
   keywords = {Testing, PV Module, Bifacial PV},
   misc2 = {EMPIR 2016: Energy},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4055707},
   author = {Winter, S. and Str{\"a}ter, H. and Vegas, A. and Molinero, R.R. and Riechelmann, S. and Pavanello, D. and Kenny, R. and Herrmann, W. and Lopez-Garcia, J. and Hinken, D. and Dittmann, S. and Bonilla, J. and Bliss, M.  and Bothe, K. and Blakesley, J.C. and Betts, T.R. and Bellenda, G. and Koutsourakis, G.  and Schmid, A. and Rauer, M.}
}

@Proceedings { MubarakMTRS2020,
   subid = {1723},
   title = {Automated Contacting of On-Wafer Devices for RF Testing},
   journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)},
   year = {2020},
   month = {9},
   day = {10},
   volume = {N/A},
   number = {N/A},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {1-2},
   keywords = {On-wafer probing, on-wafer contacting, microwave measurements, measurement techniques, measurement uncertainty, precision measurements, uncertainty},
   web_url = {https://zenodo.org/record/4276095},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Denver (Aurora), CO, USA, USA},
   event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM)},
   event_date = {24-08-2020 to 28-08-2020},
   language = {30},
   ISBN = {978-1-7281-5899-0},
   ISSN = {2160-0171},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.1109/CPEM49742.2020.9191800},
   author = {Mubarak, F. and Martino, C.D. and Toskovic, R. and Rietveld, G. and Spirito, M.}
}

@Article { GeorgievaLHCRSKHRRK2020,
   subid = {1881},
   title = {Radiometric characterization of a triggered narrow-bandwidth single-photon source and its use for the calibration of silicon single-photon avalanche detectors},
   journal = {Metrologia},
   year = {2020},
   month = {9},
   volume = {57},
   number = {5},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {055001},
   keywords = {quantum radiometry, quantum metrology, single-photon source, single-photondetector, quantum dot},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab9db6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Georgieva, H. and L{\'o}pez, M. and Hofer, H. and Christinck, J. and Rodiek, B. and Schnauber, P. and Kaganskiy, A. and Heindel, T. and Rodt, S. and Reitzenstein, S. and K{\"u}ck, S.}
}

@Proceedings { RiechelmannSW2020,
   subid = {1606},
   title = {DETERMINATION OF A PV MODULE POWER MATRIX WITH AN LED SOLAR SIMULATOR},
   journal = {EUPVSEC-proceedings},
   year = {2020},
   month = {9},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   keywords = {Energy Rating, Characterization, Electrical Properties, Qualification and Testing, Photovoltaic},
   web_url = {https://zenodo.org/record/4049818},
   misc2 = {EMPIR 2016: Energy},
   event_place = {online conference},
   event_name = {EUPVSEC 2020},
   event_date = {07-09-2020 to 07-09-2020},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4049818},
   author = {Riechelmann, S. and Straeter, H. and Winter, S.}
}

@Article { WilsonSSJR2020,
   subid = {1581},
   title = {Comparing Standardized and Manufacturers’ Interfaces for Waveguides Used at Submillimeter Wavelengths},
   journal = {IEEE Transactions on Terahertz Science and Technology},
   year = {2020},
   month = {9},
   volume = {10},
   number = {5},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {453-459},
   keywords = {Rectangular waveguide, submillimeter-waves, terahertz, waveguide flanges, waveguide interfaces, waveguidestandards},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2156-342X, 2156-3446},
   DOI = {10.1109/TTHZ.2020.3010122},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wilson, Alan and Sun, Wenjuan and Shang, Xiaobang and Johny, Susan and Ridler, Nick M.}
}

@Article { WangSRNDHW2020,
   subid = {1582},
   title = {Material Measurements Using VNA-Based Material Characterization Kits Subject to Thru-Reflect-Line Calibration},
   journal = {IEEE Transactions on Terahertz Science and Technology},
   year = {2020},
   month = {9},
   volume = {10},
   number = {5},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {466-473},
   keywords = {Loss tangent, millimeter-wave measurements, relative permittivity, terahertz measurements, time-domain spectrometer (TDS), thru-reflect-line (TRL) calibration, vector network analyzer (VNA)},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2156-342X, 2156-3446},
   DOI = {10.1109/TTHZ.2020.2999631},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wang, Yi and Shang, Xiaobang and Ridler, Nick M. and Naftaly, Mira and Dimitriadis, Alexandros I. and Huang, Tongde and Wu, Wen}
}

@Article { GunkelDHLKRUBT2020,
   subid = {1684},
   title = {Phonon‐Enhanced Near‐Field Spectroscopy to Extract the Local Electronic Properties of Buried 2D Electron Systems in Oxide Heterostructures},
   journal = {Advanced Functional Materials},
   year = {2020},
   month = {9},
   volume = {30},
   number = {46},
   number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications},
   pages = {2004767},
   keywords = {2D electron systems, electronic properties, LaAlO/SrTiO, near-field spectroscopy, oxide heterostructure},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Wiley},
   language = {30},
   ISSN = {1616-301X, 1616-3028},
   DOI = {10.1002/adfm.202004767},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gunkel, F. and Dittmann, R. and Hoehl, A. and Lewin, M. and K{\"a}stner, B. and Rose, M‐A. and Ulrich, G. and Barnett, J. and Taubner, T.}
}

@Proceedings { ChenMBR2020,
   subid = {1765},
   title = {Development of a Wideband Current-to-Voltage Transformer Set for Currents up to 2 kA},
   journal = {2020 Conference on Precision Electromagnetic Measurements},
   year = {2020},
   month = {8},
   day = {24},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   keywords = {Wideband, current transformers, calibration, measurement uncertainty, instrument transformer},
   tags = {SEG},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Zenodo},
   event_place = {Denver (Aurora), CO, USA, USA},
   event_name = {2020 Conference on Precision Electromagnetic Measurements},
   event_date = {24-08-2020 to 28-08-2020},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4348461},
   author = {Chen, Y. and Mohns, E. and Badura, H. and Raether, P.}
}

@Article { ClivatiABBDDMMMNLPRRSSSTC2020,
   subid = {1773},
   title = {Common-clock very long baseline interferometry using a coherent optical fiber link},
   journal = {Optica},
   year = {2020},
   month = {8},
   day = {20},
   volume = {7},
   number = {8},
   number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {1031},
   keywords = {fiber links, coherent phase transfer, frequency dissemination with fibers, VLBI},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {2334-2536},
   DOI = {10.1364/OPTICA.393356},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clivati, C. and Aiello, R. and Bianco, G. and Bortolotti, C. and De Natale, P. and Di Sarno, V. and Maddaloni, P. and Maccaferri, G. and Mura, A. and Negusini, M. and Levi, F. and Perini, F. and Ricci, R. and Roma, M. and Santamaria Amato, L. and Siciliani de Cumis, M. and Stagni, M. and Tuozzi, A. and Clivati, C.}
}

@Article { SchwarzDABLSWRLL2020,
   subid = {1570},
   title = {Long term measurement of the 87Sr clock frequency at the limit of primary Cs clocks},
   journal = {Physical Review Research},
   year = {2020},
   month = {8},
   day = {11},
   volume = {2},
   number = {3},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   pages = {033242},
   keywords = {Atomic spectra, optical clocks, gravitation},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   address = {Ricklinger Stadtweg 4c},
   language = {30},
   DOI = {10.1103/PhysRevResearch.2.033242},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schwarz, R and D{\"o}rscher, S and Al-Masoud, A and Benkler, E and Legero, T and Sterr, U and Weyers, S and Rahm, J and Lipphardt, B and Lisdat, C}
}

@Proceedings { vanLeeuwenvRHH2020,
   subid = {1943},
   title = {Measuring the Voltage Dependence of Current Transformers},
   journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)},
   year = {2020},
   month = {8},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   keywords = {Current measurement, current transformers, measurement standards, precision measurements},
   tags = {SEG},
   web_url = {https://www.techrxiv.org/articles/preprint/Measuring_the_Voltage_Dependence_of_Current_Transformers/13469673/1},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   event_place = {Denver, CO, USA},
   event_name = {Conference on Precision Electromagnetic Measurements (CPEM)},
   event_date = {24-08-2020 to 28-08-2020},
   language = {30},
   ISBN = {978-1-7281-5898-3},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM49742.2020.9191845},
   stag_bib_extends_levelofaccess = {NA},
   author = {van Leeuwen, R. and van den Brom, H. and Rietveld, G. and Houtzager, E. and Hoogenboom, D.}
}

@Proceedings { vanVeghelSvHRvMK2020,
   subid = {2103},
   title = {Towards improved standardization of electricity meter testing},
   journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)},
   year = {2020},
   month = {8},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   keywords = {Energy measurement,electromagnetic compatibility,measurement errors,electricity meters},
   tags = {SEG},
   web_url = {https://www.techrxiv.org/articles/preprint/Towards_improved_standardization_of_electricity_meter_testing/13469622/1},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   event_place = {Bolder},
   event_name = {Conference of Precession Electromagnetic MeasurementsPEM},
   event_date = {01-08-2020 to 07-08-2020},
   language = {30},
   DOI = {10.1109/CPEM49742.2020.9191719},
   stag_bib_extends_levelofaccess = {NA},
   author = {van Veghel, M.G.A. and Sharma, S. and van den Brom, H.E. and Hoogenboom, D. and Rietveld, G. and van Leeuwen, R. and Marais, Z. and Kok, G.J.P.}
}

@Proceedings { RietveldZY2020,
   subid = {2534},
   title = {Verification of High Voltage Divider with 10E-6 Uncertainty},
   journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)},
   year = {2020},
   month = {8},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {voltage divider, calibration, high voltage, voltage transformer, uncertainty, loss measurement, power transformer},
   tags = {SEG},
   web_url = {https://zenodo.org/record/5997015},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   event_place = {Denver, CO, USA},
   event_name = {2020 Conference on Precision Electromagnetic Measurements},
   event_date = {24-08-2020 to 28-08-2020},
   language = {30},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM49742.2020.9191889},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, G. and Zhao, W. and Ye, G.}
}

@Proceedings { KazemipourHWAHRSZ2020,
   subid = {1663},
   title = {VNA-Based Material Characterization in THz Domain without Classic Calibration and Time-Gating},
   journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)},
   year = {2020},
   month = {8},
   volume = {N/A},
   number = {N/A},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {1-2},
   keywords = {Material characterization, parameter extraction, VNA time-gating, RF metrology, measurement uncertainty},
   web_url = {https://doi.org/10.5281/zenodo.4243044},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Denver, CO, USA},
   event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM)},
   event_date = {24-08-2020 to 28-08-2020},
   language = {30},
   ISBN = {978-1-7281-5898-3},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM49742.2020.9191818},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Allal, D. and Hudlicka, M. and Ruefenacht, J. and Stalder, D. and Zeier, M.}
}

@Article { RuutelYKSIDHHTBL2020,
   subid = {2185},
   title = {Design, synthesis and application of carbazole macrocycles in anion sensors},
   journal = {Beilstein Journal of Organic Chemistry},
   year = {2020},
   month = {8},
   volume = {16},
   number = {2020},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   pages = {1901-1914},
   keywords = {anion sensors; carboxylates;ionophores; acrocycles; sensor prototype},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Beilstein Institut},
   language = {30},
   ISSN = {1860-5397},
   DOI = {10.3762/bjoc.16.157},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"u}{\"u}tel, A. and Yrj{\"a}n{\"a}, V. and Kadam, S.A. and Saar, I. and Ilisson, M. and Darnell, A. and Haav, K. and Haljasorg, T. and Toom, L. and Bobacka, J. and Leito, I.}
}

@Miscellaneous { PennecchiRSEv,
   subid = {1553},
   title = {EMUE-D3-2-Low Mass BaP Evaluation},
   year = {2020},
   month = {7},
   day = {31},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Uncertainty evaluation; Monte Carlo method; GUM uncertainty framework;Benzo[a]pyrene; Polycyclic Aromatic Hydrocarbons},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.5281/zenodo.3968940},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pennecchi, F. and Rolle, F. and Sega, M. and Ellison, S.L.R. and van der Veen, A.M.H.}
}

@Article { BatistaGMMR2020,
   subid = {1571},
   title = {Development of an experimental setup for microflow measurement using interferometry},
   journal = {Flow measurement instrumentation},
   year = {2020},
   month = {7},
   day = {29},
   volume = {75},
   number2 = {18HLT08: MEDDII: Metrology for drug delivery},
   pages = {101789},
   keywords = {Microflow measurement, Interferometry, Calibration, Measurement uncertainty},
   misc2 = {EMPIR 2018: Health},
   publisher = {Elsevier},
   language = {30},
   DOI = {10.1016/j.flowmeasinst.2020.101789},
   stag_bib_extends_levelofaccess = {NA},
   author = {Batista, Elsa and Godinho, Isabel and Martins, Rui and Mendes, Ricardo and Robarts, Jo{\~a}o}
}

@Article { KazemipourWHHYRSGZ2020,
   subid = {1603},
   title = {Analytical Uncertainty Evaluation of Material Parameter Measurements at THz Frequencies},
   journal = {Journal of Infrared, Millimeter, and Terahertz Waves},
   year = {2020},
   month = {7},
   day = {24},
   volume = {41},
   number = {10},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {1199 - 1217},
   keywords = {Material characterization, Extraction method, THz domain, Sensitivity coefficient, Measurement uncertainty, RF metrology},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1866-6892, 1866-6906},
   DOI = {10.1007/s10762-020-00723-0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazemipour, A. and Wollensack, M. and Hoffmann, J. and Hudlicka, M. and Yee, S-K. and R{\"u}fenacht, J. and Stalder, D. and G{\"a}umann, G. and Zeier, M.}
}

@Article { FerreroBCRFM2020,
   subid = {1858},
   title = {Goniochromatic assessment of gray scales for color change},
   journal = {Journal of the Optical Society of America A},
   year = {2020},
   month = {7},
   day = {22},
   volume = {37},
   number = {8},
   number2 = {IND52: xDReflect: Multidimensional reflectometry for industry},
   pages = {1266},
   keywords = {Color, gray scale, goniochromatism},
   web_url = {https://digital.csic.es/bitstream/10261/227636/1/Goniochromatic\%20assessment.pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1084-7529, 1520-8532},
   DOI = {10.1364/JOSAA.394170},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ferrero, A. and Bernad, B. and Campos, J. and Richard, N. and Fern{\'a}ndez-Maloigne, C. and Melgosa, M.}
}

@Article { FretwellLBKDLMPRSF2020,
   subid = {1539},
   title = {Direct Measurement of the 7Be L/K Capture Ratio in Ta-Based Superconducting Tunnel Junctions},
   journal = {Physical Review Letters},
   year = {2020},
   month = {7},
   day = {14},
   volume = {125},
   number = {3},
   number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters},
   pages = {032701},
   keywords = {7Be, Electron captures, Cryogenic detectors, Theoretical calculations},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2003.04921},
   author = {Fretwell, S. and Leach, K.G. and Bray, C. and Kim, G.B. and Dilling, J. and Lennarz, A. and Mougeot, X. and Ponce, F. and Ruiz, C. and Stackhouse, J. and Friedrich, S.}
}

@Article { HeeringSCANNQRBBNSLLURVSDRKL2020,
   subid = {1554},
   title = {Symmetric Potentiometric Cells for the Measurement of Unified pH Values},
   journal = {Symmetry},
   year = {2020},
   month = {7},
   volume = {12},
   number = {7},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   pages = {1150},
   keywords = {unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2073-8994},
   DOI = {10.3390/sym12071150},
   stag_bib_extends_levelofaccess = {NA},
   author = {Heering, Agnes and Stoica, Daniela and Cam{\~o}es, Filomena and Anes, B{\'a}rbara and Nagy, D{\'a}niel and Nagyn{\'e} Szil{\'a}gyi, Zs{\'o}fia and Quendera, Raquel and Ribeiro, Luis and Bastkowski, Frank and Born, Rasmus and Nerut, Jaak and Saame, Jaan and Lainela, Silvie and Liv, Lokman and Uysal, Emrah and Rozikov{\'a}, Matilda and Vičarov{\'a}, Martina and Snedden, Alan and Deleebeeck, Lisa and Radtke, Valentin and Krossing, Ingo and Leito, Ivo}
}

@Article { WuHRSW2020,
   subid = {1516},
   title = {Characterization of Dielectric Materials at WR-15 Band (50–75 GHz) Using VNA-Based Technique},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2020},
   month = {7},
   volume = {69},
   number = {7},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {4930-4939},
   keywords = {Dielectric constant, dielectric measurements, free-space measurement, loss tangent, millimeter-wave measurements, vector network analyzer (VNA)},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2019.2954010},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wang, Y. and Shang, X. and Ridler, N.M. and Huang, T. and Wu, W.}
}

@Article { LindgrenBRLGBIM2020,
   subid = {1856},
   title = {Review of road surface photometry methods and devices – Proposal for new measurement geometries},
   journal = {Lighting REsearch and technology},
   year = {2020},
   month = {7},
   number = {1},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   pages = {1-17},
   keywords = {SURFACE, road surface, asphalt, luminance coefficient, measurement geometries},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {SAGE},
   language = {30},
   ISSN = {1477-0938},
   DOI = {10.1177/1477153520958454},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lindgren, M. and Blattner, P. and Reber, J. and Liandrat, S. and GREFFIER, F. and Bernasconi, J. and Iacomussi, P. and Muzet, V.}
}

@Article { FlierlRP2020,
   subid = {1565},
   title = {Solution to gas weighing challenge},
   journal = {Analytical and Bioanalytical Chemistry},
   year = {2020},
   month = {6},
   day = {27},
   volume = {412},
   number = {17},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   pages = {3957-3959},
   keywords = {buoyancy correction, gas weighing, gas mixing},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1618-2642, 1618-2650},
   DOI = {10.1007/s00216-020-02697-3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Flierl, Lukas and Rienitz, Olaf and Pramann, Axel}
}

@Article { BloklandSRB2020,
   subid = {1517},
   title = {Capacitive and Infrared Gas Sensors for the Assessment of the Methane Number of LNG Fuels},
   journal = {Sensors},
   year = {2020},
   month = {6},
   day = {12},
   volume = {20},
   number = {12},
   number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel},
   pages = {3345},
   keywords = {energy transition; Methane Number; gas composition sensor; capacitive sensor array; interdigitated electrodes; responsive coatings; tunable filter infrared spectrometer; LNG; biogas},
   tags = {EnG},
   misc2 = {EMPIR 2016: Energy},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s20123345},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sweelssen, J. and Blokland, H. and Rajamaki, T. and Boersma, A.}
}

@Proceedings { RoseLKPMP2020,
   subid = {1590},
   title = {Modulation-based long-range interferometry as basis for an optical two-color temperature sensor},
   journal = {Proceedings 20th euspen International Conference and Exhibition},
   year = {2020},
   month = {6},
   day = {12},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   keywords = {2f/3f detection, laser modulation},
   web_url = {https://oar.ptb.de/files/download/5f3b86124c93900740005e17},
   misc2 = {EMPIR 2018: SI Broader Scope},
   event_place = {Online Conference},
   event_name = {20th euspen International Conference and Exhibition},
   event_date = {08-06-2020 to 12-06-2020},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.euspen.eu/euspen-knowledge-base/proceedings-search/\#!/author=Anni\%20Ro\&event=7871},
   author = {Rose, A. and Liu, Y. and K{\"o}chert, P. and Prellinger, G. and Manske, E. and Pollinger, F.}
}

@Miscellaneous { SegaRPSdv,
   subid = {1509},
   title = {EMUE-D3-3-Calibration Gas Mixtures},
   year = {2020},
   month = {6},
   day = {3},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Gas mixtures; Nitrogen oxides; Dynamic dilution; Mass flow controllers; Chemiluminescence analyser; Calibration; Uncertainty and covariance evaluation; Weighted Total Least-Squares},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.5281/zenodo.3875469},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sega, M. and Rolle, F. and Pennecchi, F. and Spazzini, P. and de Krom, I. and van der Veen, A.M.H.}
}

@Article { FlierlPNRR2020,
   subid = {1562},
   title = {UncorK – A Monte Carlo simulation tool for calculating combined uncertainties associated with mass bias calibration factors for isotope ratio measurements},
   journal = {Spectrochimica Acta Part B: Atomic Spectroscopy},
   year = {2020},
   month = {6},
   volume = {168},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   pages = {105866},
   keywords = {Mass bias correction, Uncertainty propagation, SI traceability, Metrology, Absolute isotope ratio},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   address = {Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands},
   language = {30},
   ISSN = {0584-8547},
   DOI = {10.1016/j.sab.2020.105866},
   stag_bib_extends_levelofaccess = {NA},
   author = {Flierl, Lukas and Pramann, Axel and Noordmann, Janine and R{\"o}thke, Anita and Rienitz, Olaf}
}

@Article { PradyumnaLRTZJADGG2020,
   subid = {1574},
   title = {Twin beam quantum-enhanced correlated interferometry for testing fundamental physics},
   journal = {Communications Physics},
   year = {2020},
   month = {6},
   volume = {3},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {104},
   keywords = {Optical physicsQuantum metrologyQuantum optics},
   web_url = {https://www.nature.com/articles/s42005-020-0368-5\#Bib1},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Nature Research},
   address = {233 Spring St. New York NY 10013 United States},
   language = {30},
   ISSN = {2399-3650},
   DOI = {10.1038/s42005-020-0368-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pradyumna, S. T. and Losero, E. and Ruo-Berchera, I. and Traina, P. and Zucco, M. and Jacobsen, C. S. and Andersen, U. L. and Degiovanni, I. P. and Genovese, M. and Gehring, T.}
}

@Article { SamantarayRB2020,
   subid = {1596},
   title = {Single-phase and correlated-phase estimation with multiphoton annihilated squeezed vacuum states: An energy-balancing scenario},
   journal = {Physical Review A},
   year = {2020},
   month = {6},
   volume = {101},
   number = {6},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {063810},
   keywords = {quantum optics, quantum metrology, non-gaussian states},
   web_url = {https://arxiv.org/abs/1809.10706},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.101.063810},
   stag_bib_extends_levelofaccess = {NA},
   author = {Samantaray, N. and Ruo-Berchera, I. and Berchera, I.}
}

@Article { deHuuTBSBMMNPR2020,
   subid = {1819},
   title = {Design of gravimetric primary standards for field-testing of hydrogen refuelling stations},
   journal = {Flow Measurement and Instrumentation},
   year = {2020},
   month = {6},
   volume = {73},
   number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles},
   pages = {101747},
   keywords = {Hydrogen calibration, Hydrogen dispenser, Gravimetric method},
   tags = {EnG},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0955-5986},
   DOI = {10.1016/j.flowmeasinst.2020.101747},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Huu, M. and Tschannen, M. and Bissig, H. and Stadelmann, P. and B{\"u}ker, O. and MacDonald, M. and Maury, R. and Neuvonen, P.T. and Petter, H.T. and RASMUSSEN, K.}
}

@Article { RoyleGFLRMPS2020,
   subid = {1510},
   title = {The challenge of ionisation chamber dosimetry in ultra-short pulsed high dose-rate Very High Energy Electron beams},
   journal = {Scientific Reports},
   year = {2020},
   month = {6},
   volume = {10},
   number = {1},
   number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates},
   keywords = {dosimetry, VHEE, uhigh dose-per-pulse, ion recombination},
   web_url = {https://www.nature.com/articles/s41598-020-65819-y},
   misc2 = {EMPIR 2018: Health},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-020-65819-y},
   stag_bib_extends_levelofaccess = {NA},
   author = {McManus, M. and Romano, F. and Lee, N.D. and Farabolini, W. and Gilardi, A. and Royle, G. and Palmans, H. and Subiel, A.}
}

@Proceedings { BosseEZCBOYBMRF2020,
   subid = {1665},
   title = {AdvManuNet: a networking project on metrology for advanced manufacturing},
   journal = {Proceedings 20th euspen International Conference and Exhibition},
   year = {2020},
   month = {6},
   volume = {2020},
   number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing},
   keywords = {Advanced Manufacturing, Key Enabling Technology (KET), Strategic Research Agenda (SRA), European Metrology Network (EMN)},
   misc2 = {EMPIR 2019: Support for Networks},
   event_place = {Online Conference},
   event_name = {20th euspen International Conference and Exhibition},
   event_date = {08-06-2020 to 12-06-2020},
   language = {30},
   ISBN = {978-0-9957751-7-6},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE20374.pdf},
   author = {Bosse, H. and Evans, A. and Zelen{\'y}, V. and Czulek, D. and Balsamo, A. and O'Connor, D. and Yandayan, T. and Billington, D. and Meli, F. and Ragusa, C. and Flys, O.}
}

@Proceedings { ReuterRFPBHR2020,
   subid = {1653},
   title = {Applications of Tactile Microprobes for Surface Metrology},
   journal = {SMSI 2020 - Sensors and Instrumentation},
   year = {2020},
   month = {6},
   volume = {Chapter A6},
   number = {2020},
   number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements},
   pages = {87-88},
   keywords = {piezoresistive cantilever, MEMS, atomic force microscopy, contact resonance, surfaceroughness},
   misc2 = {EMPIR 2017: Industry},
   publisher = {AMA Association for Sensors and Measurement},
   event_place = {Nuremberg, Germany},
   event_name = {SMSI 2020},
   event_date = {22-06-2020 to 25-06-2020},
   language = {30},
   ISBN = {978-3-9819376-2-6},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.ama-science.org/proceedings/details/3655},
   author = {Reuter, C. and Reum, A. and Fahrbach, M. and Peiner, E. and Brand, U. and Hofmann, M.  and Rangelow, I.}
}

@Article { RuoBercheraMLASG2020,
   subid = {1576},
   title = {Improving resolution-sensitivity trade off in sub-shot noise quantum imaging},
   journal = {Applied Physics Letters},
   year = {2020},
   month = {5},
   day = {26},
   volume = {116},
   number = {21},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {214001},
   keywords = {Optical metrology, Quantum correlations, Signal processing, Quantum efficiency, Quantum limit, Charge coupled devices},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/5.0009538},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ruo-Berchera, I. and Meda, A. and Losero, E. and Avella, A. and Samantaray, N. and Genovese, M.}
}

@Article { RadtkePHK2020,
   subid = {1634},
   title = {The Inverted Philosopher’s Stone: how to turn silver to a base metal},
   journal = {Journal of Solid State Electrochemistry},
   year = {2020},
   month = {5},
   day = {23},
   number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale},
   keywords = {Hydrogen electrode . Ionic liquid . Ion solvation . Protoelectric Potential Map},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1432-8488, 1433-0768},
   DOI = {10.1007/s10008-020-04633-y},
   stag_bib_extends_levelofaccess = {NA},
   author = {Radtke, V. and P{\"u}tz, K. and Himmel, D. and Krossing, I.}
}

@Article { WeituschatDGRKP2020,
   subid = {1983},
   title = {Photonic and Thermal Modelling of Microrings in Silicon, Diamond and GaN for Temperature Sensing},
   journal = {Nanomaterials},
   year = {2020},
   month = {5},
   day = {12},
   volume = {10},
   number = {5},
   number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry},
   pages = {934},
   keywords = {finite-element-simulation; optical ring resonator; diamond; silicon; gallium nitride;temperature sensor; thermal modelling; two-photon absorption; self-heating},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2079-4991},
   DOI = {10.3390/nano10050934},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weituschat, L.M. and Dickmann, W. and Guimbao, J. and Ramos, D. and Kroker, S. and Postigo, P-A.}
}

@Article { WeituschatDGRKP2020_2,
   subid = {2238},
   title = {Photonic and Thermal Modelling of Microrings in Silicon, Diamond and GaN for Temperature Sensing},
   journal = {Nanomaterials},
   year = {2020},
   month = {5},
   day = {12},
   volume = {10},
   number = {5},
   number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry},
   pages = {934},
   keywords = {finite-element-simulation; optical ring resonator; diamond; silicon; gallium nitride;temperature sensor; thermal modelling; two-photon absorption; self-heating},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2079-4991},
   DOI = {10.3390/nano10050934},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weituschat, L.M. and Dickmann, W. and Guimbao, J. and Ramos, D. and Kroker, S. and Postigo, P.A.}
}

@Article { FinizioWMHLBBMR2020_2,
   subid = {2379},
   title = {Current-induced dynamical tilting of chiral domain walls in curved microwires},
   journal = {Applied Physics Letters},
   year = {2020},
   month = {5},
   volume = {116},
   number = {18},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {182404},
   keywords = {domain wall, spin-orbit torque, x-ray microscopy},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0003-6951, 1077-3118},
   DOI = {10.1063/5.0005186},
   stag_bib_extends_levelofaccess = {NA},
   author = {Finizio, S. and Wintz, S. and Mayr, S. and Huxtable, A.J. and Langer, M. and Bailey, J. and Burnell, G. and Marrows, C.H. and Raabe, J.}
}

@Miscellaneous { SilvaALSCRMBS_2,
   subid = {1486},
   title = {EMUE-D6-4-Mobile Optical Measurement},
   year = {2020},
   month = {4},
   day = {18},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Measurement uncertainty; Calibration; Mobile optical measurement system},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.5281/zenodo.3756658},
   stag_bib_extends_levelofaccess = {NA},
   author = {Silva, M.A. and Almeida, M.C. and Loureiro, D. and Sousa, J.A. and Cox, M.G. and Ribeiro, A.S. and Martins, L.L. and Brito, R. and Soares, A.C.}
}

@Article { GedRHO2020,
   subid = {1739},
   title = {Assessing gloss under diffuse and specular lighting},
   journal = {Color Research \& Application},
   year = {2020},
   month = {4},
   day = {16},
   volume = {45},
   number = {4},
   number2 = {16NRM08: BiRD: Bidirectional reflectance definitions},
   pages = {591-602},
   keywords = {Gloss, diffuse lighting,  specular lighting, environmental effect, MLDS, Visual perception},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Wiley},
   language = {30},
   ISSN = {0361-2317, 1520-6378},
   DOI = {10.1002/col.22510},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ged, G. and Rabal‐Almazor, A‐M. and Himbert, M.E. and Obein, G.}
}

@Article { RonnbergBGMK2020,
   subid = {1492},
   title = {Comparison of Measurement Methods for the Frequency Range 2–150 kHz (Supraharmonics) Based on the Present Standards Framework},
   journal = {IEEE Access},
   year = {2020},
   month = {4},
   day = {15},
   volume = {8},
   number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods},
   pages = {77618-77630},
   keywords = {Distortion measurement, electromagnetic compatibility, measurement standards, powerquality, supraharmonics, frequency domain analysis},
   web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=9067844},
   misc2 = {EMPIR 2018: Pre-Co-Normative},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2169-3536},
   DOI = {10.1109/ACCESS.2020.2987996},
   stag_bib_extends_levelofaccess = {NA},
   author = {Khokhlov, V. and Meyer, J. and Grevener, A. and Busatto, T. and Ronnberg, S.}
}

@Miscellaneous { SilvaALSCRMBS,
   subid = {1484},
   title = {EMUE-D1-3-Single Burning Item},
   year = {2020},
   month = {4},
   day = {1},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Measurement uncertainty; Measurement model; SBI – Single Burning Item; Reaction to fire test},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.5281/zenodo.3736602},
   stag_bib_extends_levelofaccess = {NA},
   author = {Silva, M.A. and Almeida, M.C. and Loureiro, D. and Sousa, J.A. and Cox, M.G. and Ribeiro, A.S. and Martins, L.L. and Brito, R. and Soares, A.C.}
}

@Article { YacootKHDDRVN2020,
   subid = {1489},
   title = {Multiple fibre interferometry setup for probe sample interaction measurements in atomic force microscopy},
   journal = {Measurement Science and Technology},
   year = {2020},
   month = {4},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   keywords = {atomic force microscopy, Fibre interferometry, probe sample interaction, nanometrology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ab85d8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Klapetek, P. and Yacoot, A. and Hortv{\'i}k, V. and Duchoň, V. and Dongmo, H. and Rerucha, S. and Valtr, M. and Nečas, D.}
}

@Article { ZhuKPRLP2020,
   subid = {1480},
   title = {Combining Harmonic Laser Beams by Fiber Components for Refractivity–Compensating Two-Color Interferometry},
   journal = {Journal of Lightwave Technology},
   year = {2020},
   month = {4},
   volume = {38},
   number = {7},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   pages = {1945-1952},
   keywords = {Beam properties, photonics crystal fiber (PCF), two–color interferometry, wavelength division multiplexing (WDM)},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0733-8724, 1558-2213},
   DOI = {10.1109/JLT.2019.2960473},
   stag_bib_extends_levelofaccess = {NA},
   author = {Liu, Y. and Rose, A. and Prellinger, G. and K{\"o}chert, P. and Zhu, J. and Pollinger, F.}
}

@Miscellaneous { RibeiroCSM,
   subid = {1485},
   title = {EMUE-D4-5-Thermal Comfort},
   year = {2020},
   month = {3},
   day = {30},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Measurement uncertainty; Thermal comfort; Implicit model formulation; Monte Carlo model},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.5281/zenodo.3733403},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ribeiro, A.S. and Cox, M.G. and Sousa, J.A. and Martins, L.L.}
}

@Article { UbbelohdeHPWRGF2020,
   subid = {1470},
   title = {Trapping and Counting Ballistic Nonequilibrium Electrons},
   journal = {Physical Review Letters},
   year = {2020},
   month = {3},
   day = {27},
   volume = {124},
   number = {12},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {127701},
   keywords = {Ballistic transport, Electron relaxation, Semiconductor quantum optics, Full counting statistics},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society},
   language = {30},
   ISSN = {1079-7114},
   DOI = {10.1103/PhysRevLett.124.127701},
   stag_bib_extends_levelofaccess = {NA},
   author = {Freise, L. and Gerster, T. and Reifert, D. and Weimann, T. and Pierz, K. and Hohls, F. and Ubbelohde, N.}
}

@Article { RabagoFCFFQPCQS2020,
   subid = {2029},
   title = {Intercomparison of Indoor Radon Measurements Under Field Conditions In the Framework of MetroRADON European Project},
   journal = {International Journal of Environmental Research and Public Health},
   year = {2020},
   month = {3},
   volume = {17},
   number = {5},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {1780},
   keywords = {radon, proficiency test, quality assurance, metrology, interlaboratory comparison},
   web_url = {https://www.mdpi.com/1660-4601/17/5/1780},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1660-4601},
   DOI = {10.3390/ijerph17051780},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rabago, D. and Fuente, I. and Celaya, S. and Fernandez , A. and Fernandez, E. and Quindos, J. and Pol, R. and Cinelli, G. and Quindos, L. and Sainz, C.}
}

@Article { RussellPavierPPDYHK2020,
   subid = {1477},
   title = {Bringing real-time traceability to high-speed atomic force microscopy},
   journal = {Measurement Science and Technology},
   year = {2020},
   month = {3},
   number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology},
   keywords = {Metrology, high-speed atomic force microscopy, traceability, nanometrology, nanotechnology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/ab7ca9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Heaps, E. and Yacoot, A. and Dongmo, H. and Picco, L. and Payton, O.D. and Russell-Pavier, F.S and Klapetek, P}
}

@Article { TxoperenaRLFERAPCCCCHMZK2020,
   subid = {1505},
   title = {Towards standardisation of contact and contactless electrical measurements of CVD graphene at the macro-, micro- and nano-scale},
   journal = {Scientific Reports},
   year = {2020},
   month = {2},
   day = {21},
   volume = {10},
   number = {1},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   pages = {3223},
   keywords = {Characterization and analytical techniques,Electronic properties and devices,Imaging techniques,Materials science,Nanoscience and technology,Physics,Graphene},
   web_url = {https://www.nature.com/articles/s41598-020-59851-1},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-020-59851-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Melios, C. and Huang, N. and Callegaro, L. and Centeno, A. and Cultrera, A. and Cordon, A. and Panchal, V. and Arnedo, I. and Redo-Sanchez, A. and Etayo, D. and Fernandez, M. and Lopez, A. and Rozhko, S. and Txoperena, O. and Zurutuza, A. and Kazakova, O.}
}

@Techreport { WeberHSRDBMHKMENHSW2020,
   subid = {1431},
   title = {Document specifying rules for the secure use of DCC covering legal aspects of metrology},
   journal = {Zenodo},
   year = {2020},
   month = {2},
   day = {12},
   number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks},
   keywords = {digital calibration certificate (DCC) cryptography minimum requirements data communication IoT-communication IoT-networking SmartCom},
   web_url = {https://zenodo.org/record/3664211\#.XlO2QTFKhaR},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Zenodo},
   language = {30},
   DOI = {10.5281/zenodo.3664211},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weber, H. and Hutzschenreuter, D. and Smith, I. and Rhodes, S. and Dawkins, J. and Brown, C. and Maennel, O. and Hovhannisyan, K. and Kuosmanen, P. and Mustap{\"a}{\"a}, T. and Elo, T. and Nikander, P. and Heeren, W. and Sch{\"o}nhals, S. and Wiedenh{\"o}fer, Th.}
}

@Proceedings { ObatonKRMBACD2020,
   subid = {1759},
   title = {Reference standards for XCT measurements of additively manufactured parts },
   journal = {Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020},
   year = {2020},
   month = {2},
   number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry},
   pages = {152},
   keywords = {X-ray computed tomography (XCT), dimensional metrology, reference standards, additive manufacturing},
   web_url = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf},
   misc2 = {EMPIR 2017: Industry},
   event_place = {Wels, Austria},
   event_name = {10th Conference on Industrial Computed Tomography (iCT 2020)},
   event_date = {04-02-2020 to 07-02-2020},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf},
   author = {Obaton, A. and Klingaa, C.  and Rivet, C. and Mohaghegh, K. and Baier, S. and Andreasen, J. and Carli, L. and De Chiffre, L.}
}

@Article { BurnellLRvHBNSRMHBFZM2020,
   subid = {1425},
   title = {Diameter-independent skyrmion Hall angle observed in chiral magnetic multilayers},
   journal = {Nature Communications},
   year = {2020},
   month = {1},
   day = {22},
   volume = {11},
   number = {1},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   keywords = {skyrmion motion, spin-orbit torque},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-019-14232-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zeissler, K. and Finizio, S. and Barton, C. and Huxtable, A.J. and Massey, J. and Raabe, J. and Sadovnikov, A.V. and Nikitov, S.A. and Brearton, R. and Hesjedal, T. and van der Laan, G. and Rosamond, M.C. and Linfield, E.H. and Burnell, G. and Marrows, C.H.}
}

@Article { SarjonenRBSB2020,
   subid = {1391},
   title = {A Versatile Capacitive Sensing Platform for the Assessment of the Composition in Gas Mixtures},
   journal = {Micromachines},
   year = {2020},
   month = {1},
   day = {21},
   volume = {11},
   number = {2},
   number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel},
   pages = {116},
   keywords = {energy  transition;  gas  composition  sensor;  capacitive  sensor  array;  interdigitated  electrodes; responsive coatings; tunable filter infrared spectrometer; LNG; biogas},
   tags = {EnG},
   web_url = {https://www.mdpi.com/2072-666X/11/2/116/pdf},
   misc2 = {EMPIR 2016: Energy},
   publisher = {MDPI AG},
   address = {Postfach Basel CH-4005 Switzerland},
   language = {30},
   ISSN = {2072-666X},
   DOI = {10.3390/mi11020116},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sweelssen, J. and Blokland, H. and Rajamaki, T. and Sarjonen, R. and Boersma, A.}
}

@Article { FlierlRP2020_2,
   subid = {1564},
   title = {Gas weighing challenge},
   journal = {Analytical and Bioanalytical Chemistry},
   year = {2020},
   month = {1},
   volume = {412},
   number = {1},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   pages = {1-3},
   keywords = {buoyancy correction, gas weighing, gas mixing},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1618-2642, 1618-2650},
   DOI = {10.1007/s00216-019-02168-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Flierl, Lukas and Rienitz, Olaf and Pramann, Axel}
}

@Article { PierreRS2020,
   subid = {1246},
   title = {Experimental facility for the production of reference atmosphere of radioactive gases (Rn, Xe, Kr, and H isotopes)},
   journal = {Applied Radiation and Isotopes},
   year = {2020},
   month = {1},
   volume = {155},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {108934},
   keywords = {Calibration, Radioactive Gas, Metrology, Radon, Xenon, Tritium, Krypton},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2019.108934},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sabot, B. and Rodrigues, M. and Pierre, S.}
}

@Article { FlierlRBMS2020,
   subid = {1598},
   title = {Absolute isotope ratios of carbon dioxide – a feasibility study},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2020},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   keywords = {Gas Metrology, SI traceability, Carbon Dioxide refrence maerial},
   web_url = {https://pubs.rsc.org/is/content/articlelanding/2020/ja/d0ja00318b\#!divAbstract},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {0267-9477, 1364-5544},
   DOI = {10.1039/d0ja00318b},
   stag_bib_extends_levelofaccess = {NA},
   author = {Flierl, L. and Rienitz, O. and Brewer, P.J. and Meijer, H.A.J. and Steur, F.M.}
}

@Article { Roske2020,
   subid = {1789},
   title = {Linear regression analysis and the GUM: example of temperature influence on force transfer transducers},
   journal = {ACTA IMEKO},
   year = {2020},
   volume = {9},
   number = {5},
   number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services},
   keywords = {strain-gauge force, torque transducers, ambient temperature, high-precision force transfer transducers,  special temperature chambers},
   web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-83},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {ACTA IMEKO},
   language = {30},
   DOI = {10.21014/acta_imeko.v9i5.1010},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"o}ske, D.}
}

@Article { CaraMSGRCDHKBMZCLBF2020,
   subid = {1829},
   title = {Towards a traceable enhancement factor in surface-enhanced Raman spectroscopy},
   journal = {Journal of Materials Chemistry C},
   year = {2020},
   volume = {8},
   number = {46},
   number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality},
   pages = {16513-16519},
   keywords = {Raman spectroscopy (SERS)},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2050-7526, 2050-7534},
   DOI = {10.1039/D0TC04364H},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cara, E. and Mandrile, L. and Sacco, A. and Giovannozzi, A.M. and Rossi, A.M. and Celegato, F. and De Leo, N. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Marchi, D. and Zoccante, A. and Cossi, M. and Laus, M. and Boarino, L. and Ferrarese Lupi, F.}
}

@Article { GoenagaInfantePRdBAC2020,
   subid = {1417},
   title = {The accurate determination of number concentration of inorganic nanoparticles using spICP-MS with the dynamic mass flow approach},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2020},
   number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements},
   keywords = {nanoparticles, nanoparticle number concentration, spICP-MS, inorganic nanoparticles, Au nanoparticles, TiO2 nanoparticles},
   web_url = {https://pubs.rsc.org/en/content/articlepdf/2020/ja/c9ja00415g},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   DOI = {10.1039/c9ja00415g},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cuello-Nu{\~n}ez, S. and Abad-{\'A}lvaro, I. and Bartczak, D. and  del Castillo Busto, M.E. and Ramsay, D.A. and Pellegrino, F. and Goenaga-Infante, H.}
}

@Article { CuelloNunezABdRPG2020,
   subid = {1848},
   title = {The accurate determination of number concentration of inorganic nanoparticles using spICP-MS with the dynamic mass flow approach},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2020},
   volume = {35},
   number = {9},
   number2 = {18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration},
   pages = {1832-1839},
   keywords = {number concentration, spICP-MS, nanoparticle},
   misc2 = {EMPIR 2018: Support for Impact},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {0267-9477, 1364-5544},
   DOI = {10.1039/C9JA00415G},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cuello-Nu{\~n}ez, S. and Abad-{\'A}lvaro, I. and Bartczak, D. and Del Castillo Busto, M.E. and Ramsay, D.A. and Pellegrino, F. and Goenaga-Infante, H.}
}

@Article { ArrheniusFBAELR2020,
   subid = {1602},
   title = {Analytical methods for the determination of oil carryover from CNG/biomethane refueling stations recovered in a solvent},
   journal = {RSC Advances},
   year = {2020},
   volume = {10},
   number = {20},
   number2 = {16ENG05: Biomethane: Metrology for biomethane},
   pages = {11907-11917},
   keywords = {Biomethane oilcarryoveranaytical method},
   tags = {EnG},
   misc2 = {EMPIR 2016: Energy},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2046-2069},
   DOI = {10.1039/D0RA01399D},
   stag_bib_extends_levelofaccess = {NA},
   author = {Arrhenius, K. and Fischer, A. and B{\"u}ker, O. and Adrien, H. and El Masri, A. and Lestremau, F. and Robinson, T.}
}

@Article { RuhleH2020,
   subid = {1718},
   title = {Towards Automated Electron Microscopy Image Segmentation for Nanoparticles of Complex Shape by Convolutional Neural Networks},
   journal = {Microscopy and Microanalysis},
   year = {2020},
   volume = {26},
   number = {S2},
   number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements},
   pages = {1188},
   keywords = {nanoparticles, automation, particle size distribution, convolutional neural networks},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {Cambridge University Press},
   address = {Cambridge},
   language = {30},
   ISSN = {1435-8115},
   DOI = {10.1017/S1431927620017262},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"u}hle, B. and Hodoroaba, V-D.}
}

@Article { CalinALSSR2019,
   subid = {1770},
   title = {Education and training tradition at IFIN-HH in radon measurement and evaluation of radiological impact},
   journal = {Romanian Reports in Physics},
   year = {2019},
   month = {12},
   day = {20},
   volume = {71},
   number = {4},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {906},
   keywords = {Radon measurement, 222Rn standard system, Radon chamber, Indoor and outdoor radon, education and training, ANNETTE, EU project},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Editura Academiei Romane},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.rrp.infim.ro/2019/AN71906.pdf},
   author = {Calin, M.R. and Antohe, A. and Luca, A. and Stanescu, G. and Sahagia, M. and Radulescu, I.}
}

@Article { PottieAQCLRWKKG2019,
   subid = {1393},
   title = {Combining fiber Brillouin amplification with a repeater laser station for fiber-based optical frequency dissemination over 1400 km},
   journal = {New Journal of Physics},
   year = {2019},
   month = {12},
   day = {13},
   volume = {21},
   number = {.},
   number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {123017},
   keywords = {optical frequency dissemination},
   web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab5d95},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOPscience},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/ab5d95},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koke, S. and Kuhl, A. and Waterholter, T. and Raupach, S.M.F. and Lopez, O. and Cantin, E. and Quintin, N. and Amy-Klein, A. and Pottie, P.-E. and Grosche, G.}
}

@Article { KlenovskyCSRCLHR2019,
   subid = {1360},
   title = {Single-particle-picture breakdown in laterally weakly confining GaAs quantum dots},
   journal = {Physical Review B},
   year = {2019},
   month = {12},
   day = {13},
   volume = {100},
   number = {23},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {GaAs, quantum dot},
   web_url = {https://journals.aps.org/prb/pdf/10.1103/PhysRevB.100.235425},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/PhysRevB.100.235425},
   stag_bib_extends_levelofaccess = {NA},
   author = {Huber, D. and Lehner, B.U. and Csontosov{\'a}, D. and Reindl, M. and Schuler, S. and Covre Da Silva, S.F. and Klenovsk{\'y}, P. and Rastelli, A.}
}

@Article { LoseroRMASG2019,
   subid = {1573},
   title = {Quantum differential ghost microscopy},
   journal = {Physical Review A},
   year = {2019},
   month = {12},
   day = {10},
   volume = {100},
   number = {6},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {063818},
   keywords = {Quantum Optics, Ghost Imaging, Quantum Correlations},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.100.063818},
   stag_bib_extends_levelofaccess = {NA},
   author = {Losero, E. and Ruo-Berchera, I. and Meda, A. and Avella, A. and Sambataro, O. and Genovese, M.}
}

@Article { RodtHSSHKFSR2019,
   subid = {1359},
   title = {Deterministically fabricated spectrally-tunable quantum dot based single-photon source},
   journal = {Optical Materials Express},
   year = {2019},
   month = {12},
   day = {10},
   volume = {10},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {76},
   keywords = {quantum dot, single-photon source},
   web_url = {https://arxiv.org/ftp/arxiv/papers/1805/1805.10623.pdf},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {2159-3930},
   DOI = {10.1364/OME.10.000076},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schmidt, R. and Schmidt, M. and Helversen, M.V. and Fischbach, S. and Kaganskiy, A. and Schliwa, A. and Heindel, T. and Rodt, S. and Reitzenstein, S.}
}

@Article { JeneiPZTRTCSMD2019,
   subid = {1545},
   title = {Waiting time distributions in a two-level fluctuator coupled to a superconducting charge detector},
   journal = {Physical Review Research},
   year = {2019},
   month = {12},
   day = {10},
   volume = {1},
   number = {3},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Waiting time distributions in a two-level fluctuator coupled to a superconducting charge detector},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2643-1564},
   DOI = {10.1103/physrevresearch.1.033163},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jenei, M. and Potanina, E. and Zhao, R. and Tan, K.Y. and Rossi, A. and Tanttu, T. and Chan, K.W. and Sevriuk, V. and M{\"o}tt{\"o}nen, M. and Dzurak, A.}
}

@Article { RanitzschABBBEKKLMNPRW2019,
   subid = {1729},
   title = {MetroMMC: Electron-Capture Spectrometry with Cryogenic Calorimeters for Science and Technology},
   journal = {Journal of Low Temperature Physics},
   year = {2019},
   month = {12},
   volume = {199},
   number = {1-2},
   number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters},
   pages = {441-450},
   keywords = {Electron-capture decay, Metallic magnetic calorimeter, Radionuclide metrology},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0022-2291, 1573-7357},
   DOI = {10.1007/s10909-019-02278-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ranitzsch, P.C-O. and Arnold, D. and Beyer, J. and Bockhorn, L. and Bonaparte, J.J. and Enss, C. and Kossert, K. and Kempf, S. and Loidl, M. and Mariam, R. and N{\"a}hle, O. J. and Paulsen, M. and Rodrigues, M. and Wegner, M.}
}

@Article { GomezFGLDBMFMMGARPABCDH2019,
   subid = {1260},
   title = {Hydrogen fuel quality from two main production processes: Steam methane reforming and proton exchange membrane water electrolysis},
   journal = {Journal of Power Sources},
   year = {2019},
   month = {12},
   volume = {444},
   number2 = {15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications},
   pages = {227170},
   keywords = {Fuel cell electrical vehicles, ISO14687, Gas analysis, Hydrogen production, Hydrogen quality},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0378775319311632},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0378-7753},
   DOI = {10.1016/j.jpowsour.2019.227170},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bacquart, T. and Arrhenius, K. and Persijn, S. and Rojo, A. and Aupr{\^e}tre, F. and Gozlan, B. and Moore, N. and Morris, A. and Fischer, A. and Murugan, A. and Bartlett, S. and Doucet, G. and Laridant, F. and Gernot, E. and Fern{\'a}ndez, T. E. and G{\'o}mez, C. and Carr{\'e}, M. and De Reals, G. and Haloua, F.}
}

@Article { OrtolanoRP2019,
   subid = {1575},
   title = {Quantum enhanced imaging of nonuniform refractive profiles},
   journal = {International Journal of Quantum Information},
   year = {2019},
   month = {12},
   volume = {17},
   number = {08},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1941010},
   keywords = {Quantum imaging, non-classical correlations, gradient-index},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {World Scientific Pub Co Pte Lt},
   language = {30},
   ISSN = {0219-7499, 1793-6918},
   DOI = {10.1142/S0219749919410107},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ortolano, Giuseppe and Ruo-Berchera, Ivano and Predazzi, Enrico}
}

@Proceedings { KazemipourWHYRGHZ2019,
   subid = {1662},
   title = {Material Parameter Extraction in THz Domain, Simplifications and Sensitivity Analysis},
   journal = {2019 IEEE Asia-Pacific Microwave Conference (APMC)},
   year = {2019},
   month = {12},
   volume = {N/A},
   number = {N/A},
   number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies},
   pages = {276-278},
   keywords = {material characterization, extraction method, THz domain, sensitivity coefficient, measurement uncertainty},
   web_url = {https://doi.org/10.5281/zenodo.4243025},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IEEE},
   event_place = {Singapore},
   event_name = {019 IEEE Asia-Pacific Microwave Conference (APMC)},
   event_date = {10-12-2019 to 13-12-2019},
   language = {30},
   ISBN = {978-1-7281-3517-5},
   ISSN = {N/A},
   DOI = {10.1109/APMC46564.2019.9038523},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kazemipour, A. and Wollensack, M. and Hoffmann, J. and Yee, S-K. and R{\"u}fenacht, J. and G{\"a}umann, G. and Hudlicka, M. and Zeier, M.}
}

@Article { BenklerLPWRS2019,
   subid = {1661},
   title = {End-to-end topology for fiber comb based optical frequency transfer at the 10−21 level},
   journal = {Optics Express},
   year = {2019},
   month = {12},
   volume = {27},
   number = {25},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   pages = {36886},
   keywords = {optical frequency combs, stability transfer},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.27.036886},
   stag_bib_extends_levelofaccess = {NA},
   author = {Benkler, E. and Lipphardt, B. and Puppe, T. and Wilk, R. and Rohde, F. and Sterr, U.}
}

@Article { BockhornPBKLNRR2019,
   subid = {1355},
   title = {Improved Source/Absorber Preparation for Radionuclide Spectrometry Based on Low-Temperature Calorimetric Detectors},
   journal = {Journal of Low Temperature Physics},
   year = {2019},
   month = {11},
   day = {30},
   number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters},
   keywords = {Beta spectrometry, Preparation techniques, Low-temperature detectors},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0022-2291, 1573-7357},
   DOI = {10.1007/s10909-019-02274-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bockhorn, L. and Paulsen, M. and Beyer, J. and Kossert, K. and Loidl, M. and N{\"a}hle, O. J. and Ranitzsch, P. C.-O. and Rodrigues, M.}
}

@Article { RibeiroPBAM2019,
   subid = {1427},
   title = {Method selection to evaluate measurement uncertainty in microflow applications},
   journal = {Journal of Physics: Conference Series},
   year = {2019},
   month = {11},
   day = {29},
   volume = {1379},
   number2 = {18HLT08: MEDDII: Metrology for drug delivery},
   pages = {012033},
   keywords = {Uncertainty, microflow,  Monte Carlo method, Bayesian method},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1379/1/012033/pdf},
   misc2 = {EMPIR 2018: Health},
   publisher = {IOP science},
   language = {30},
   ISSN = {17426588},
   DOI = {10.1088/1742-6596/1379/1/012033},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sousa, J.A. and Batista, E. and Pellegrino, O. and Ribeiro, {\'A}. and Martins, L.}
}

@Article { GeislerNBHSRKWHTHMSU2019,
   subid = {1316},
   title = {Determining the Thickness and Completeness of the Shell of Polymer Core–Shell Nanoparticles by X-ray Photoelectron Spectroscopy, Secondary Ion Mass Spectrometry, and Transmission Scanning Electron Microscopy},
   journal = {The Journal of Physical Chemistry C},
   year = {2019},
   month = {11},
   day = {26},
   number2 = {17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses},
   keywords = {Nanoparticles, core-shell, XPS, SIMS, T-SEM, polymer},
   misc2 = {EMPIR 2017: Support for Impact},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {1932-7447, 1932-7455},
   DOI = {10.1021/acs.jpcc.9b09258},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\"u}ller, A. and Heinrich, T. and Tougaard, S. and Werner, W. S. M. and Hronek, M. and Kunz, V. and Radnik, J. and Stockmann, J. M. and Hodoroaba, V-D. and Benemann, S. and Nirmalananthan-Budau, N. and Gei{\ss}ler, D. and Sparnacci, K. and Unger, W. E. S }
}

@Article { KashcheyevsFBJLSGFRK2019,
   subid = {1312},
   title = {Continuous-variable tomography of solitary electrons},
   journal = {Nature Communications},
   year = {2019},
   month = {11},
   day = {22},
   volume = {10},
   number = {1},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   keywords = {Single electron, Electron wave packet, Tomography},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-019-13222-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fletcher, J. D. and Johnson, N. and Locane, E. and See, P. and Griffiths, J. P. and Farrer, I. and Ritchie, D. A. and Brouwer, P. W. and Kashcheyevs, V. and Kataoka, M.}
}

@Article { BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019,
   subid = {2340},
   title = {The Metrological Traceability, Performance and Precision of European Radon Calibration Facilities},
   journal = {International Journal of Environmental Research and Public Health},
   year = {2019},
   month = {11},
   day = {21},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   keywords = {radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability},
   misc2 = {EMPIR 2016: Environment},
   language = {30},
   DOI = {10.3390/ijerph182212150},
   stag_bib_extends_levelofaccess = {NA},
   author = {Beck, T.R. and Antohe, A. and Cardellini, F. and Cucoş, A. and Fialova, E. and Grossi, C. and Hening, K. and Jensen, J. and Kastratović, D. and Krivoš{\'i}k, M. and Lobner, P. and Luca, A. and Maringer, F.J. and Michielsen, N. and Otahal, P.P.S. and Quindos, L. and Rabago, D. and Sainz, C. and Sz{\"u}cs, L. and Teodorescu, T. and Tolinsson, C. and Tugulan, C.L. and Turtiainen, T. and Vargas, A. and Vosahlik, J. and Vukoslavovic, G. and Wiedner, H. and Wołoszczuk, K.}
}

@Article { SchneiderHHCFKRSTR2019,
   subid = {1362},
   title = {Resolving the temporal evolution of line broadening in single quantum emitters},
   journal = {Optics Express},
   year = {2019},
   month = {11},
   day = {18},
   volume = {27},
   number = {24},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {35290},
   keywords = {single quantum emitter, GaAs and In(Ga)As quantum dots},
   web_url = {https://www.osapublishing.org/DirectPDFAccess/0872F4C8-F64C-1DD3-BF83A9359A9A78C7_423274/oe-27-24-35290.pdf?da=1\&id=423274\&seq=0\&mobile=no},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.27.035290},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schimpf, C. and Reindl, M. and Klenovsk{\'y}, P. and Fromherz, T. and Covre Da Silva, S.F. and Hofer, J. and Schneider, C. and H{\"o}fling, S. and Trotta, R. and Rastelli, A.}
}

@Article { RanitzschPNMKKEBBLRS2019,
   subid = {1234},
   title = {Beta spectrometry with metallic magnetic calorimeters in the framework of the European EMPIR project MetroBeta},
   journal = {Applied Radiation and Isotopes},
   year = {2019},
   month = {11},
   volume = {153},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {108830},
   keywords = {Beta spectrometry; Metallic magnetic calorimeter; Ionizing radiation metrology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2019.108830},
   stag_bib_extends_levelofaccess = {NA},
   author = {Loidl, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Mariam, R. and N{\"a}hle, O. and Paulsen, M. and Ranitzsch, P. and Rodrigues, M. and Schmidt, M.}
}

@Article { GuarnizoMRFS2019,
   subid = {1272},
   title = {Validation of Emission Spectroscopy Gas Temperature Measurements Using a Standard Flame Traceable to the International Temperature Scale of 1990 (ITS-90)},
   journal = {International Journal of Thermophysics},
   year = {2019},
   month = {11},
   volume = {40},
   number = {11},
   number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2},
   pages = {99},
   keywords = {Combustion, Emission spectroscopy, ITS-90, Rayleigh scattering, Standard Temperature},
   web_url = {https://link.springer.com/content/pdf/10.1007\%2Fs10765-019-2557-6.pdf},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-019-2557-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sutton, G. and Fateev, A. and Rodr{\'i}guez-Conejo, M.A. and Mel{\'e}ndez, J. and Guarnizo, G.}
}

@Thesis { Rosner2019,
   subid = {1368},
   title = {Production and preparation of highly charged ions for re-trapping in ultra-cold environments,Master Thesis, Ruprecht-Karls-Universitat, Heidelberg (2019)},
   year = {2019},
   month = {11},
   number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks},
   keywords = {Optical ClockTrapped Ions},
   web_url = {https://pure.mpg.de/rest/items/item_3182118_1/component/file_3182119/content},
   misc2 = {EMPIR 2017: Fundamental},
   school = {Ruprecht-Karls-Universit{\"a}t, Heidelberg},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/21.11116/0000-0005-5B37-8},
   author = {Rosner, M.K.}
}

@Article { RibeiroPBSM2019,
   subid = {1419},
   title = {Method selection to evaluate measurement uncertainty in microflow applications},
   journal = {Journal of Physics: Conference Series},
   year = {2019},
   month = {11},
   volume = {1379},
   number = {2019},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   pages = {012033},
   keywords = {microflow, medicine, neonatology, oncology, measurement uncertainty, GUM, Monte Carlo},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1379/1/012033},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sousa, J.A. and Batista, E. and Pellegrino, O. and Ribeiro, A.S. and Martins, L.L.}
}

@Manual { EloKnKALSZSFRBSHWHHHNHMMHP2019,
   subid = {1433},
   title = {SmartCom Digital System of Units (D-SI) Guide for the use of the metadata-format used in metrology for the easy-to-use, safe, harmonised and unambiguous digital transfer of metrological data},
   year = {2019},
   month = {11},
   number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks},
   keywords = {Digital-SI (D-SI) metrology data digital exchange format SmartCom data communication IoT-networking IoT-communication},
   web_url = {https://zenodo.org/record/3522631\#.XlTbaTFKhaQ},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Zenodo},
   language = {30},
   DOI = {10.5281/zenodo.3522631},
   stag_bib_extends_levelofaccess = {NA},
   author = {Elo, T. and Kuosmanen, P. and  Mustap{\"a}{\"a}, T. and Klobucar, R. and Acko, B. and Linkeov{\'a}, I. and S{\'y}kora, J. and Zelen{\'y}, V. and Smith, I. and Forbes, A. and Rhodes, S. and Brown, C. and Scheibner, A. and Hackel, S.G. and Wiedenh{\"o}fer, T. and Heeren, W. and Haertig, F. and Hutschenreuter, D. and Nikander, P. and Hovhannisyan, K. and Maennel, O. and Muller, B. and Heindorf, L. and Paciello, V.}
}

@Article { BinghamWSTMFZSRKH2019,
   subid = {1353},
   title = {Formation of N{\'e}el-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy},
   journal = {Physical Review B},
   year = {2019},
   month = {10},
   day = {25},
   volume = {100},
   number = {14},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {144435},
   keywords = {Skyrmions, DMI, spin waves},
   web_url = {https://arxiv.org/abs/1910.04515},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9950, 2469-9969},
   DOI = {10.1103/PhysRevB.100.144435},
   stag_bib_extends_levelofaccess = {NA},
   author = {Saha, S. and Zelent, M. and Finizio, S. and Mruczkiewicz, M. and Tacchi, S. and Suszka, A. K. and Wintz, S. and Bingham, N. S. and Raabe, J. and Krawczyk, M. and Heyderman, L. J.}
}

@Article { CalonicoLRBBP2019,
   subid = {1443},
   title = {Absolute frequency measurement of the1S0 –3P0 transition of171Yb with a link to International Atomic Time},
   journal = {Metrologia},
   year = {2019},
   month = {10},
   day = {24},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   keywords = {optical lattice clock, SI second, frequency metrology},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab50e8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pizzocaro, M. and Bregolin, F. and Barbieri, P. and Rauf, . and Levi, F. and Calonico, D.}
}

@Article { PfleidererRRLBAPWB2019,
   subid = {1313},
   title = {Ferromagnetic Resonance with Magnetic Phase Selectivity by Means of Resonant Elastic X-Ray Scattering on a Chiral Magnet},
   journal = {Physical Review Letters},
   year = {2019},
   month = {10},
   day = {14},
   volume = {123},
   number = {16},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   keywords = {Skyrmions, X-ray scattering, Ferromagnetic resonance},
   web_url = {https://arxiv.org/abs/1909.08293},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.123.167201},
   stag_bib_extends_levelofaccess = {NA},
   author = {P{\"o}llath, S. and Aqeel, A. and Bauer, A. and Luo, C. and Ryll, H. and Radu, F. and Pfleiderer, C. and Woltersdorf, G. and Back, C. H.}
}

@Proceedings { HoogenboomHRY2019,
   subid = {1301},
   title = {Reliable Power Transformer Efficiency Tests},
   journal = {Proceedings 5th International Colloquium “Transformer Research and Asset Management” Opatija/Croatia, October 09 – 12, 2019},
   year = {2019},
   month = {10},
   day = {11},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {power transformers, efficiency, loss, loss measurement, reliability, calibration, accuracy, uncertainty},
   tags = {SEG},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   event_place = {Opatija, Croatia},
   event_name = {5th International Colloquium “Transformer Research and Asset Management” Opatija/Croatia},
   event_date = {09-10-2019 to 12-10-2019},
   language = {30},
   DOI = {10.5281/zenodo.3559845},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hoogenboom, D. and Houtzager, E. and Rietveld, G. and Ye, G.}
}

@Article { LaihoSSKHSBWR2019,
   subid = {2617},
   title = {Photon-number parity of heralded single photons from a Bragg-reflection waveguide reconstructed loss-tolerantly via moment generating function},
   journal = {New Journal of Physics},
   year = {2019},
   month = {10},
   volume = {21},
   number = {10},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {103025},
   keywords = {factorial moment of photon number, photon-number parity, moment generating function, parametric down-conversion, Bragg-reflection waveguide, transition-edge sensor},
   web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab42ae},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/ab42ae},
   stag_bib_extends_levelofaccess = {NA},
   author = {Laiho, K. and Schmidt, M. and Suchomel, H. and Kamp, M. and H{\"o}fling, S. and Schneider, C. and Beyer, J. and Weihs, G. and Reitzenstein, S.}
}

@Proceedings { FortuneCRSPA2019,
   subid = {1198},
   title = {STUDY OF NONINVASIVE INSTRUMENTS FOR THE MEASUREMENT OF X-RAY HIGH VOLTAGE TUBE},
   journal = {Proceedings of CIM 2019},
   year = {2019},
   month = {9},
   day = {24},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Pulsed X-ray tube, KVp meters, Metrology, Dose.},
   web_url = {https://www.cim2019.com},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Paris, France},
   event_name = {The 19st Congr{\`e}s Internationla de M{\'e}trologie},
   event_date = {24-09-2019 to 26-09-2019},
   language = {30},
   DOI = {10.1051/metrology/201902002},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {10.5281/zenodo.3335340},
   author = {Agazar, M. and Perrillat, D. and Saadeddine, H. and Robert, C. and Casteignau, L. and Fortune, D.}
}

@Article { BurgerHSGSR2019,
   subid = {1291},
   title = {Benchmarking Five Global Optimization Approaches for Nano-optical Shape Optimization and Parameter Reconstruction},
   journal = {ACS Photonics},
   year = {2019},
   month = {9},
   day = {17},
   volume = {6},
   number = {11},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {2726-2733},
   keywords = {shape optimization, parameter reconstruction, machine learning, global optimization, Bayesian optimization},
   web_url = {https://arxiv.org/abs/1809.06674},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {ACS},
   language = {30},
   ISSN = {2330-4022, 2330-4022},
   DOI = {10.1021/acsphotonics.9b00706},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schneider, P.I. and Garcia Santiago, X. and Soltwisch, Vi. and Hammerschmidt, M. and Burger, S. and Rockstuhl, C.}
}

@Article { MayrBWHFMRWZ2019,
   subid = {1370},
   title = {Deterministic Field-Free Skyrmion Nucleation at a Nanoengineered Injector Device},
   journal = {Nano Letters},
   year = {2019},
   month = {9},
   day = {17},
   volume = {19},
   number = {10},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {7246-7255},
   keywords = {Skyrmion; nanomagnetism, spin-orbit torque},
   web_url = {https://arxiv.org/abs/1902.10435},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Chemical Society (ACS)},
   address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Contract \#: 19-0000016470-01 PO \#: 6000110532 Columbus Ohio 43210 United States},
   language = {30},
   ISSN = {1530-6984, 1530-6992},
   DOI = {10.1021/acs.nanolett.9b02840},
   stag_bib_extends_levelofaccess = {NA},
   author = {Finizio, S. and Zeissler, K. and Wintz, S. and Mayr, S. and We{\ss}els, T. and Huxtable, A.J. and Burnell, G. and Marrows, C.H. and Raabe, J.}
}

@Article { BremerFPRSHW2019,
   subid = {1804},
   title = {Cesium‐Vapor‐Based Delay of Single Photons Emitted by Deterministically Fabricated Quantum Dot Microlenses},
   journal = {Advanced Quantum Technologies},
   year = {2019},
   month = {9},
   day = {12},
   volume = {3},
   number = {2},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {1900071},
   keywords = {atomic vapors delays deterministic fabrication quantum dots single‐photon sources},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Wiley},
   language = {30},
   ISSN = {2511-9044, 2511-9044},
   DOI = {10.1002/qute.201900071},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bremer, L. and Fischbach, S. and Park, S‐I. and Rodt, S. and Song, J‐Dong. and Heindel, T. and Weber, N.}
}

@Article { KokHvvR2019,
   subid = {1380},
   title = {Current waveforms of household appliances for advanced meter testing},
   journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {Electromagnetic compatibility , static meters , interference , accuracy , testing , household appliances},
   tags = {SEG},
   web_url = {https://zenodo.org/record/3582391\#.XiG1P3u7KUl},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/AMPS.2019.8897771},
   stag_bib_extends_levelofaccess = {NA},
   author = {van Leeuwen, R. and van den Brom, H. and Hoogenboom, D. and Kok, G. and Rietveld, G.}
}

@Article { RietveldKvWB2019,
   subid = {1377},
   title = {Detection Methods for Current Signals Causing Errors in Static Electricity Meters},
   journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {Power Quality  Electricity Meters  Short Time Fourier Transform  Wavelet Transform  Multiresolution Signal Decomposition  Wavelets  Smart Meters},
   web_url = {https://zenodo.org/record/3582153\#.XiGzUXu7KUm},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/EMCEurope.2019.8872120},
   stag_bib_extends_levelofaccess = {NA},
   author = {Barakou, F. and Wright, P.S. and van den Brom, H.E. and Kok, G.J.P and Rietveld, G.}
}

@Article { vanLeeuwenHMvR2019,
   subid = {1378},
   title = {A Testbed for Static Electricity Meter Testing with Conducted EMI},
   journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {Static meters, energy measurement, standards, Electromagnetic Compatibility, EMC immunity testing, electricity meters.},
   tags = {SEG},
   web_url = {https://zenodo.org/record/3580444\#.XiG0OHu7KUk},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/EMCEurope.2019.8872130},
   stag_bib_extends_levelofaccess = {NA},
   author = {van den Brom, H.E. and Marais, Z. and Hoogenboom, D. and van Leeuwen, R. and Rietveld, G.}
}

@Article { HoogenboomvRvMR2019,
   subid = {1379},
   title = {Sensitivity of static energy meter reading errors to changes in non-sinusoidal load conditions},
   journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE},
   year = {2019},
   month = {9},
   volume = {Not Applic},
   number = {Not Applic},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   pages = {6},
   keywords = {static energy meter; metering error; electromagnetic interference; accuracy; impedance; phase firing angle.},
   tags = {SEG},
   web_url = {https://zenodo.org/record/3580436\#.XiG00Xu7KUl},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/EMCEurope.2019.8872006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marais, Z. and van den Brom, H.E. and Rietveld, G. and van Leeuwen, R. and Hoogenboom, D. and Rens, J.}
}

@Article { ReitzensteinSZBRDDDMWPOMKSSGSMoU2019,
   subid = {1363},
   title = {Method for direct coupling of a semiconductor quantum dot to an optical fiber for single-photon source applications},
   journal = {Optics Express},
   year = {2019},
   month = {9},
   volume = {27},
   number = {19},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {26772},
   keywords = {semiconductor quantum dot, single-photon source},
   web_url = {https://www.osapublishing.org/DirectPDFAccess/08FE2392-996C-94FE-814D27FFE5E6D46E_418606/oe-27-19-26772.pdf?da=1\&id=418606\&seq=0\&mobile=no},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.27.026772},
   stag_bib_extends_levelofaccess = {NA},
   author = {Żołnacz, K. and Musiał, A. and Srocka, N. and Gro{\ss}e, J. and Schl{\"o}singer, M.J. and Schneider, P-I. and Kravets, O. and Mikulicz, M. and Olszewski, J. and Poturaj, K. and W{\'o}jcik, G. and Mergo, P. and Dybka, K. and Dyrkacz, M. and Dłubek, M. and Rodt, S. and Burger, S. and Zschiedrich, L. and Sęk, G. and Reitzenstein, S. and Urbańczyk, W.}
}

@Proceedings { LuisoRBCM2019,
   subid = {1295},
   title = {Setup and Characterisation of Reference Current-to-Voltage Transformers for Wideband Current Transformers Calibration up to 2 kA},
   journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2019},
   month = {9},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {64-69},
   keywords = {wideband, current transformers, calibration, measurement uncertainty, instrument transformers, power quality},
   tags = {SEG},
   web_url = {https://doi.org/10.1109/AMPS.2019.8897759},
   misc2 = {EMPIR 2017: Industry},
   publisher = {IEEE},
   event_place = {Aachen, Germany},
   event_name = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems},
   event_date = {25-09-2019 to 27-09-2019},
   language = {30},
   ISBN = {978-1-7281-0075-3, 978-1-7281-},
   ISSN = {2475-2304, 2473-1315},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.1109/AMPS.2019.8897759},
   author = {Luiso, M. and Rather, P. and Badura, H. and Chen, Y. and Mohns, E.}
}

@Proceedings { NeubergerRSW2019,
   subid = {1502},
   title = {LED-Based Differential Spectral Responsivity Measurements of PV Modules},
   journal = {https://www.eupvsec-proceedings.com/proceedings},
   year = {2019},
   month = {9},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   keywords = {Spectral Response, LED, PV Modules, Solar Simulator, DSR},
   misc2 = {EMPIR 2016: Energy},
   event_place = {Marseille, France},
   event_name = {36th European Photovoltaic Solar Energy Conference and Exhibitio},
   event_date = {09-09-2019 to 13-09-2019},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/3784708},
   author = {Neuberger, F. and Riechelmann, S. and Straeter, H. and Winter, S.}
}

@Proceedings { Riechelmann2019,
   subid = {1503},
   title = {Characterizing the Angular Distribution of an LED-Based Solar Simulator for PV Modules},
   journal = {https://www.eupvsec-proceedings.com/proceedings},
   year = {2019},
   month = {9},
   number2 = {16ENG02: PV-Enerate: Advanced PV energy rating},
   keywords = {characterization, calibration, solar simulator},
   misc2 = {EMPIR 2016: Energy},
   event_place = {Marseille, France},
   event_name = {EUPVSEC 2019},
   event_date = {09-09-2019 to 13-09-2019},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/3784748},
   author = {Riechelmann, S.}
}

@Article { KellmanMRSBXORNIRMGNPC2019,
   subid = {1474},
   title = {Simultaneous 13N-Ammonia and gadolinium first-pass myocardial perfusion with quantitative hybrid PET-MR imaging: a phantom and clinical feasibility study},
   journal = {European Journal of Hybrid Imaging},
   year = {2019},
   month = {9},
   volume = {3},
   number = {1},
   number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion},
   keywords = {myocardial perfusion, hybrid PET-MR},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2510-3636},
   DOI = {10.1186/s41824-019-0062-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nazir, M.S. and Gould, S-M. and Milidonis, X. and Reyes, E. and Ismail, T.F. and Neji, R. and Roujol, S. and O’Doherty, J. and Xue, H. and Barrington, S.F. and Schaeffter, T. and Razavi, R. and Marsden, P. and Kellman, P. and Plein, S. and Chiribiri, A.}
}

@Proceedings { SauzayRJBBWS2019,
   subid = {1302},
   title = {Estimating Uncertainty in Loss Measurement of Power Transformers},
   journal = {Proceedings of the 21st International Symposium on High Voltage Engineering},
   year = {2019},
   month = {8},
   day = {30},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {power transformers, losses, measurement, uncertainty.},
   tags = {SEG},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   event_place = {Budapest},
   event_name = {21st International Symposium on High Voltage Engineering},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3559837},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sauzay, M. and Rietveld, G. and J{\"o}nsson, B. and Bergman, A. and Bergman, A. and Walmsley, J. and Sund, J-B.}
}

@Proceedings { RoviraGSFA2019,
   subid = {1197},
   title = {Characterisation of high voltage dividers for X-ray measurements},
   journal = {Proceedings of IHS2019},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {High Voltage, Pulsed X-ray tube , Divider, Metrology},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary,},
   event_name = {The 21st International Symposium on High Voltage Engineering (ISH2019)},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3243494},
   author = {Rovira, J. and Garnacho, F. and Saadeddine, H. and Fortune, D. and Agazar, M.}
}

@Proceedings { KaramanDMEBHHRGG2019,
   subid = {1186},
   title = {Comparison of PD calibration capabilities in four National Metrology Institutes down to 0.1 pC},
   journal = {Proceedings of ISH2019},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {partial discharge, calibration},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary},
   event_name = {21st International Symposium on High Voltage Engineering},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3243449},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Bergman, A.E. and Elg, A-P. and Merev, A. and Dedeoğlu, S. and Karaman, I. and Rovira, J. and Garcia, T. and Garnacho, F.}
}

@Proceedings { NieminenHRGGE2019,
   subid = {1212},
   title = {Traceable measurement of transmitted overvoltages in instrument transformers},
   journal = {Proceedings of ISH2019},
   year = {2019},
   month = {8},
   day = {26},
   number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients},
   keywords = {Voltage instrument transformers, Transient overoltages, traceability},
   tags = {SEG},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   event_place = {Budapest, Hungary},
   event_name = {21st International Symposium on High Voltage Engineering (ISH2019)},
   event_date = {26-08-2019 to 30-08-2019},
   language = {30},
   DOI = {10.5281/zenodo.3244088},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nieminen, T. and H{\"a}llstr{\"o}m, J. and Rovira, J. and Garcia, T. and Garnacho, F. and Elg, A-P.}
}

@Inbook { RuttingerPGCPSKBJSBSWWS2019,
   subid = {1193},
   title = {European Research on Magnetic Nanoparticles for Biomedical Applications: Standardisation Aspects},
   year = {2019},
   month = {8},
   day = {23},
   volume = {Advances i},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {316-326},
   keywords = {magnetic nanoparticles, standardisation European research},
   web_url = {https://arxiv.org/abs/1905.08791},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer International Publishing},
   address = {Cham},
   booktitle = {Current Trends in Biomedical Engineering and Bioimages Analysis. PCBEE 2019.},
   language = {30},
   ISBN = {978-3-030-29884-5},
   DOI = {10.1007/978-3-030-29885-2_29},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schier, Peter and Barton, Craig and Spassov, Simo and Johansson, Christer and Baumgarten, Daniel and Kazakova, Olga and Southern, Paul and Pankhurst, Quentin and Coisson, Marco and Gr{\"u}ttner, Cordula and Price, Alex and R{\"u}ttinger, Roman and Wiekhorst, Frank and Wells, James and Steinhoff, Uwe}
}

@Article { FuenteSMDGQPR2019,
   subid = {1290},
   title = {Testing and Calibration of CDs as Radon Detectors at Highly Variable Radon Concentrations and Temperatures},
   journal = {International Journal of Environmental Research and Public Health},
   year = {2019},
   month = {8},
   day = {22},
   volume = {16},
   number = {17},
   number2 = {16ENV10: MetroRADON: Metrology for radon monitoring},
   pages = {3038},
   keywords = {radon; CD-method; blind comparison; extremely variable concentrations; unstabletemperature},
   web_url = {https://www.mdpi.com/1660-4601/16/17/3038/htm},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1660-4601},
   DOI = {10.3390/ijerph16173038},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pressyanov, D. and Quindos Poncela, L.S. and Georgiev, S. and Dimitrova, I. and Mitev, K. and Sainz, C. and Fuente, I. and Rabago, D.}
}

@Proceedings { VentreMDBCFPPRSTBASSGHBZFDKL2019,
   subid = {1200},
   title = {Metrology for Inductive Charging of Electric Vehicles (MICEV)},
   journal = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)},
   year = {2019},
   month = {8},
   day = {19},
   volume = {Electrical},
   number = {2019 AEIT},
   number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles},
   pages = {6 pages},
   keywords = {Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety},
   tags = {SEG},
   web_url = {http://arxiv.org/abs/1908.11108},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   event_place = {Turin (Italy)},
   event_name = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)},
   event_date = {02-07-2019 to 04-07-2019},
   language = {30},
   ISBN = {978-8-8872-3743-6},
   ISSN = {0018-9219},
   DOI = {10.23919/EETA.2019.8804498},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zucca, M. and Bottauscio, O. and Harmon, S. and Guilizzoni, R. and Schilling, F. and Schmidt, M. and Ankarson, P. and Bergsten, T. and Tammi, K. and Sainio, P. and Romero, J.B. and Puyal, E.L. and Pichon, L. and Freschi, F. and Cirimele, V. and Bauer, P. and Dong, J. and Maffucci, A. and Ventre, S. and Femia, N. and Di Capua, G. and Kuster, N. and Liorni, I.}
}

@Manual { WattsRKP2009,
   subid = {1199},
   title = {Good Practice Guide on Making Rectangular Waveguide Connections at Frequencies above 100 GHz},
   year = {2019},
   month = {8},
   day = {9},
   number2 = {17SIP08: NeWITT: New Waveguide Interfaces for Terahertz Technologies},
   keywords = {INSPEC B1310 Waveguides and microwave transmission lines, INSPEC B1320 Waveguide and microwave transmission line components, INSPEC B2180E Connectors, INSPEC B5210C Radiowave propagation,INSPEC B7130 Measurement standards and calibration},
   misc2 = {EMPIR 2017: Support for Impact},
   publisher = {Physikalisch-Technische Bundesanstalt (PTB)},
   address = {Braunschweig},
   language = {30},
   DOI = {10.7795/530.20190805},
   stag_bib_extends_levelofaccess = {NA},
   author = {Watts, J. and Ridler, N. and Kuhlmann, K. and Probst, T.}
}

@Article { ColemanERGS2019,
   subid = {1191},
   title = {Uncertainty requirements of the European Union’s Industrial Emissions Directive for monitoring sulfur dioxide emissions: Implications from a blind comparison of sulfate measurements by accredited laboratories},
   journal = {Journal of the Air \& Waste Management Association},
   year = {2019},
   month = {8},
   volume = {69},
   number = {9},
   number2 = {15NRM01: Sulf-Norm: Metrology for sampling and conditioning SO2 emissions from stacks},
   pages = {1070-1078},
   keywords = {Uncertainty requirements, European Union’s Industrial Emissions Directive, monitoring sulfur dioxide emissions},
   web_url = {https://doi.org/10.1080/10962247.2019.1604449},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {1096-2247, 2162-2906},
   DOI = {10.1080/10962247.2019.1604449},
   stag_bib_extends_levelofaccess = {NA},
   author = {Coleman, M.D. and Ellison, M. and Robinson, R.A. and Gardiner, T.D. and Smith, T.O.M.}
}

@Article { RunzEMDKK2019,
   subid = {1205},
   title = {Polymer gel-based measurements of the isocenter accuracy in an MR-LINAC},
   journal = {Journal of Physics: Conference Series},
   year = {2019},
   month = {8},
   volume = {1305},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {012007},
   keywords = {MRgRT, dosimetry},
   web_url = {https://doi.org/10.1088/1742-6596/1305/1/012007},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1305/1/012007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dorsch, S. and Mann, P. and Elter, A. and Runz, A. and Kl{\"u}ter, S. and Karger, C.P.}
}

@Article { NahleMLKKEBBPRR2019,
   subid = {1235},
   title = {Development of a beta spectrometry setup using metallic magnetic calorimeters},
   journal = {Journal of Instrumentation},
   year = {2019},
   month = {8},
   volume = {14},
   number = {08},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {P08012-P08012},
   keywords = {Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/14/08/P08012},
   stag_bib_extends_levelofaccess = {NA},
   author = {Paulsen, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Loidl, M. and Mariam, R. and N{\"a}hle, O. and Ranitzsch, P. and Rodrigues, M.}
}

@Article { NahleMLKKEBBPRR20190,
   subid = {1235},
   title = {Development of a beta spectrometry setup using metallic magnetic calorimeters},
   journal = {Journal of Instrumentation},
   year = {2019},
   month = {8},
   volume = {14},
   number = {08},
   number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters},
   pages = {P08012-P08012},
   keywords = {Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/14/08/P08012},
   stag_bib_extends_levelofaccess = {NA},
   author = {Paulsen, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Loidl, M. and Mariam, R. and N{\"a}hle, O. and Ranitzsch, P. and Rodrigues, M.}
}

@Article { GennserCPBBMCKCRMBJDH2019,
   subid = {1311},
   title = {Quantum tomography of electrical currents},
   journal = {Nature Communications},
   year = {2019},
   month = {7},
   day = {29},
   volume = {10},
   number = {1},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   keywords = {Electronic wavefunction, Quantum tomography},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-019-11369-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bisognin, R. and Marguerite, A. and Roussel, B. and Kumar, M. and Cabart, C. and Chapdelaine, C. and Mohammad-Djafari, A. and Berroir, J.-M. and Bocquillon, E. and Pla\c{c}ais, B. and Cavanna, A. and Gennser, U. and Jin, Y. and Degiovanni, P. and F{\`e}ve, G.}
}

@Article { OrtolanoARCETCZSCC2019,
   subid = {1227},
   title = {Mapping the conductivity of graphene with Electrical Resistance Tomography},
   journal = {Scientific Reports},
   year = {2019},
   month = {7},
   day = {23},
   volume = {9},
   number = {1},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   keywords = {graphene, electrical resistance tomography, conductivity, terahertz spectroscopy},
   web_url = {https://doi.org/10.1038/s41598-019-46713-8},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-46713-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cultrera, A. and Serazio, D. and Zurutuza, A. and Centeno, A. and Txoperena, O. and Etayo, D. and Cordon, A. and Redo-Sanchez, A. and Arnedo, I. and Ortolano, M. and Callegaro, L.}
}

@Article { SOCHOROVARLLKFDCCBBT2019,
   subid = {1285},
   title = {Activity measurements and determination of nuclear decay data of 166Ho in the MRTDosimetry project},
   journal = {Applied Radiation and Isotopes},
   year = {2019},
   month = {7},
   day = {20},
   volume = {153},
   number = {November 2},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   pages = {1-11},
   keywords = {Ho166, Activity standardization, gamma-spectrometry, Half-life measurements, Molecular radiotherapy, MRTDosimetry},
   misc2 = {EMPIR 2015: Health},
   publisher = {Elsevier},
   language = {30},
   DOI = {10.1016/j.apradiso.2019.108826},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bobin, C. and BOUCHARD, J. and CHISTE, V. and COLLINS, S. and Dry{\'a}k, P. and FENWICK, A. and Keightley, J. and L{\'e}py, M.C. and Lourenco, V. and Robinson, A. and Sochorov{\'a}, J. and THIAM, C.}
}

@Article { RedshawQPMIHGEDBSRY2019,
   subid = {1232},
   title = {Direct determination of the La138\(\beta\)-decay Q value using Penning trap mass spectrometry},
   journal = {Physical Review C},
   year = {2019},
   month = {7},
   day = {11},
   volume = {100},
   number = {1},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {014308},
   keywords = {138La, high-precision Q-values, mass spectrometry, Penning trap},
   web_url = {https://arxiv.org/abs/1904.12076v2},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9985, 2469-9993},
   DOI = {10.1103/PhysRevC.100.014308},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sandler, R. and Bollen, G. and Dissanayake, J. and Eibach, M. and Gulyuz, K. and Hamaker, A. and Izzo, C. and Mougeot, X. and Puentes, D. and Quarati, F. G. A. and Redshaw, M. and Ringle, R. and Yandow, I.}
}

@Article { StollWerianFRNKP2019,
   subid = {1563},
   title = {Absolute isotope ratios – Analytical solution for the determination of calibration factors for any number of isotopes and isotopologues},
   journal = {Spectrochimica Acta Part B: Atomic Spectroscopy},
   year = {2019},
   month = {7},
   volume = {157},
   number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards},
   pages = {76-83},
   keywords = {Mass bias correction, Absolute isotope ratio, SI traceability, Metrology, Isotopic composition},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0584-8547},
   DOI = {10.1016/j.sab.2019.04.008},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stoll-Werian, Anne and Flierl, Lukas and Rienitz, Olaf and Noordmann, Janine and Kessel, R{\"u}diger and Pramann, Axel}
}

@Article { IacomussiVR2019,
   subid = {1277},
   title = {Innovative Design And Metrological Approaches To Smart Lighting},
   journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE},
   year = {2019},
   month = {6},
   day = {24},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   keywords = {Smart lighting, Road lighting, ILMD detector, Pedestrian safety, Systemic Design, Design by Components, Design Network, SURFACE, EMPIR},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {International Commission on Illumination, CIE},
   language = {30},
   DOI = {10.25039/x46.2019.PO192},
   stag_bib_extends_levelofaccess = {NA},
   author = {Valpreda, Fab. and Iacomussi, P. and Rossi, G.}
}

@Article { RossiI2019,
   subid = {1276},
   title = {Influence Of Material Characterization In The Design Of Tunnel Lighting Installations},
   journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE},
   year = {2019},
   month = {6},
   day = {24},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   keywords = {Road tunnel lighting, energy savings, SURFACE, EMPIR, luminance coefficient, r- tables.},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {International Commission on Illumination, CIE},
   language = {30},
   DOI = {10.25039/x46.2019.OP74},
   stag_bib_extends_levelofaccess = {NA},
   author = {Iacomussi, P. and Rossi, G.}
}

@Article { IacomussiR2019,
   subid = {1279},
   title = {The Veiling Luminance In Tunnel Lighting Installation},
   journal = {PROCEEDINGS OF the 29th Quadrennial Session of the CIE},
   year = {2019},
   month = {6},
   day = {24},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   keywords = {Tunnel, lighting, 16NRM02},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {International Commission on Illumination, CIE},
   address = {Babenbergerstrasse 9/9A Vienna 1010 Austria},
   language = {30},
   DOI = {10.25039/x46.2019.PP28},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rossi, G. and Iacomussi, P.}
}

@Article { HibberdMOCORMOPVHC2019,
   subid = {1159},
   title = {Integrating informatics tools and portable sequencing technology for rapid detection of resistance to anti-tuberculous drugs},
   journal = {Genome Medicine},
   year = {2019},
   month = {6},
   day = {24},
   volume = {11},
   number = {1},
   number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance},
   pages = {41},
   keywords = {whole genome sequencing, drug resistance, tuberculosis},
   web_url = {https://genomemedicine.biomedcentral.com/articles/10.1186/s13073-019-0650-x},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1756-994X},
   DOI = {10.1186/s13073-019-0650-x},
   stag_bib_extends_levelofaccess = {NA},
   author = {Phelan, J.E. and O’Sullivan, D.M. and Machado, D. and Ramos, J. and Oppong, Y.E.A. and Campino, S. and O’Grady, J. and McNerney, R. and Hibberd, M.L. and Viveiros, M. and Huggett, J.F. and Clark, T.G.}
}

@Article { PraakMUP2019,
   subid = {1327},
   title = {The Influence of the Cornea on Intraocular Pressure Measurement by ICARE PRO and ORA},
   journal = {Czech and Slovak Ophthalmology},
   year = {2019},
   month = {6},
   day = {15},
   volume = {75},
   number = {3},
   number2 = {16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements},
   pages = {111-118},
   keywords = {intraocular pressure, ICARE, ORA, corneal hysteresis, central corneal thickness},
   web_url = {http://www.cs-ophthalmology.cz/cs/journal/2019/3/1},
   misc2 = {EMPIR 2016: Research Potential},
   publisher = {Czech Society of Ophthalmology of the CzMA},
   language = {30},
   ISSN = {1211-9059, 1805-4447},
   DOI = {10.31348/2019/3/1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pluh{\'a}ček, F. and Unzeitigov{\'a}, A. and Marešov{\'a}, K. and Ryb{\'a}ř, J.}
}

@Article { MottonenRKBYFGK2019,
   subid = {1110},
   title = {Evidence for universality of tunable-barrier electron pumps},
   journal = {Metrologia},
   year = {2019},
   month = {6},
   day = {13},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Single electron pumps, electrical metrology, quantum electrical standards},
   web_url = {https://arxiv.org/abs/1901.05218},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab29a5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Giblin, S. and Fujiwara, A. and Yamahata, G. and Bae, M.H. and Kim, N. and Rossi, A. and M{\"o}tt{\"o}nen, M. and Kataoka, M.}
}

@Article { RoscoeRJDW2019,
   subid = {1185},
   title = {Field Measurement of Frequency and ROCOF in the Presence of Phase Steps},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   month = {6},
   volume = {68},
   number = {6},
   number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids},
   pages = {1688-1695},
   keywords = {ROCOF, Instruments, Frequency measurement, Phase measurement, Relays, Power system stability, Phasor measurement units, Sea measurements,},
   tags = {SEG},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2018.2882907},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wright, P.. and Davis, P. and Johnstone, K. and Rietveld, G. and Roscoe, A. J.}
}

@Article { IvanovGWRBBR2019,
   subid = {1128},
   title = {Complete dissolution of solid matrices using automated borate fusion in support of nuclear decommissioning and production of reference materials},
   journal = {Journal of Radioanalytical and Nuclear Chemistry},
   year = {2019},
   month = {5},
   day = {28},
   volume = {321},
   number = {1},
   number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities},
   pages = {183-196},
   keywords = {Fusion, dissolution, radionuclide, decommissioning, reference material, characterisation},
   web_url = {https://link.springer.com/article/10.1007/s10967-019-06572-z},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Springer Science and Business Media LLC},
   address = {233 Spring St. New York NY 10013 United States},
   language = {30},
   ISSN = {0236-5731, 1588-2780},
   DOI = {10.1007/s10967-019-06572-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Braysher, E. and Russell, B. and Woods, S. and Garc{\'i}a-Miranda, M. and Ivanov, P. and Bouchard, B. and Read, D.}
}

@Article { WolthausRLdvvW2019,
   subid = {1144},
   title = {Technical Note: Consistency of PTW 30013 and FC 65‐G ion chamber magnetic field correction factors},
   journal = {Medical Physics},
   year = {2019},
   month = {5},
   day = {27},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   keywords = {Reference dosimetry, MRgRT, ionisation chamber},
   misc2 = {EMPIR 2015: Health},
   publisher = {Wiley},
   language = {30},
   ISSN = {0094-2405, 2473-4209},
   DOI = {10.1002/mp.13623},
   stag_bib_extends_levelofaccess = {NA},
   author = {Woodings, S.J. and van Asselen, B. and van Soest, T.L. and de Prez, L.A. and Lagendijk, J.J.W and Raaymakers, B.W and Wolthaus, J.W.H}
}

@Article { OliveroBOFCJGSPBFHBER2019,
   subid = {1261},
   title = {Quantum Micro–Nano Devices Fabricated in Diamond by Femtosecond Laser and Ion Irradiation},
   journal = {Advanced Quantum Technologies},
   year = {2019},
   month = {5},
   day = {20},
   volume = {2},
   number = {5-6},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1900006},
   keywords = {diamond, ion‐beam irradiation, nitrogen vacancies ,NV magnetometry, quantum sensing, ultrafast laser writing},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Wiley},
   language = {30},
   ISSN = {2511-9044, 2511-9044},
   DOI = {10.1002/qute.201900006},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://hdl.handle.net/2318/1704485},
   author = {Eaton, S.M. and Hadden, J.P. and Bharadwaj, V. and Forneris, J. and Picollo, F. and Bosia, F. and Sotillo, B. and Giakoumaki, A.N. and Jedrkiewicz, O. and Chiappini, A. and Ferrari, M. and Osellame, R. and Barclay, P.E. and Olivero, P. and Ramponi, R.}
}

@Proceedings { SchulerREL2019,
   subid = {1247},
   title = {Zur Bestimmung des ILRS-Referenzpunktes am Satellite Observing System Wettzell},
   journal = {Photogrammetrie - Laserscanning - Optische 3D-Messtechnik},
   year = {2019},
   month = {4},
   day = {30},
   volume = {2019},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   pages = {162-175},
   keywords = {geometric reference points, VLBI, SLR, ILRS, geodesy, satellite, local tie vectors},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Wichmann Verlag},
   event_place = {Oldenburg},
   event_name = {18. Oldenburger 3D-Tage 2019},
   event_date = {06-02-2019 to 07-02-2019},
   language = {43},
   ISBN = {978-3-87907-660-4},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3515831},
   author = {Sch{\"u}ler, T. and Riepl, S. and Eschelbach, C. and L{\"o}sler, M.}
}

@Article { IacomussiRMLG2019,
   subid = {1255},
   title = {Road Surface Photometric Characterisation and Its Impact on Energy Savings},
   journal = {Coatings},
   year = {2019},
   month = {4},
   day = {26},
   volume = {9},
   number = {5},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   pages = {286},
   keywords = {road surface; luminance coefficient q; road lighting; energy savings; road users safety; EMPIR; EURAMET; Surface 16NRM02 project},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Paola Iacomussi},
   language = {30},
   ISSN = {2079-6412},
   DOI = {10.3390/coatings9050286},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gidlund, H. and Lindgren, M. and Muzet, V. and Rossi, G. and Iacomussi, P.}
}

@Article { WarwickRCZ2019,
   subid = {1925},
   title = {Evaluation of inductively coupled plasma tandem mass spectrometry for radionuclide assay in nuclear waste characterisation},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2019},
   month = {4},
   day = {26},
   volume = {34},
   number = {9},
   number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities},
   pages = {1810-1821},
   keywords = {tandem mass spectrometry, nuclear waste characterisation, rapid measurement, expanded measurement capability},
   web_url = {https://eprints.soton.ac.uk/430647},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {0267-9477, 1364-5544},
   DOI = {https://doi.org/10.1039/C8JA00411K},
   stag_bib_extends_levelofaccess = {NA},
   author = {Warwick, P. E. and Russell, B. C. and Croudace, I. W. and Zacharauskas, Ž.}
}

@Manual { HaddadiDLHGLHPZWHMSRKPASC2019,
   subid = {1085},
   title = {Best Practice Guide for Planar S-Parameter Measurements using Vector Network Analysers},
   year = {2019},
   month = {4},
   day = {24},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), microwave probes, extreme impedance measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise, vector network analyzer (VNA)},
   web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424B},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Physikalisch-Technische Bundesanstalt (PTB)},
   language = {30},
   DOI = {10.7795/530.20190424B},
   stag_bib_extends_levelofaccess = {NA},
   author = {Haddadi, K. and Dambrine, G. and Lozar, R. and Helmreich, K. and Gold, G. and Lomakin, K. and Heinrich, W. and Phung, G.N. and Zeier, M. and Wollensack, M. and Hoffmann, J. and Mubarak, F. and Shang, X. and Ridler, N. and Kuhlmann, K. and Probst, T. and Arz, U. and Spirito, M. and Clarke, R.}
}

@Article { DudekR2019,
   subid = {1237},
   title = {New approach to the adiabaticity concepts in the collective nuclear motion: Impact for the collective-inertia tensor and comparisons with experiment},
   journal = {Physical Review C},
   year = {2019},
   month = {4},
   day = {19},
   volume = {99},
   number = {4},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   keywords = {Collective nuclear motion, adiabaticity, nuclear inertia tensor, cranking approximation},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2469-9985, 2469-9993},
   DOI = {10.1103/PhysRevC.99.041303},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rouvel, D. and Dudek, J.}
}

@Article { RaaymakersJWvdWd2019,
   subid = {1046},
   title = {Direct measurement of ion chamber correction factors, k\(_{Q}\) and k\(_{B}\), in a 7 MV MRI-linac},
   journal = {Physics in Medicine and Biology},
   year = {2019},
   month = {4},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   keywords = {absorbed dose, MRgRT, kB, kQ, magnetic field},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/ab1511/pdf},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/ab1511},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Prez, L.A. and Woodings, S.J. and de Pooter, J.A. and van Asselen, B. and Wolthaus, J.W.H. and Jansen, B.J. and Raaymakers, B.W.}
}

@Article { RosendahlBBKSKS2019,
   subid = {1550},
   title = {CT beam dosimetric characterization procedure for personalized dosimetry},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {3},
   day = {29},
   volume = {64},
   number = {7},
   number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion},
   pages = {075009},
   keywords = {CT beam dosimetric characterization procedure for personalized dosimetry},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/ab0e97},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rosendahl, S. and B{\"u}ermann, L. and Borowski, M. and Kortesniemi, M. and Sundell, V-M. and Kosunen, A. and Siiskonen, T.}
}

@Article { MinelliBPRUSSGS2019,
   subid = {1543},
   title = {Sticky Measurement Problem: Number Concentration of Agglomerated Nanoparticles},
   journal = {Langmuir},
   year = {2019},
   month = {3},
   day = {14},
   volume = {35},
   number = {14},
   number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles},
   pages = {4927-4935},
   keywords = {Sticky Measurement Problem: Number Concentration of Agglomerated Nanoparticles},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {0743-7463, 1520-5827},
   DOI = {10.1021/acs.langmuir.8b04209},
   stag_bib_extends_levelofaccess = {NA},
   author = {Minelli, C. and Bartczak, D. and Peters, R. and Rissler, J. and Undas, A. and Sikora, A. and Sj{\"o}str{\"o}m, E. and Goenaga-Infante, H. and Shard, A.G.}
}

@Article { BraunBRSB2019,
   subid = {1033},
   title = {Measurement and Analysis of PMU Reporting Latency for Smart Grid Protection and Control Applications},
   journal = {IEEE Access},
   year = {2019},
   month = {3},
   day = {12},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   pages = {1-1},
   keywords = {Phasor measurement units, Ethernet, Hardware, Real-time systems, Synchronization, Task analysis},
   misc2 = {EMPIR 2017: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {2169-3536},
   DOI = {10.1109/ACCESS.2019.2903929},
   stag_bib_extends_levelofaccess = {NA},
   author = {Blair, S.M. and Syed, M.H. and Roscoe, A.J. and Burt, G.M. and Braun, J.P.}
}

@Article { GramegnaRPARVDG2019,
   subid = {1006},
   title = {Optimal estimation of entanglement and discord in two-qubit states},
   journal = {Scientific Reports},
   year = {2019},
   month = {2},
   day = {28},
   volume = {9},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {1-9},
   keywords = {quantum technologies},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-39334-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Ruo Berchera, I. and Degiovanni, I.P. and Genovese, M.}
}

@Article { GramegnaRPARVDG20190,
   subid = {1006},
   title = {Optimal estimation of entanglement and discord in two-qubit states},
   journal = {Scientific Reports},
   year = {2019},
   month = {2},
   day = {28},
   volume = {9},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1-9},
   keywords = {quantum technologies},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-39334-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Ruo Berchera, I. and Degiovanni, I.P. and Genovese, M.}
}

@Article { GramegnaRPARVDG20191,
   subid = {1006},
   title = {Optimal estimation of entanglement and discord in two-qubit states},
   journal = {Scientific Reports},
   year = {2019},
   month = {2},
   day = {28},
   volume = {9},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {1-9},
   keywords = {quantum technologies},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-019-39334-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Ruo Berchera, I. and Degiovanni, I.P. and Genovese, M.}
}

@Article { RaaymakersWHMv2019,
   subid = {1048},
   title = {Monte Carlo simulations of out-of-field surface doses due to the electron streaming effect in orthogonal magnetic fields},
   journal = {Physics in Medicine and Biology},
   year = {2019},
   month = {2},
   day = {26},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   keywords = {out-of-field dose, MRgRT},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/1361-6560/ab0aa0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Malkov, V.N. and Hackett, S.L. and Wolthaus, J.W.H. and Raaymakers, B.W. and van Asselen, B.}
}

@Article { ChunnilallKBGRKLPRGD2019,
   subid = {1012},
   title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source},
   journal = {Metrologia},
   year = {2019},
   month = {2},
   day = {22},
   volume = {56},
   number = {2},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {025004},
   keywords = {single-photon sources, quantum technologies, quantum characterization},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab022e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.}
}

@Article { ChunnilallKBGRKLPRGD20190,
   subid = {1012},
   title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source},
   journal = {Metrologia},
   year = {2019},
   month = {2},
   day = {22},
   volume = {56},
   number = {2},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {025004},
   keywords = {single-photon sources, quantum technologies, quantum characterization},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab022e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.}
}

@Article { ChunnilallKBGRKLPRGD20191,
   subid = {1012},
   title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source},
   journal = {Metrologia},
   year = {2019},
   month = {2},
   day = {22},
   volume = {56},
   number = {2},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {025004},
   keywords = {single-photon sources, quantum technologies, quantum characterization},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab022e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.}
}

@Article { BurgerRRHS2019,
   subid = {1520},
   title = {Numerical Investigation of Light Emission from Quantum Dots Embedded into On‐Chip, Low‐Index‐Contrast Optical Waveguides},
   journal = {physica status solidi (b)},
   year = {2019},
   month = {2},
   day = {15},
   volume = {256},
   number = {7},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1800437},
   keywords = {single photon emitters, coherent light matter interaction, numerical simulations, finite element methods},
   web_url = {https://arxiv.org/abs/2006.10466},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Wiley},
   language = {30},
   ISSN = {0370-1972, 1521-3951},
   DOI = {10.1002/pssb.201800437},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hoehne, T. and Schnauber, P. and Rodt, S. and Reitzenstein, S. and Burger, S.}
}

@Article { WolthausRvHM2019,
   subid = {1142},
   title = {Monte Carlo simulations of out-of-field skin dose due to spiralling contaminant electrons in a perpendicular magnetic field},
   journal = {Medical Physics},
   year = {2019},
   month = {2},
   day = {14},
   volume = {46},
   number = {3},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {1467-1477},
   keywords = {MRgRT, Monte Carlo, dosimetry, magnetic field},
   web_url = {https://aapm.onlinelibrary.wiley.com/doi/full/10.1002/mp.13392},
   misc2 = {EMPIR 2015: Health},
   publisher = {Wiley},
   language = {30},
   ISSN = {0094-2405},
   DOI = {10.1002/mp.13392},
   stag_bib_extends_levelofaccess = {NA},
   author = {Malkov, V.N. and Hackett, S.L. and van Asselen, B. and Raaymakers, B.W. and Wolthaus, Jochem W. H.}
}

@Article { JohnenRMDEK2019,
   subid = {1052},
   title = {Compatibility of 3D printing materials and printing techniques with PAGAT gel dosimetry},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {2},
   volume = {64},
   number = {4},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {04NT02},
   keywords = {MRgRT},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aafef0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Elter, A. and Dorsch, S. and Mann, P. and Runz, A. and Johnen, W. and Karger, C.P.}
}

@Article { KokvvWWJddR2019,
   subid = {1045},
   title = {Commissioning of a water calorimeter as a primary standard for absorbed dose to water in magnetic fields},
   journal = {Physics in Medicine \& Biology},
   year = {2019},
   month = {1},
   day = {29},
   volume = {64},
   number = {3},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {035013},
   keywords = {dosimetry, MRgRT, primary standard, magnetic field, MRI-linac, calorimetry},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/aaf975},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aaf975},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Prez, L. and de Pooter, J. and Jansen, B. and Woodings, S. and Wolthaus, J. and van Asselen, B. and van Soest, T. and Kok, J. and Raaymakers, B.}
}

@Article { PiacentiniGRAVVMDG2019,
   subid = {1005},
   title = {Theoretical description and experimental simulation of quantum entanglement near open time-like curves via pseudo-density operators},
   journal = {Nature Communications},
   year = {2019},
   month = {1},
   day = {14},
   volume = {10},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {1-7},
   keywords = {quantum entanglement, pseudo-density operators,},
   web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-018-08100-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marletto, C. and Vedral, V. and Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.}
}

@Article { PiacentiniGRAVVMDG20190,
   subid = {1005},
   title = {Theoretical description and experimental simulation of quantum entanglement near open time-like curves via pseudo-density operators},
   journal = {Nature Communications},
   year = {2019},
   month = {1},
   day = {14},
   volume = {10},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1-7},
   keywords = {quantum entanglement, pseudo-density operators,},
   web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-018-08100-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marletto, C. and Vedral, V. and Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.}
}

@Article { OliveroDFGRBLKTMCKGD2019,
   subid = {1007},
   title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range},
   journal = {Metrologia},
   year = {2019},
   month = {1},
   volume = {56},
   number = {1},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {015016},
   keywords = {colour centers, single-photon source, metrology for quantum technologies},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf6c8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.}
}

@Article { OliveroDFGRBLKTMCKGD20190,
   subid = {1007},
   title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range},
   journal = {Metrologia},
   year = {2019},
   month = {1},
   volume = {56},
   number = {1},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {015016},
   keywords = {colour centers, single-photon source, metrology for quantum technologies},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf6c8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.}
}

@Article { OliveroDFGRBLKTMCKGD20191,
   subid = {1007},
   title = {Feasibility study towards comparison of the g (2)(0) measurement in the visible range},
   journal = {Metrologia},
   year = {2019},
   month = {1},
   volume = {56},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {015016},
   keywords = {colour centers, single-photon source, metrology for quantum technologies},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf6c8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Moreva, E. and Traina, P. and Kirkwood, R.A. and L{\'o}pez, M. and Brida, G. and Gramegna, M. and Ruo-Berchera, I. and Forneris, J. and Ditalia Tchernij, S. and Olivero, P. and Chunnilall, C.J. and K{\"u}ck, S. and Genovese, M. and Degiovanni, I.P.}
}

@Article { ZschiedrichFRBHG2019,
   subid = {1060},
   title = {Decomposition of scattered electromagnetic fields into vector spherical wave functions on surfaces with general shapes},
   journal = {Physical Review B},
   year = {2019},
   month = {1},
   volume = {99},
   number = {4},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {045406},
   keywords = {light scattering, vector spherical wave functions},
   web_url = {https://arxiv.org/abs/1808.02315},
   misc2 = {EMPIR 2017: Fundamental},
   language = {30},
   DOI = {10.1103/PhysRevB.99.045406},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garcia Santiago, X. and Hammerschmidt, M. and Burger, S. and Rockstuhl, C. and Fernandez-Corbaton, I. and Zschiedrich, L.}
}

@Article { MohnsHBHR2019,
   subid = {1041},
   title = {Comparison of Reference Setups for Calibrating Power Transformer Loss Measurement Systems},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {power transformers, loss measurement, power transformer losses, load loss, shunt reactor, power measurement, comparison, calibration, high voltage, uncertainty.},
   tags = {SEG},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.1109/TIM.2018.2879171},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, Gert and Mohns, Enrico and Houtzager, Ernest and Badura, Henrik and Hoogenboom, Dennis}
}

@Article { BaduraCMR2019,
   subid = {1042},
   title = {A Fundamental Step-Up Method for Standard Voltage Transformers Based on an Active Capacitive High-Voltage Divider},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {Capacitors, Standards, Voltage measurement, Calibration, Uncertainty, Gain, Voltage transformersCapacitive divider, high voltage, inductive voltage divider (IVD), phase displacement, ratio error},
   tags = {SEG},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {30},
   DOI = {10.7795/EMPIR.17NRM01.CA.20190408},
   stag_bib_extends_levelofaccess = {NA},
   author = {Badura, H. and Chunyang, J. and Mohns, E. and Raether, P.}
}

@Article { RydlerB2019,
   subid = {1138},
   title = {Realization of Absolute Phase and AC Resistance of Current Shunts by Ratio Measurements},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2019},
   volume = {68},
   number = {6},
   number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements},
   pages = {2041-2046},
   keywords = {Capacitance, current shunt,impedance measurement, inductance, measurement standards, phase measurement, resistance},
   web_url = {https://ieeexplore.ieee.org/document/8608020},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IEEE},
   language = {30},
   ISSN = {1557-9662},
   DOI = {10.1109/TIM.2018.2882927},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bergsten, T. and Rydler, K.E.}
}

@Proceedings { GiordanoCRMGLFRSBD2019,
   subid = {1945},
   title = {Pantograph-Catenary Arc Detection Technique based on Conducted Effects Measurement on Railway Supply System},
   journal = {WCRR Papers},
   year = {2019},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   keywords = {arc discharge; electric arc; Power quality; rail transportation system;},
   misc2 = {EMPIR 2016: Energy},
   event_place = {Tokyo, Japan},
   event_name = {WORLD CONGRESS OF RAIL RESEARCH (WCRR), Tokyo, Japan, 28 October - 1 November 2019},
   event_date = {28-10-2019 to 01-11-2019},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4587794},
   author = {Giordano, D. and Crotti, G. and Roccato, P. and Mariscotti, A. and Gallo, D. and Luiso, M. and Filippini, N.  and Rossetta, I. and Spalvieri, C. and Biancucci, A. and Domandio, L.}
}

@Inbook { PriceRBSW2019,
   subid = {1192},
   title = {Standardisation of magnetic nanomaterials: Steps towards magnetic reference particles},
   year = {2019},
   volume = {PTB-Berich},
   number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles},
   pages = {200-208},
   keywords = {standardisation, magnetic nanomaterials, reference materials,},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Fachverlag NW in Carl Ed. Sch{\"u}nemann KG},
   address = {Bremen},
   booktitle = {NanoWorkshop 2018: Workshop on Reference Nanomaterials},
   language = {30},
   ISBN = {978-3-95606-440-1},
   ISSN = {0179-0609},
   DOI = {10.7795/110.20190412},
   stag_bib_extends_levelofaccess = {NA},
   author = {Price, A. and R{\"u}ttinger, R. and Bleul, R. and Steinhoff, U. and Wiekhorst, F.}
}

@Article { GodDCBYDDRW2019,
   subid = {1238},
   title = {High-rank Symmetries in Nuclei: Challenges for Prediction Capacities of the Nuclear Mean-field Theories},
   journal = {Acta Physica Polonica B},
   year = {2019},
   volume = {50},
   number = {3},
   number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology},
   pages = {685},
   keywords = {Nuclear mean field theory, modeling prediciton capacities, nuclear point group symmetreis, high-rank symmetries},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Jagiellonian University},
   language = {30},
   ISSN = {0587-4254, 1509-5770},
   DOI = {10.5506/APhysPolB.50.685},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dudek, J. and Dedes, I. and Yang, J. and Baran, A. and Curien, D. and Dickel, T. and G{\'o}źdź, A. and Rouvel, D. and Wang, H.L.}
}

@Proceedings { BuzoianuRF2019,
   subid = {1244},
   title = {Recent progress in chemical measuring capabilities in INM as a result of EMRP/EMPIR Programme},
   journal = {19th International Congress of Metrology (CIM2019)},
   year = {2019},
   number = {20004 (2019)},
   number2 = {16RPT02: ALCOREF: Certified forensic alcohol reference materials},
   pages = {1-13},
   keywords = {ICP-MS, gas chromatography},
   misc2 = {EMPIR 2016: Research Potential},
   publisher = {EDP Sciences},
   event_place = {LNE},
   event_name = {CIM 2019 - 19th International Metrology Congress},
   event_date = {16-09-2019 to 21-09-2019},
   language = {30},
   DOI = {10.1051/metrology/201920004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Buzoianu, M. and Radu, M. and Ionescu, G.V.}
}

@Proceedings { BuzoianuRF20190,
   subid = {1244},
   title = {Recent progress in chemical measuring capabilities in INM as a result of EMRP/EMPIR Programme},
   journal = {19th International Congress of Metrology (CIM2019)},
   year = {2019},
   number = {20004 (2019)},
   number2 = {16RPT01: ChemMet-Cap: Development of scientific and technical capabilities in the field of chemical analysis},
   pages = {1-13},
   keywords = {ICP-MS, gas chromatography},
   misc2 = {EMPIR 2016: Research Potential},
   publisher = {EDP Sciences},
   event_place = {LNE},
   event_name = {CIM 2019 - 19th International Metrology Congress},
   event_date = {16-09-2019 to 21-09-2019},
   language = {30},
   DOI = {10.1051/metrology/201920004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Buzoianu, M. and Radu, M. and Ionescu, G.V.}
}

@Proceedings { RojoS2019,
   subid = {2006},
   title = {Preparation of hydrogen chloride in hydrogen standard gas mixtures for hydrogen purity requirements},
   journal = {19th International Congress of Metrology (CIM2019)},
   year = {2019},
   number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles},
   keywords = {Hydrogen, HCl, purity},
   tags = {EnG},
   misc2 = {EMPIR 2016: Energy},
   publisher = {EDP Sciences},
   event_place = {France},
   event_name = {CIM 2019 19th INTERNATIONAL METROLOGY CONGRESS},
   event_date = {01-09-2019 to 05-09-2019},
   language = {30},
   DOI = {10.1051/metrology/201920002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rojo, A. and Santamar{\'i}a, E.}
}

@Article { VavassoriASCGPRCC2019,
   subid = {1307},
   title = {Magnetic imaging using geometrically constrained nano-domain walls},
   journal = {Nanoscale},
   year = {2019},
   volume = {11},
   number = {10},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {4478-4488},
   keywords = {MFM},
   web_url = {https://pubs.rsc.org/en/content/articlelanding/2019/NR/C8NR07729K\#!divAbstract},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2040-3364, 2040-3372},
   DOI = {10.1039/C8NR07729K},
   stag_bib_extends_levelofaccess = {NA},
   author = {Corte-Le{\'o}n, H. and Corte-Le{\'o}n, H. and Rodr{\'i}guez, L A. and Pancaldi, M. and Gatel, C. and Cox, D. and Snoeck, E. and Antonov, V. and Vavassori, P.}
}

@Article { ZhuKPRLP2019,
   subid = {1456},
   title = {Combining Harmonic Laser Beams by Fiber Components for Refractivity-Compensating Two-Color Interferometry},
   journal = {Journal of Lightwave Technology},
   year = {2019},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   pages = {1-1},
   keywords = {Wavelength division multiplexing (WDM), Photonics crystal  fiber  (PCF),  Beam properties, Two–color  interferometry},
   web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=8936353},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0733-8724, 1558-2213},
   DOI = {10.1109/JLT.2019.2960473},
   stag_bib_extends_levelofaccess = {NA},
   author = {Liu, Y. and Rose, A. and Prellinger, G. and K{\"o}chert, P. and Zhu, J. and Pollinger, F.}
}

@Article { SchumacherPMWHMRFMGHU2018,
   subid = {1127},
   title = {Robust formation of quantum dots in GaAs/AlGaAs heterostructures for single-electron metrology},
   journal = {Metrologia},
   year = {2018},
   month = {12},
   day = {21},
   volume = {56},
   number = {1},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {014002},
   keywords = {quantum dot, single-electron, GaAs/AlGaAs, fabrication},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aaf4aa},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gerster, T. and M{\"u}ller, A. and Freise, L. and Reifert, D. and Maradan, D. and Hinze, P. and Weimann, T. and Marx, H. and Pierz, K. and Schumacher, H.W. and Hohls, F. and Ubbelohde, N.}
}

@Proceedings { HrabinaiPeHi2018,
   subid = {1129},
   title = {Investigating the use of the hydrogen cyanide (HCN) as an absorption media for laser spectroscopy},
   journal = {21st Czech-Polish-Slovak Optical Conference on Wave and Quantum Aspects of Contemporary Optics},
   year = {2018},
   month = {12},
   day = {18},
   number2 = {17IND03: LaVA: Large Volume Metrology Applications},
   keywords = {SI metre realisation, HCN gas, molecular spectroscopy, hyperfine transition, optical frequency comb},
   web_url = {https://arxiv.org/abs/1905.07272},
   misc2 = {EMPIR 2017: Industry},
   publisher = {SPIE},
   event_place = {Lednice, Czech Republic},
   event_name = {21st Czech-Polish-Slovak Optical Conference on Wave and Quantum Aspects of Contemporary Optics},
   event_date = {03-09-2018 to 07-09-2018},
   language = {30},
   DOI = {10.1117/12.2517761},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hošek, M. and Rerucha, S. and Pravdova, L. and Č{\'i}žek, M. and Hrabina, J. and Č{\'i}p, O.}
}

@Article { MubarakRGMRS2018,
   subid = {984},
   title = {Noise Behavior and Implementation of Interferometer-Based Broadband VNA},
   journal = {IEEE Transactions on Microwave Theory and Techniques},
   year = {2018},
   month = {12},
   volume = {67},
   number = {1},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {249-260},
   keywords = {extreme  impedance  measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise,  vector  network  analyzer},
   web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=8566175},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9480, 1557-9670},
   DOI = {10.1109/TMTT.2018.2874667},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mubarak, F.A. and Romano, R. and Galatro, L. and Mascolo, V. and Rietveld, G. and Spirito, M.}
}

@Article { ColemanGKBDR2018,
   subid = {970},
   title = {Flow rate measurement in stacks with cyclonic flow – Error estimations using CFD modelling},
   journal = {Measurement},
   year = {2018},
   month = {12},
   volume = {129},
   number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions},
   pages = {167-183},
   keywords = {flow measurement, cyclonic flow, velocity measurements, standard reference method, ultrasonic flow measurement, EN ISO 16911-2, validated computational fluid dynamics (CFD) modelling, OpenFoam software, Emissions Trading System},
   web_url = {https://arxiv.org/ftp/arxiv/papers/1808/1808.10159.pdf},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2018.06.032},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gersl, J. and Knotek, S. and Belligoli, Z. and Dwight, R.P. and Robinson, R.A. and Coleman, M.D.}
}

@Article { NewellHMRLKHCPYKE2018,
   subid = {994},
   title = {Confocal laser scanning microscopy for rapid optical characterization of graphene},
   journal = {Communications Physics},
   year = {2018},
   month = {11},
   day = {20},
   volume = {1},
   number = {1},
   number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics},
   keywords = {Confocal microscopy, graphene.},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Springer Nature America, Inc},
   language = {30},
   ISSN = {2399-3650},
   DOI = {10.1038/s42005-018-0084-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Panchal, V. and Yang, Y. and Cheng, G. and Hu, J. and Kruskopf, M. and Liu, C.I. and Rigosi, A.F. and Melios, C. and Hight Walker, A.R. and Newell, D.B. and Kazakova, O. and Elmquist, R.E.}
}

@Proceedings { DambrineRVMMDRH2018,
   subid = {1002},
   title = {On-Wafer Broadband Microwave Measurement of High Impedance Devices-CPW Test Structures with Integrated Metallic Nano-Resistances},
   journal = {2018 48th European Microwave Conference (EuMC)},
   year = {2018},
   month = {11},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {25-28},
   keywords = {S-parameters, microwave, uncertainty, on-wafer,},
   web_url = {https://hal.archives-ouvertes.fr/hal-02056825},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Madrid},
   event_name = {EuMC 2018},
   event_date = {23-09-2018 to 27-09-2018},
   language = {30},
   DOI = {10.23919/EuMC.2018.8541607},
   stag_bib_extends_levelofaccess = {NA},
   author = {Daff{\'e}, K. and Mubarak, F. and Mascolo, V. and Votsi, H. and Ridler, N.M. and Dambrine, G. and Roch, I. and Haddadi, K.}
}

@Article { WinterRKP2018,
   title = {Multidimensional model to correct PV device performance measurements taken under diffuse irradiation to reference conditions},
   journal = {Solar Energy},
   year = {2018},
   month = {11},
   volume = {174},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {431-444},
   keywords = {Modeling; PV metrology; Calibration; Angle of incidence; Diffuse irradiance; Optical losses; Numerical method},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0038092X18308429?via\%3Dihub},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0038-092X},
   DOI = {10.1016/j.solener.2018.08.072},
   stag_bib_extends_levelofaccess = {NA},
   author = {Winter, S. and Riechelmann, S. and Kr{\"o}ger, I. and Plag, F.}
}

@Article { VargasBCMPR2018,
   subid = {894},
   title = {An Unmanned Aircraft System to Detect a Radiological Point Source Using RIMA Software Architecture},
   journal = {Remote Sensing},
   year = {2018},
   month = {10},
   day = {30},
   volume = {10},
   number = {11},
   number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident},
   pages = {1712},
   keywords = {UAS, CZT, UAS software Architecture, radiological detection},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2072-4292},
   DOI = {10.3390/rs10111712},
   stag_bib_extends_levelofaccess = {NA},
   author = {Royo, P. and Pastor, E. and Macias, M. and Cuadrado, R. and Barrado, C. and Vargas, A.}
}

@Article { JakubowskiLKNPTRES2018,
   subid = {937},
   title = {Gadolinium in human brain sections and colocalization with other elements},
   journal = {Neurology - Neuroimmunology Neuroinflammation},
   year = {2018},
   month = {10},
   day = {19},
   volume = {6},
   number = {1},
   number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease},
   pages = {e515},
   keywords = {Gadolinium, Gadolinium-based contrast agents, Human brain, MRI, LA-ICP-MS, Iron, Copper, Phosphorus},
   web_url = {http://nn.neurology.org/content/6/1/e515/},
   misc2 = {EMPIR 2015: Health},
   publisher = {Ovid Technologies (Wolters Kluwer Health)},
   language = {30},
   ISSN = {2332-7812},
   DOI = {10.1212/NXI.0000000000000515},
   stag_bib_extends_levelofaccess = {NA},
   author = {El-Khatib, A.H. and Radbruch, H. and Trog, S. and Neumann, B. and Paul, F. and Koch, A. and Linscheid, M.W. and Jakubowski, N. and Schellenberger, E.}
}

@Article { PepperRFJGFSSREJJK2018,
   subid = {1113},
   title = {LO-Phonon Emission Rate of Hot Electrons from an On-Demand Single-Electron Source in a GaAs/AlGaAs Heterostructure},
   journal = {Physical Review Letters},
   year = {2018},
   month = {9},
   day = {26},
   volume = {121},
   number = {13},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Single electron pumps, hot electron transport, phonon emission, phonon relaxation, optical phonons, edge states, electron optics, electron quantum optics},
   web_url = {https://arxiv.org/abs/1712.09031},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.121.137703},
   stag_bib_extends_levelofaccess = {NA},
   author = {Johnson, N. and Emary, C. and Ryu, S. and Sim, H.S. and See, P. and Fletcher, J.D. and Griffiths, J.P. and Jones, G.A.C. and Farrer, I. and Ritchie, D.A. and Pepper, M. and Janssen, T.J.B.M. and Kataoka, M.}
}

@Article { RuttTTHLHILS2018,
   subid = {1122},
   title = {Manipulation of random telegraph signals in a silicon nanowire transistor with a triple gate},
   journal = {Nanotechnology},
   year = {2018},
   month = {9},
   day = {25},
   volume = {29},
   number = {47},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {475201},
   keywords = {random telegraph signal, silicon nanowire, quantum dot, MOSFET},
   web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/aadfa6/meta\#back-to-top-target},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-4484, 1361-6528},
   DOI = {10.1088/1361-6528/aadfa6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Liu, F. and Ibukuro, K. and Husain, M.H. and Li, Z. and Hillier, J. and Tomita, I. and Tsuchiya, Y. and Rutt, H. and Saito, S.}
}

@Article { HisamotoRHLASTYTLSK2018,
   subid = {595},
   title = {Quantum Dipole Effects in a Silicon Transistor under High Electric Fields},
   journal = {Journal of the Physical Society of Japan},
   year = {2018},
   month = {9},
   day = {15},
   volume = {87},
   number = {9},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {094801},
   keywords = {Si, CMOS, transistor, quantum dipole, Heisenberg model},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Physical Society of Japan},
   language = {30},
   ISSN = {0031-9015, 1347-4073},
   DOI = {10.7566/jpsJ.87.094801},
   stag_bib_extends_levelofaccess = {NA},
   author = {Saito, S. and Li, Z. and Yoshimoto, H, and Tomita, I. and Tsuchiya, Y. and Sasago, Y. and Arimoto, H. and Liu, F. and Husain, M.K. and Hisamoto, D. and Rutt, H.N. and Kurihara, S.}
}

@Article { KonijnenbergGMGGCGR2018,
   subid = {825},
   title = {EANM practical guidance on uncertainty analysis for molecular radiotherapy absorbed dose calculations},
   journal = {European Journal of Nuclear Medicine and Molecular Imaging},
   year = {2018},
   month = {9},
   day = {14},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   keywords = {Dosimetry, Absorbed Dose},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature America, Inc},
   language = {30},
   ISSN = {1619-7070, 1619-7089},
   DOI = {10.1007/s00259-018-4136-7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gear, J.I. and Cox, M.G. and Gustafsson, J. and Gleisner, K.S. and Murray, I. and Glatting, G. and Konijnenberg, M. and Flux, G. D.}
}

@Proceedings { CarabelliDPDFTMGR2018,
   subid = {1414},
   title = {Color centres in diamond from single photon sources to ODMR in cells},
   journal = {Quantum Photonic Devices 2018},
   year = {2018},
   month = {9},
   day = {11},
   volume = {10733},
   number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits},
   pages = {1073304},
   keywords = {Diamond,Color centers,Confocal microscopy,Electroluminescence,Single photon},
   web_url = {https://iris.unito.it/handle/2318/1685641\#.XjvhgWhKhPY},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {SPIE},
   event_place = {San Diego, California, United States},
   event_name = {SPIE NanoScience + Engineering},
   event_date = {19-08-2018 to 23-08-2018},
   language = {30},
   DOI = {10.1117/12.2323102},
   stag_bib_extends_levelofaccess = {NA},
   author = {Genovese, M. and Moreva, E. and Traina, P. and Forneris, J. and Ditalia Tchernij, S. and Picollo, F. and Degiovanni, I.P. and Carabelli, V. and Olivero, P.}
}

@Article { LandiGDRGCLM2018,
   subid = {1146},
   title = {Pantograph-to-OHL Arc: Conducted Effects in DC Railway Supply System},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2018},
   month = {9},
   number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems},
   keywords = {DC railway system, Electric arc, Rail transportation Pantograph–catenary, Predictive maintenance},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/TIM.2019.2902805},
   stag_bib_extends_levelofaccess = {NA},
   author = {Crotti, G. and Delle Femine, A. and Gallo, D. and Giordano, D. and Landi, C. and Luiso, M. and Mariscotti, A. and Roccato, P.}
}

@Proceedings { AllalARJG2018,
   subid = {1032},
   title = {Efficient Experimental Assessment of The Specific Absorption Rate (SAR) Induced by MIMO Wireless Communication Devices; Application of Vector Near-Field Measurement System},
   journal = {2018 IEEE Conference on Antenna Measurements \& Applications (CAMA)},
   year = {2018},
   month = {9},
   number2 = {16NRM07: Vector SAR: SAR measurement using vector probes},
   pages = {1-4},
   keywords = {SAR, MIMO, Planar Near-Field Measurement System, Vector Field Measurement},
   web_url = {https://hal.archives-ouvertes.fr/hal-02376333},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {IEEE},
   event_place = {Vasteras},
   event_name = {2018 IEEE Conference on Antenna Measurements \& Applications (CAMA)},
   event_date = {03-09-2018 to 06-09-2018},
   language = {30},
   DOI = {10.1109/CAMA.2018.8530621},
   stag_bib_extends_levelofaccess = {NA},
   author = {Aberbour, L. and Jawad, O. and Ramdani, M. and Giry, P. and Julien, T.}
}

@Article { HaasSSRBH2018,
   title = {A gravitational telescope deformation model for geodetic VLBI},
   journal = {Journal of Geodesy},
   year = {2018},
   month = {8},
   day = {29},
   volume = {93},
   number = {5},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {669-680},
   keywords = {VLBI, Telescope deformation, Systematic errors, Terrestrial reference frames},
   web_url = {http://link.springer.com/article/10.1007/s00190-018-1188-1},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0949-7714, 1432-1394},
   DOI = {10.1007/s00190-018-1188-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Haas, R. and Svantesson, C.G. and Spetz, J. and Rieck, C. and Bergstrand, S. and Herbertsson, M.}
}

@Article { KoppmannHGRAMO2018,
   title = {A large-area blackbody for in-flight calibration of an infrared interferometer deployed on board a long-duration balloon for stratospheric research},
   journal = {Atmospheric Measurement Techniques},
   year = {2018},
   month = {8},
   day = {14},
   volume = {11},
   number = {8},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {4757-4762},
   keywords = {GLORIA, Calibration},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-11-4757-2018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koppmann, R. and Hollandt, J. and Gutschwager, B. and Reiniger, M. and Adibekyan, A. and Monte, C. and Olschewski, F.}
}

@Article { YooSWWIAKR2018,
   subid = {842},
   title = {Extrusion 3D Printing of Paracetamol Tablets from a Single Formulation with Tunable Release Profiles Through Control of Tablet Geometry},
   journal = {AAPS PharmSciTech},
   year = {2018},
   month = {8},
   day = {10},
   volume = {19},
   number = {11},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   keywords = {3D printing; paracetamol; sustained release; immediate release; personalised medicine; geometry},
   web_url = {https://link.springer.com/article/10.1208/s12249-018-1107-z},
   misc2 = {EMPIR 2015: Health},
   publisher = {American Association of Pharmaceutical Scientists (AAPS)},
   language = {30},
   ISSN = {1530-9932},
   DOI = {10.1208/s12249-018-1107-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Khaled, S.A. and Alexander, M.R. and Irvine, D.J. and Wildman, R.D. and Wallace, M.J. and Sharpe, S. and Yoo, J. and Roberts, C.J.}
}

@Article { RidlerLWL2018,
   subid = {884},
   title = {A New SOLT Calibration Method for Leaky On-Wafer Measurements Using a 10-Term Error Model},
   journal = {IEEE Transactions on Microwave Theory and Techniques},
   year = {2018},
   month = {8},
   volume = {66},
   number = {8},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {3894-3900},
   keywords = {Calibration, Crosstalk, Standards, Probes, Semiconductor device measurement, Measurement uncertainty, Numerical models, approximation theory, calibration, measurement errors, measurement standards, millimetre wave measurement, network analysers, S-parameters},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9480, 1557-9670},
   DOI = {10.1109/TMTT.2018.2832052},
   stag_bib_extends_levelofaccess = {NA},
   author = {Liu, C. and Wu, A. and Li, C. and Ridler, N.}
}

@Article { ZvizdiFSIRSSH2018,
   subid = {1087},
   title = {Development and preliminary investigation of a modular chamber for calibration of relative humidity instruments},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement},
   pages = {122017},
   keywords = {Humidity, Relative humidity, Calibration chamber},
   web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122017},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/12/122017},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sestan, D. and Smorgon, D. and Rothmund, P. and Iacomini, L. and Šariri, K. and Fernicola, V. and Zvizdić, D. and Hodzic, N.}
}

@Article { OlbrichSROBS2018,
   subid = {1626},
   title = {Validation of simulations in multiphase flow metrology by comparison with experimental video observations},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {8},
   volume = {1065},
   number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology},
   pages = {092015},
   keywords = {Multiphase flow, slug flow, CFD, liquid level extraction, frequency analysis},
   misc2 = {EMPIR 2016: Energy},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/1065/9/092015},
   stag_bib_extends_levelofaccess = {NA},
   author = {Olbrich, M. and Schmeyer, E. and Riazy, L. and Oberleithner, K. and B{\"a}r, M. and Schmelter, S.}
}

@Article { BoarinoRDSPDGFMC2018,
   subid = {846},
   title = {Influence of the long-range ordering of gold-coated Si nanowires on SERS},
   journal = {Scientific Reports},
   year = {2018},
   month = {7},
   day = {27},
   volume = {8},
   number = {1},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   keywords = {surface-enhanced Raman spectroscopy; substrates for bio-analytical applications; flexible gold-coated Si nanowires},
   web_url = {https://www.nature.com/articles/s41598-018-29641-x.pdf},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-018-29641-x},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cara, E. and Mandrile, L. and Ferrarese Lupi, F. and Giovannozzi, A.M. and Dialameh, M. and Portesi, C. and Sparnacci, K. and De Leo, N. and Rossi, A.M. and Boarino, L.}
}

@Article { HoflingSBBHSGLFSKRS2018_2,
   subid = {696},
   title = {Photon-Number-Resolved Measurement of an Exciton-Polariton Condensate},
   journal = {Physical Review Letters},
   year = {2018},
   month = {7},
   day = {25},
   volume = {121},
   number = {4},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {047401},
   keywords = {Exciton Polariton, Photon Statistics},
   web_url = {https://arxiv.org/abs/1805.02959},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.121.047401},
   stag_bib_extends_levelofaccess = {NA},
   author = {Klaas, M. and Schlottmann, E. and Flayac, H. and Laussy, F. P. and Gericke, F. and Schmidt, M. and Helversen, M. v. and Beyer, J. and Brodbeck, S. and Suchomel, H. and H{\"o}fling, S. and Reitzenstein, S. and Schneider, C.}
}

@Proceedings { DaffeSRMMH2018,
   subid = {893},
   title = {Parameterization Models for Traceable Characterization of Planar CPW SOL Calibration Standards},
   journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {7},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Uncertainty, Calibration, Coplanar waveguides, Standards, Frequency measurement, Measurement Uncertainty, Probes},
   web_url = {https://hal.archives-ouvertes.fr/hal-02085776/document},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Paris, France},
   event_name = {CPEM},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   ISBN = {978-1-5386-0974-3},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2018.8500810},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mubarak, F. and Mascolo, V. and Rietveld, G. and Spirito, M. and Daff{\'e}, K. and Haddadi, K.}
}

@Article { EllingsbergBAVLRWPS2018,
   subid = {1376},
   title = {Evaluation of EMI Effects on Static Electricity Meters},
   journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {7},
   number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters},
   keywords = {Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters.},
   tags = {SEG},
   web_url = {https://zenodo.org/record/3587786\#.XiGxp3u7KUn},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/CPEM.2018.8500945},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wright, P.S. and Rietveld, G. and Leferink, F. and van den Brom, H.E. and Alonso, F.R.I and Braun, J.P. and Ellingsberg, K. and Pous, M. and Svoboda, M.}
}

@Article { RottgerDDBKN2018,
   title = {Novel spectrometers for environmental dose rate monitoring},
   journal = {Journal of Environmental Radioactivity},
   year = {2018},
   month = {7},
   volume = {187},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {115-121},
   keywords = {Environmental dosimetry, Spectrometers, MetroERM, Early warning networks},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0265931X17304976?via\%3Dihub},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0265-931X},
   DOI = {10.1016/j.jenvrad.2018.01.020},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"o}ttger, A. and Dombrowski, H. and Dabrowski, R. and Behnke, B. and Kessler, P. and Neumaier, S.}
}

@Article { SigrayLCBMBBAHRGCBD2018,
   subid = {904},
   title = {Calibration standards for hydrophones and autonomous underwater noise recorders for frequencies below 1 kHz: current activities of EMPIR “UNAC-LOW” project},
   journal = {ACTA IMEKO},
   year = {2018},
   month = {7},
   volume = {7},
   number = {2},
   number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz},
   pages = {32},
   keywords = {low frequency hydrophone calibration; low frequency underwater noise recorders; underwater acoustics; calibration},
   web_url = {http://dx.doi.org/10.21014/acta_imeko.v7i2.542},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IMEKO International Measurement Confederation},
   language = {30},
   ISSN = {2221-870X},
   DOI = {10.21014/acta_imeko.v7i2.542},
   stag_bib_extends_levelofaccess = {NA},
   author = {Biber, A. and \c{C}orak\c{c}ı, A.C. and Golick, A. and Robinson, S. and Hayman, G. and Ablitt, J. and Barrera-Figueroa, S. and Buogo, S. and Mauro, S. and Borsani, F. and Curcuruto, S. and Linn{\'e}, M. and Sigray, P. and Davidsson, P.}
}

@Proceedings { MohnsRFP2018,
   subid = {1043},
   title = {A Sampling-Based Ratio Bridge for Calibrating Voltage Transformers},
   journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)},
   year = {2018},
   month = {7},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {Bridge circuits, Voltage measurement, Voltage transformers, Windings, Measurement uncertainty, Uncertainty, Magnetic cores},
   tags = {SEG},
   web_url = {https://doi.org/10.1109/CPEM.2018.8501245},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   event_place = {Paris},
   event_name = {2018 Conference on Precision Electromagnetic Measurements},
   event_date = {08-07-2018 to 13-07-2018},
   language = {30},
   DOI = {10.7795/EMPIR.17NRM01.CA.20190411},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mohns, E. and Roeissle, G. and Fricke, S. and Pauling, F.}
}

@Article { LudwigSKSDGTNPFJBPKRI2018,
   subid = {900},
   title = {Development of white LED illuminants for colorimetry and recommendation of white LED reference spectrum for photometry},
   journal = {Metrologia},
   year = {2018},
   month = {6},
   day = {28},
   volume = {55},
   number = {4},
   number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products},
   pages = {526-534},
   keywords = {Photometry, colorimetry, illuminant, reference spectrum, photometer, calibration, uncertainty},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aacae7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kokka, A. and Poikonen, T. and Blattner, P. and Jost, S. and Ferrero, A. and Pulli, T. and Ngo, M. and Thorseth, A. and Gerloff, T. and Dekker, P. and Stuker, F. and Klej, A. and Ludwig, K. and Schneider, M. and Reiners, T. and Ikonen, E.}
}

@Article { WubbelerRPKHUHSKZ2018,
   subid = {1114},
   title = {Compressed sensing FTIR nano-spectroscopy and nano-imaging},
   journal = {Optics Express},
   year = {2018},
   month = {6},
   day = {28},
   volume = {26},
   number = {14},
   number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications},
   pages = {18115},
   keywords = {Infrared scattering scanning near-field optical microscopy, Optical spectroscopy, Compressed sensing},
   web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-14-18115},
   misc2 = {EMPIR 2016: Energy},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.26.018115},
   stag_bib_extends_levelofaccess = {NA},
   author = {K{\"a}stner, Bernd and Schm{\"a}hling, Franko and Hornemann, Andrea and Ulrich, Georg and Hoehl, Arne and Kruskopf, Mattias and Pierz, Klaus and Raschke, Markus B. and W{\"u}bbeler, Gerd and Elster, C.}
}

@Manual { KielerBWMRCSBSSCDOB2018,
   subid = {719},
   title = {Good Practice Guide on the operation of AC quantum voltage standards},
   year = {2018},
   month = {6},
   day = {21},
   volume = {1},
   number2 = {14RPT01: ACQ-PRO: Towards the propagation of ac quantum voltage standards},
   note = {ISBN ok https://grp.isbn-international.org/search/piid_cineca_solr/978-80-905619\%2B\%2528ISBNPrefix\%2529?keys=978-80-905619\%2B\%2528ISBNPrefix\%2529},
   keywords = {Good Practice Guide, quantum standards, alternating voltage, Josephson effect, measurement techniques, uncertainty estimation, software tools, safe operation, cryogenic equipment},
   misc2 = {EMPIR 2014: Research Potential},
   publisher = {Czech Metrology Institute},
   address = {Brno},
   language = {30},
   ISBN = {978-80-905619-2-2},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://acqpro.cmi.cz/index.php/results/28-good-practice-guide},
   author = {Kieler, O. and Behr, R. and Williams, J.M. and Malmbekk, H. and Ribeiro, L. and Cabral, V. and Sosso, A. and Bruszewski, P. and Š{\'i}ra, M. and Sanmamed, Y.A. and Caballero, R. and Diaz de Aguilar, J. and Orhan, R. and Bonfait, G.}
}

@Article { TettamanziKDRMHTRK2018,
   subid = {828},
   title = {Gigahertz Single-Electron Pumping Mediated by Parasitic States},
   journal = {Nano Letters},
   year = {2018},
   month = {6},
   day = {19},
   volume = {18},
   number = {7},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   pages = {4141-4147},
   keywords = {silicon electron pump},
   web_url = {https://arxiv.org/abs/1803.00791},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {1530-6984, 1530-6992},
   DOI = {10.1021/acs.nanolett.8b00874},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rossi, A. and Klochan, J. and Timoshenko, J. and Hudson, F.E. and M{\"o}tt{\"o}nen, M. and Rogge, S. and Dzurak, A.S. and Kashcheyevs, V. and Tettamanzi, G.C.}
}

@Article { HarrisHRB2018,
   subid = {905},
   title = {Signal-modelling methods applied to the free-field calibration of hydrophones and projectors in laboratory test tanks},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {6},
   day = {19},
   volume = {29},
   number = {8},
   number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz},
   pages = {085001},
   keywords = {underwater acoustics, transducer calibration, signal-modelling, non-linear least-squares},
   misc2 = {EMPIR 2015: Research Potential},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aac752},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, S.P. and Hayman, G. and Harris, P.M. and Beamiss, G.A.}
}

@Article { RadivojeviTSD2018,
   subid = {756},
   title = {An in situ temperature calibration of a guarded hot plate apparatus},
   journal = {Thermal Science International Scientific Journal},
   year = {2018},
   month = {6},
   day = {17},
   volume = {On line fi},
   number2 = {14RPT05: Eura-Thermal: Developing traceable capabilities in thermal metrology},
   pages = {176-186},
   keywords = {Thermal Conductivity, Guarded Hot Plate Method, Metrology, in situ temperature calibration},
   misc2 = {EMPIR 2014: Research Potential},
   publisher = {Dr. Vukman Bakić},
   language = {30},
   ISSN = {2334-7163},
   DOI = {10.2298/TSCI180425176S},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stepanic, N. and Terzic, M. and Radivojević, D. and Raković, D.}
}

@Article { MalhiARNDBOCL2018,
   subid = {959},
   title = {Realistic Forest Stand Reconstruction from Terrestrial LiDAR for Radiative Transfer Modelling},
   journal = {Remote Sensing},
   year = {2018},
   month = {6},
   day = {13},
   volume = {10},
   number = {6},
   number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate},
   pages = {933},
   keywords = {tree reconstruction, radiative transfer, terrestrial LiDAR, forestry, 3D modelling, calibration and validation, end-to-end traceability},
   web_url = {https://www.mdpi.com/2072-4292/10/6/933},
   misc2 = {EMPIR 2016: Environment},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2072-4292},
   DOI = {10.3390/rs10060933},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calders, K. and Origo, N. and Burt, A. and Disney, M. and Nightingale, J. and Raumonen, P. and {\AA}kerblom, M. and Malhi, Y. and Lewis, P.}
}

@Article { elGawharyLWNSRBF2018,
   title = {Sensitivity study of the instrumental temperature corrections on Brewer total ozone column measurements},
   journal = {Atmospheric Measurement Techniques},
   year = {2018},
   month = {6},
   day = {11},
   volume = {11},
   number = {6},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {3323-3337},
   keywords = {Brewer, instrumental temperature},
   web_url = {https://www.atmos-meas-tech.net/11/3323/2018/amt-11-3323-2018.html},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-11-3323-2018},
   stag_bib_extends_levelofaccess = {NA},
   author = {El Gawhary, O. and Le{\'o}n-Luis, S.F. and Wilson, K. and Nevas, S. and Sildoja, M.M. and Redondas, A. and Berjon, A. and Fountoulakis, I.}
}

@Article { RaaymakersKvHWvW2018,
   subid = {951},
   title = {A formalism for reference dosimetry in photon beams in the presence of a magnetic field},
   journal = {Physics in Medicine \& Biology},
   year = {2018},
   month = {6},
   day = {11},
   volume = {63},
   number = {12},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {125008},
   keywords = {Dosimetry, MRgRT, Radiotherapy, magnetic fields},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aac70e/meta},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aac70e},
   stag_bib_extends_levelofaccess = {NA},
   author = {van Asselen, B. and Woodings, S.J. and Hackett, S.L. and van Soest, T.L. and Kok, J.G.M and Raaymakers, B.W and Wolthaus, J.W.H}
}

@Article { deClercqZGRPCAB2018,
   title = {Toward a High-Stability Coherent Population Trapping Cs Vapor-Cell Atomic Clock Using Autobalanced Ramsey Spectroscopy},
   journal = {Physical Review Applied},
   year = {2018},
   month = {6},
   volume = {9},
   number = {6},
   number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications},
   keywords = {Resonance raman transition, dual-frequency laser, long-term stability, rubidium, standard; compensation, performance, shifts,},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.9.064002},
   stag_bib_extends_levelofaccess = {NA},
   author = {de Clercq, E. and Zanon-Willette, T. and Gu{\'e}randel, S. and Rocher, C. and Petersen, M. and Coget, G. and Abdel Hafiz, M. and Boudot, R.}
}

@Article { WidmaierVRLEHKL2018,
   title = {Interferometric step gauge for CMM verification},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {6},
   volume = {29},
   number = {7},
   number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems},
   pages = {074012},
   keywords = {CMM, verification, metrology},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aabd2b},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   language = {30},
   DOI = {10.1088/1361-6501/aabd2b},
   stag_bib_extends_levelofaccess = {NA},
   author = {Widmaier, T. and Viitala, R. and Rantanen, A. and Laukkanen, P. and Esala, V.P. and Hemming, B. and Kuosmanen, P. and Lassila, A.}
}

@Article { HaeringLMDRK2018,
   subid = {838},
   title = {Feasibility of polymer gel-based measurements of radiation isocenter accuracy in magnetic fields},
   journal = {Physics in Medicine \& Biology},
   year = {2018},
   month = {5},
   day = {29},
   volume = {63},
   number = {11},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {11NT02},
   keywords = {3D-dosimetry, MRgRT, gel-dosimetry},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aac228/meta},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aac228},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dorsch, S. and Mann, P. and Lang, C. and Haering, P. and Runz, A. and Karger, C.P.}
}

@Proceedings { RobinsonMCY2018,
   subid = {850},
   title = {Traceable instruments for Encircled Angular Flux measurements},
   journal = {Proc. SPIE},
   year = {2018},
   month = {5},
   day = {17},
   volume = {10683},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {106831B},
   keywords = {Encircled Angular Flux, modal distribution, far field intensity pattern, step-index fibres},
   web_url = {https://arxiv.org/abs/1806.09839},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Strasbourg},
   event_name = {Fiber Lasers and Glass Photonics: Materials through Applications},
   event_date = {22-04-2018 to 26-04-2018},
   language = {30},
   DOI = {10.1117/12.2306430},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, E. and Yang, H. and Castagna, N. and Morel, J.}
}

@Article { MihelicTDDR2018,
   title = {Comparison of the uncertainties of several European low-dose calibration facilities},
   journal = {Journal of Instrumentation},
   year = {2018},
   month = {4},
   day = {27},
   volume = {13},
   number = {04},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {P04023-P04023},
   keywords = {detector alignment and calibration methods, dosimetry concepts and apparatus, gamma detectors},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/13/04/P04023},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mihelic, M. and Toni, M.P. and D{\'i}az, N.A.C. and Dombrowski, H. and R{\"o}ttger, A.}
}

@Article { DickersonBRR2018,
   subid = {826},
   title = {Dealing with front-end white noise on differentiated measurements such as frequency and ROCOF in power systems},
   journal = {IEEE Transcations on Instrumentation and Measurement},
   year = {2018},
   month = {4},
   day = {25},
   volume = {67},
   number = {11},
   number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids},
   pages = {2579-2591},
   keywords = {Frequency measurement, noise measurement, power measurement, phase measurement, white noise, measurement uncertainty, phasor measurement units},
   web_url = {https://strathprints.strath.ac.uk/63576/},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {IEEE},
   language = {30},
   ISSN = {1557-9662},
   DOI = {10.1109/TIM.2018.2822438},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roscoe, A.J. and Blair, S.M. and Dickerson, W. and Rietveld, G.}
}

@Article { KastnerJHKPHHUFPRU2018,
   subid = {1690},
   title = {Infrared Nanospectroscopy of Phospholipid and Surfactin Monolayer Domains},
   journal = {ACS Omega},
   year = {2018},
   month = {4},
   day = {12},
   volume = {3},
   number = {4},
   number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications},
   pages = {4141-4147},
   keywords = {-},
   misc2 = {EMPIR 2016: Energy},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2470-1343, 2470-1343},
   DOI = {10.1021/acsomega.7b01931},
   stag_bib_extends_levelofaccess = {NA},
   author = {K{\"a}stner, B. and Johnson, C.M. and Hermann, P. and Kruskopf, M. and Pierz, K. and Hoehl, A. and Hornemann, A. and Ulrich, G. and Fehmel, J. and Patoka, P. and Ruhl, E. and Ulm, G.}
}

@Article { ZinziIR2018,
   subid = {982},
   title = {Lighting Implications of Urban Mitigation Strategies through Cool Pavements: Energy Savings and Visual Comfort},
   journal = {Climate},
   year = {2018},
   month = {4},
   volume = {6},
   number = {2},
   number2 = {16NRM02: SURFACE: Pavement surface characterisation for smart and efficient road lighting},
   pages = {26},
   keywords = {cool pavements; road lighting; urban heat island; road surface; material characterization; luminance coefficient; energy savings; Euramet; EMPIR 16NRM02},
   web_url = {https://www.mdpi.com/2225-1154/6/2/26},
   misc2 = {EMPIR 2016: Pre-Co-Normative},
   publisher = {Paola Iacomussi},
   language = {30},
   ISSN = {2225-1154},
   DOI = {10.3390/cli6020026},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rossi, G. and Iacomussi, P. and Zinzi, M.}
}

@Article { RedondasSSEMNKS2018,
   title = {Optical characterisation of three reference Dobsons in the ATMOZ Project – verification of G. M. B. Dobson's original specifications},
   journal = {Atmospheric Measurement Techniques},
   year = {2018},
   month = {4},
   volume = {11},
   number = {4},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {1989-1999},
   keywords = {Total Ozone Column, spectrophotometers, Dobson, slit function, effective absorption coefficents},
   web_url = {https://www.atmos-meas-tech.net/11/1989/2018/},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-11-1989-2018},
   stag_bib_extends_levelofaccess = {NA},
   author = {Redondas, A. and Stanek, M. and Smid, M. and Evans, R. and McConville, G. and Nevas, S. and K{\"o}hler, U. and Sch{\"o}nenborn, F.}
}

@Article { TabandehBSRCM2018,
   title = {Development of a low frost-point generator operating at sub-atmospheric pressure},
   journal = {Measurement Science and Technology},
   year = {2018},
   month = {3},
   day = {16},
   volume = {29},
   number = {5},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {054002},
   keywords = {hygrometry, humidity generator, frost point, upper-air sensors},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aaa785},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tabandeh, S. and Beltramino, G. and Smorgon, D. and Rosso, L. and Cuccaro, R. and Mana, G.}
}

@Article { RawsonHAS2018,
   subid = {841},
   title = {Electrochemically stimulating developments in bioelectronic medicine},
   journal = {Bioelectronic Medicine},
   year = {2018},
   month = {3},
   day = {15},
   volume = {4},
   number = {1},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   keywords = {Bioelectronic interfaces, Bioelectrochemistry, Nanobioelectronics, Cellular signalling},
   web_url = {https://link.springer.com/content/pdf/10.1186\%2Fs42234-018-0001-z.pdf},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2332-8886},
   DOI = {10.1186/s42234-018-0001-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sanjuan-Alberte, P. and Alexander, M.R. and Hague, R.J.M. and Rawson, F.J.}
}

@Article { CalonicoPTVR2018,
   subid = {589},
   title = {Phase noise cancellation in polarisation-maintaining fibre links},
   journal = {Review of Scientific Instruments},
   year = {2018},
   month = {3},
   volume = {89},
   number = {3},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {033103},
   keywords = {frequency metrology, optical fibre links},
   web_url = {http://arxiv.org/abs/1807.10818},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.5016514},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rauf, B. and V{\'e}lez L{\'o}pez, M. C. and Thoumany, P. and Pizzocaro, M. and Calonico, D.}
}

@Article { RaumonenLCBBDW2018,
   title = {Weighing trees with lasers: advances, challenges and opportunities},
   journal = {Interface Focus},
   year = {2018},
   month = {2},
   day = {16},
   volume = {8},
   number = {2},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {20170048},
   keywords = {above-ground biomass, terrestrial laser, scanning, lidar, canopy, structure, buttress},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {The Royal Society},
   language = {30},
   ISSN = {2042-8898, 2042-8901},
   DOI = {10.1098/rsfs.2017.0048},
   stag_bib_extends_levelofaccess = {NA},
   author = {Raumonen, P. and Lewis, S. L. and Calders, K. and Burt, A. and Boni Vicari, M. and Disney, M. I. and Wilkes, P.}
}

@Article { CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018,
   subid = {812},
   title = {Geodesy and metrology with a transportable optical clock},
   journal = {Nature Physics},
   year = {2018},
   month = {2},
   day = {12},
   volume = {14},
   number = {5},
   number2 = {SIB55: ITOC: International timescales with optical clocks},
   pages = {437-441},
   keywords = {optical fiber, optical frequency transfer},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1745-2473, 1745-2481},
   DOI = {10.1038/s41567-017-0042-3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Costanzo, G.A. and Zucco, M. and Barbieri, P. and Tampellini, A. and Bregolin, F. and Rauf, B. and Pizzocaro, M. and Thoumany, P. and Margolis, H.S. and Zampaolo, M. and Rolland, A. and Baynes, F.N. and Timmen, L. and Denker, H. and Voigt, C. and Lisdat, C. and H{\"a}fner, S. and Sterr, U. and Vogt, S. and Koller, S. and Grotti, J. and Clivati, C. and Levi, F. and Calonico, D.}
}

@Article { HollandtMGRDv2018,
   title = {Traceability of the Network for Detection of the Mesospheric Change (NDMC) to radiometric standards via a Near Infrared Filter Radiometer},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {2},
   volume = {972},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {012006},
   keywords = {Traceability, radiometric standards},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/972/1/012006},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hollandt, J. and Monte, C. and Gutschwager, B. and Reiniger, M. and Dekker, P. and van den Berg, S.}
}

@Article { PeyresERHVPLMGDMC2018,
   title = {Measurement of absolute \(\gamma\)-ray emission probabilities in the decay of  235 U},
   journal = {Applied Radiation and Isotopes},
   year = {2018},
   month = {2},
   volume = {132},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {72-78},
   keywords = {\(\gamma\)-ray spectrometry, 235U, 231Th, Decay data, \(\gamma\)-ray emission probabilities, NORM},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.10.049},
   stag_bib_extends_levelofaccess = {NA},
   author = {Peyres, V. and Eykens, R. and Richter, S. and Hult, M. and Van Ammel, R. and Pomm{\'e}, S. and Lutter, G. and Marouli, M. and Garc{\'i}a-Tora{\~n}o, E. and Dry{\'a}k, P. and Maz{\'a}nov{\'a}, M. and Carconi, P.}
}

@Article { HenaultCLDRBFMBH2018,
   subid = {374},
   title = {A metrological comparison of Raman-distributed temperature sensors},
   journal = {Measurement},
   year = {2018},
   month = {2},
   volume = {116},
   number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities},
   pages = {18-24},
   keywords = {Distributed temperature sensors; Raman; Metrology; Structural health monitoring; Optical fibres},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0263224117306656},
   misc2 = {EMPIR 2016: Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0263-2241},
   DOI = {10.1016/j.measurement.2017.10.041},
   stag_bib_extends_levelofaccess = {NA},
   author = {Failleau, G. and Beaumont, O. and Razouk, R. and Delepine-Lesoille, S. and Landolt, M. and Courthial, B. and H{\'e}nault, J.M. and Martinot, F. and Bertrand, J. and Hay, B.}
}

@Article { StevenSRPGGGHPTB2018,
   title = {A calibration procedure for a traceable contamination analysis on medical devices by combined X-ray spectrometry and ambient spectroscopic techniques},
   journal = {Journal of Pharmaceutical and Biomedical Analysis},
   year = {2018},
   month = {2},
   volume = {150},
   number = {1},
   number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry},
   pages = {308-317},
   keywords = {XRF; Reference-free; N,N’-ethylene-bis (stearamide); Vibrational spectroscopy; Medical device},
   web_url = {https://www.sciencedirect.com/science/article/abs/pii/S0731708517310609},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0731-7085},
   DOI = {10.1016/j.jpba.2017.12.007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Steven, R. and Seim, C. and Rossi, A. and Portesi, C. and Gunning, P. and Green, F. and Giovannozzi, A.M. and Hornemann, A. and Pollakowski-Herrmann, B. and Tyler, B. and Beckhoff, B.}
}

@Article { HoferLRK2018,
   subid = {588},
   title = {The absolutely characterized nitrogen vacancy center-based single-photon source – measurement uncertainty of photon flux and angular emission properties},
   journal = {Journal of Physics: Conference Series},
   year = {2018},
   month = {2},
   volume = {972},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {012008},
   keywords = {single-photon source, Photon f,lux, measurement uncertainty, emission characterisitics},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/972/1/012008/pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/972/1/012008},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rodiek, B and L{\'o}pez, M and Hofer, H and K{\"u}ck, S}
}

@Article { ReitzensteinHRSKSFS2018_2,
   subid = {695},
   title = {A stand-alone fiber-coupled single-photon source},
   journal = {Scientific Reports},
   year = {2018},
   month = {1},
   day = {22},
   volume = {8},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {1340},
   keywords = {quantum-light source, semiconductor quantum dots},
   web_url = {https://www.nature.com/articles/s41598-017-19049-4},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-19049-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schlehahn, A. and Fischbach, S. and Schmidt, R. and Kaganskiy, A. and Strittmatter, A. and Rodt, S. and Heindel, T. and Reitzenstein, S.}
}

@Article { BarlowLR2018,
   subid = {820},
   title = {Thermography based online characterization of conductive thin films in large-scale electronics fabrication},
   journal = {Optics Express},
   year = {2018},
   month = {1},
   day = {11},
   volume = {26},
   number = {2},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {1219},
   keywords = {Flexible electronics, thin film based technology, quality assessment, thin film electronics, synchronized thermography, roll-to-roll},
   web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-2-1219},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.26.001219},
   stag_bib_extends_levelofaccess = {NA},
   author = {Remes, K. and Remes, K. and Lepp{\"a}nen, K.}
}

@Article { VermesseSLDBROGDDPDSGCP2018,
   title = {Feasibility of using a dose-area product ratio as beam quality specifier for photon beams with small field sizes},
   journal = {Physica Medica},
   year = {2018},
   month = {1},
   volume = {45},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {106-116},
   keywords = {Dose-area product, Beam quality, DAP ratio, Small photon beams},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1120-1797},
   DOI = {10.1016/j.ejmp.2017.12.012},
   stag_bib_extends_levelofaccess = {NA},
   author = {Vermesse, D. and Sommier, L. and Le Roy, M. and Daures, J. and Bordy, J.M. and Rapp, B. and Ostrowsky, A. and Gouriou, J. and Dufreneix, S. and Delaunay, F. and Petrucci, A. and De Coste, V. and Silvi, L. and Guerra, A.S. and Caporali, C. and Pimpinella, M.}
}

@Article { PortesiGISR2018,
   subid = {847},
   title = {Development of a candidate reference sample for the characterization of tip-enhanced Raman spectroscopy spatial resolution},
   journal = {RSC Advances},
   year = {2018},
   volume = {8},
   number = {49},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {27863-27869},
   keywords = {Tip-Enhanced Raman Spectroscopy (TERS); Scanning Probe Microscopy (SPM); Localized Surface Plasmon Resonance (LSPR); Electron Beam Lithography (EBL); STM-TERS imaging},
   web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra03762k},
   misc2 = {EMPIR 2015: Health},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2046-2069},
   DOI = {10.1039/c8ra03762k},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sacco, A. and Imbraguglio, D. and Giovannozzi, A.M. and Portesi, C. and Rossi, A.M.}
}

@Thesis { Rauf2018,
   subid = {580},
   title = {Absolute frequency measurement of an 171Yb lattice clock and optical clock comparisons},
   year = {2018},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   keywords = {Optical lattice clocks},
   web_url = {http://hdl.handle.net/11583/2708557},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Politecnico di Torino},
   school = {Politecnico di Torino},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rauf, B.}
}

@Article { AlexanderWWNRPHH2018,
   subid = {844},
   title = {Effect of surfactant on Pseudomonas aeruginosa colonization of polymer microparticles and flat films},
   journal = {RSC Advances},
   year = {2018},
   volume = {8},
   number = {28},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {15352-15357},
   keywords = {nanoparticles, polymer microparticles, polymerizable monomer},
   web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra01491d},
   misc2 = {EMPIR 2015: Health},
   publisher = {Royal Society of Chemistry (RSC)},
   language = {30},
   ISSN = {2046-2069},
   DOI = {10.1039/C8RA01491D},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"u}sler, A. and Haas, S. and Parry, L. and Romero, M. and Nisisako, T. and Williams, P. and Wildman, R.D. and Alexander, M.R.}
}

@Article { RockstuhlRLZGAAP2018,
   subid = {869},
   title = {Rigorous wave-optical treatment of photon recycling in thermodynamics of photovoltaics: Perovskite thin-film solar cells},
   journal = {Phys. Rev. B},
   year = {2018},
   volume = {98},
   number = {7},
   number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications},
   pages = {075141},
   keywords = {Geometrical \& wave optics, Interference \& diffraction of light, Light propagation, transmission \& absorption, Light-matter interaction, Luminescence, Nanophotonics, ,Optoelectronics, Spontaneous emission},
   web_url = {https://arxiv.org/abs/1804.02230},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Physical Society},
   language = {30},
   DOI = {10.1103/PhysRevB.98.075141},
   stag_bib_extends_levelofaccess = {NA},
   author = {Abebe, M.G. and Abass, A. and Gomard, G.  and Zschiedrich, L. and Lemmer, U. and Richards, B.S.  and Rockstuhl, C. and Paetzold, U.W. }
}

@Article { BurnsRMNBFLADYHR2017,
   subid = {499},
   title = {Antimicrobial peptide capsids of de novo design},
   journal = {Nature Communications},
   year = {2017},
   month = {12},
   day = {22},
   volume = {8},
   number = {1},
   number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance},
   pages = {2263},
   keywords = {Antimicrobials, Protein design, Self-assembly, Biometrology},
   misc2 = {EMPIR 2015: Health},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/s41467-017-02475-3},
   stag_bib_extends_levelofaccess = {NA},
   author = {De Santis, E. and Alkassem, H. and Lamarre, B. and Faruqui, N. and Bella, A. and Noble, J.E. and Micale, N. and Ray, S. and Burns, J.R. and Yon, A.R. and Hoogenboom, B.W. and Ryadnov, M.G.}
}

@Article { RuizCMPB2017,
   subid = {819},
   title = {Characterization of the reference wave in a compact digital holographic camera},
   journal = {Applied Optics},
   year = {2017},
   month = {12},
   day = {18},
   volume = {57},
   number = {1},
   number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing},
   pages = {A235-A241},
   keywords = {holographic, reference wave, optical holography,},
   web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-57-1-A235},
   misc2 = {EMPIR 2014: Industry},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1559-128X, 2155-3165},
   DOI = {10.1364/AO.57.00A235},
   stag_bib_extends_levelofaccess = {NA},
   author = {Park, I.S. and Middleton, R.J.C. and Coggrave, C.R. and Ruiz, P.D. and Coupland, J M}
}

@Article { SterrRZSOBHLYMR2017,
   subid = {720},
   title = {Ultrastable Silicon Cavity in a Continuously Operating Closed-Cycle Cryostat at 4 K},
   journal = {Physical Review Letters},
   year = {2017},
   month = {12},
   day = {15},
   volume = {119},
   number = {24},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   keywords = {ultrastable laser, silicon cavity, 4K cryocooler, time and frequency standards},
   web_url = {https://arxiv.org/abs/1708.05161},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.119.243601},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhang, W. and Robinson, J. M. and Sonderhouse, L. and Oelker, E. and Benko, C. and Hall, J. L. and Legero, T. and Matei, D. G. and Riehle, F. and Sterr, U. and Ye, J.}
}

@Proceedings { RidlerCL2017_2,
   subid = {519},
   title = {An intra-laboratory investigation of on-wafer measurement reproducibility at millimeter-wave frequencies},
   journal = {2017 90th ARFTG Microwave Measurement Symposium (ARFTG)},
   year = {2017},
   month = {11},
   day = {30},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Measurement repeatability, Measurement reproducibility, On-wafer measurements, Millimeter-wave measurements, Measurement uncertainty},
   web_url = {http://eprints.whiterose.ac.uk/125336/},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   address = {445 Hoes Lane Piscataway NJ 08855-1331 United States},
   event_place = {Boulder, Colorado},
   event_name = {ARFTG 90th Microwave Measurement Conference},
   event_date = {28-11-2017 to 01-12-2017},
   language = {30},
   ISBN = {978-1-5386-4356-3},
   DOI = {10.1109/arftg.2017.8255866},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clarke, R G and Li, C and Ridler, N M}
}

@Article { NordlundKRR2017,
   title = {Atomistic simulation of the measurement of mechanical properties of gold nanorods by AFM},
   journal = {Scientific Reports},
   year = {2017},
   month = {11},
   day = {24},
   volume = {7},
   number = {1},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   keywords = {AFM, gold nanorods, nanowires},
   web_url = {https://www.nature.com/articles/s41598-017-16460-9},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-16460-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nordlund, K. and Kuronen, A. and Rohl, A.L. and Reischl, B}
}

@Article { FountoulakisFGKKKHFDBBLRF2017,
   title = {Temperature dependence of the Brewer global UV measurements},
   journal = {Atmospheric Measurement Techniques},
   year = {2017},
   month = {11},
   day = {22},
   volume = {10},
   number = {11},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {4491-4505},
   keywords = {Brewer spectrophotometer, temperature characterization, UV radiation},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-10-4491-2017},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fountoulakis, I. and Fragkos, K. and Garane, K. and Koskela, T. and Karhu, J.M. and Karppinen, T. and Heikkila, A. and Feister, U. and Doppler, L. and Bais, A.F. and Berjon, A. and Lakkala, K. and Redondas, A. and Fountoulakis, I.}
}

@Article { EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017,
   subid = {602},
   title = {First patients treated with a 1.5 T MRI-Linac: clinical proof of concept of a high-precision, high-field MRI guided radiotherapy treatment},
   journal = {Physics in Medicine \& Biology},
   year = {2017},
   month = {11},
   day = {14},
   volume = {62},
   number = {23},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {L41-L50},
   keywords = {MRgRT, Radiotherapy, MRI},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1361-6560},
   DOI = {10.1088/1361-6560/aa9517},
   stag_bib_extends_levelofaccess = {NA},
   author = {Raaymakers, B W and J{\"u}rgenliemk-Schulz, I M and Bol, G H and Glitzner, M and Kotte, A N T J and van Asselen, B and de Boer, J C J and Bluemink, J J and Hackett, S L and Moerland, M A and Woodings, S J and Wolthaus, J W H and van Zijp, H M and Philippens, M E P and Tijssen, R and Kok, J G M and de Groot-van Breugel, E N and Kiekebosch, I and Meijers, L T C and Nomden, C N and Sikkes, G G and Doornaert, P A H and Eppinga, W S C and Kasperts, N and Kerkmeijer, L G W and Tersteeg, J H A and Brown, K J and Pais, B and Woodhead, P and Lagendijk, J J W}
}

@Article { SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017,
   title = {The MeteoMet2 project – Highlights and results},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {11},
   day = {13},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   keywords = {Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa99fc},
   stag_bib_extends_levelofaccess = {NA},
   author = {Šindel{\'a}rov{\'a}, L. and Sestan, D. and Salminen, J. and Sairanen, H. and Rosso, L. and del Rio, J. and Rasmussen, M.K. and Oguz Aytekin, S. and de Podesta, M. and Pavlasek, P. and Nogueras Cervera, M. and Nielsen, J. and Musacchio, C. and Miao, P. and Lanza, L.G. and Kowal, A. and Kalemci, M. and Hudoklin, D. and H{\"o}gstr{\"o}m, R. and Hernandez de la Villa, S. and Heinonen, M. and Groselj, D. and Gonzalez Calvo, A. and Georgin, E. and Gardiner, T. and Garc{\'i}a Izquierdo, C. and Garcia-Benad{\'i}, A. and Fernicola, V and Ebert, V. and Drnovsek, J. and Dobre, M. and Cuccaro, R. and Coppa, G. and Colli, M. and Chiodo, N. and Castrillo, A. and del Campo, D. and Brunet, M. and Bojkovski, J. and Beltramino, G. and Bell, S.A. and Beges, G. and Sanna, F. and Merlone, A. and Smorgon, D. and Sparasci, F. and Strnad, R. and Vold{\'a}n, M. and Underwood, R.J. and Mana, G.}
}

@Proceedings { SalterCR2017,
   subid = {528},
   title = {'Mind the Gap'... Establishing Measurement Capability in the Terahertz Gap Region - from 0.1 THz to 1.1 THz},
   journal = {ARMMS RF \& Microwave Society Conference, 13-14 Nov, 2017, Wyboston, Bedfordshire},
   year = {2017},
   month = {11},
   day = {13},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {measurement, state-of-the-art of measurements, 0.1 THz to 1.1 THz frequency range, rectangular metallic waveguides, on-wafer planar circuits, bult material  characterisations, Terahertz Gap},
   web_url = {http://eprints.whiterose.ac.uk/125335/},
   misc2 = {EMPIR 2014: Industry},
   publisher = {ARMMS},
   event_place = {Wyboston, Bedfordshire, UK},
   event_name = {ARMMS RF \& Microwave Society Conference},
   event_date = {13-11-2017 to 14-11-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://eprints.whiterose.ac.uk/125335/},
   author = {Salter, M J  and Clarke, R G and Ridler, N M}
}

@Article { ZhaoRGFHMKF2017,
   subid = {405},
   title = {Thermal-Error Regime in High-Accuracy Gigahertz Single-Electron Pumping},
   journal = {Physical Review Applied},
   year = {2017},
   month = {10},
   day = {30},
   volume = {8},
   number = {4},
   number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere},
   keywords = {Single electron pumps},
   web_url = {https://arxiv.org/abs/1703.04795},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {2331-7019},
   DOI = {10.1103/PhysRevApplied.8.044021},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhao, R. and Rossi, A. and Giblin, S. P. and Fletcher, J. D. and Fletcher, J. and Hudson, F. E. and M{\"o}tt{\"o}nen, M. and Kataoka, M.}
}

@Article { KesslerDDRN2017,
   title = {Detection of rain events in radiological early warning networks with spectro-dosimetric systems},
   journal = {Journal of Instrumentation},
   year = {2017},
   month = {10},
   day = {12},
   volume = {12},
   number = {10},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {P10005-P10005},
   keywords = {gamma detectors (scintillators, CZT, HPG, HgI etc), models and simulations, radiation monitoring},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1748-0221},
   DOI = {10.1088/1748-0221/12/10/P10005},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kessler, P. and Dombrowski, H. and Dabrowski, R. and R{\"o}ttger, A. and Neumaier, S.}
}

@Proceedings { HoogenboomAHR2017,
   subid = {391},
   title = {Meeting ecodesign efficiency requirements: ensuring accuracy in power transformer loss tests via TLM system calibrations},
   journal = {CIRED - Open Access Proceedings Journal},
   year = {2017},
   month = {10},
   volume = {2017},
   number = {1},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   pages = {329-332},
   keywords = {power transformer testing power factor; error sources; Ecodesign Directive; sustainable energy policies; high-quality TLM systems; efficiency requirements; power transformer loss test; TLM system calibration; transformer loss measurement systems; EU; calibration accuracies; advanced digital signal processing technique; ecodesign efficiency requirement},
   tags = {SEG},
   web_url = {http://digital-library.theiet.org/content/journals/10.1049/oap-cired.2017.0475},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Institution of Engineering and Technology (IET)},
   event_place = {Scottish Event Campus (SEC), Glasgow, Scotland},
   event_name = {CIRED 2017},
   event_date = {12-06-2017 to 15-06-2017},
   language = {30},
   ISSN = {2515-0855},
   DOI = {10.1049/oap-cired.2017.0475},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, G. and Houtzager, E. and Acanski, M. and Hoogenboom, D.}
}

@Proceedings { RietveldJPS2017,
   subid = {827},
   title = {PMU-based power system analysis of a medium-voltage distribution grid},
   journal = {CIRED - Open Access Proceedings Journal},
   year = {2017},
   month = {10},
   volume = {2017},
   number = {1},
   number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids},
   pages = {1927-1930},
   keywords = {phasor measurement, distribution networks, power grids, load flow, data acquisition},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {Institution of Engineering and Technology (IET)},
   event_place = {Glasgow},
   event_name = {CIRED},
   event_date = {12-06-2017 to 15-06-2017},
   language = {30},
   ISSN = {2515-0855},
   DOI = {10.1049/oap-cired.2017.1035},
   stag_bib_extends_levelofaccess = {NA},
   author = {Save, N. and Popov, M. and Jongepier, A. and Rietveld, G.}
}

@Inbook { GillBRBBNKJGBM2017,
   subid = {379},
   title = {Absolute frequency measurement of the  optical clock transition in 171Yb+ with an uncertainty of 4E-16 using a frequency link to international atomic time},
   year = {2017},
   month = {10},
   volume = {65},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {221-227},
   keywords = {Frequency metrology, optical frequency standards, international atomic time},
   web_url = {http://empir.npl.co.uk/oc18/wp-content/uploads/sites/13/2016/04/Yb_J_Mod_Op.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Informa UK Limited},
   booktitle = {Journal of Modern Optics},
   language = {30},
   ISBN = {0950-0340, 1362-3044},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1707.00646v2},
   author = {Gill, P. and Bongs, K. and Rolland, A. and Baird, P.E.G. and Baynes, F. and Nisbet-Jones, P.B.R. and King, S.A. and Jones, J.M. and Godun, R.M. and Baynham, C.F.A. and Margolis, H.S.}
}

@Article { LestremauLKvBMBCBRYAB2017,
   title = {Suitability of vessels and adsorbents for the short-term storage of biogas/biomethane for the determination of impurities – Siloxanes, sulfur compounds, halogenated hydrocarbons, BTEX},
   journal = {Biomass and Bioenergy},
   year = {2017},
   month = {10},
   volume = {105},
   number2 = {ENG54: Biogas: Metrology for biogas},
   pages = {127-135},
   keywords = {BiogasCompositionImpuritiesVesselsSampling},
   tags = {EnG},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0961953417302118},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   DOI = {10.1016/j.biombioe.2017.06.025},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lestremau, F. and Li, J. and Krom, I. and van der Veen, A.M.H. and Brewer, B. and Murugan, A. and Bartlett, S. and Culleton, L. and B{\"u}ker, O. and Rosell, L. and Yaghooby, H. and Arrhenius, K. and Beranek, J.}
}

@Article { KabrtSBMRW2017,
   title = {Production and characterization of a traceable NORM material and its use in proficiency testing of gamma-ray spectrometry laboratories},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {9},
   day = {18},
   volume = {134},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {45-50},
   keywords = {Environmental radioactivity; Gamma-ray spectrometry; NORM; Reference material; Intercomparison; Interlaboratory comparison; Proficiency testing; Quartz sand; Drinking water treatment; Natural radionuclides},
   web_url = {https://www.sciencedirect.com/science/article/pii/S0969804317305158},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier},
   language = {30},
   DOI = {10.1016/j.apradiso.2017.09.025},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kabrt, F. and Stietka, M. and Baumgartner, A. and Maringer, F.J. and Riedl, J. and Wiedner, H.}
}

@Article { RiechelmannHEKGS2017,
   title = {The high-resolution extraterrestrial solar spectrum (QASUMEFTS) determined from ground-based solar irradiance measurements},
   journal = {Atmospheric Measurement Techniques},
   year = {2017},
   month = {9},
   day = {15},
   volume = {10},
   number = {9},
   number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone},
   pages = {3375-3383},
   keywords = {extraterrestrail spectrum, QASUMEFTS, QASUME},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1867-8548},
   DOI = {10.5194/amt-10-3375-2017},
   stag_bib_extends_levelofaccess = {NA},
   author = {Riechelmann, S. and H{\"u}lsen, G. and Egli, L. and Kr{\"o}ger, I. and Gr{\"o}bner, J. and Sperfeld, P.}
}

@Article { RobinsonIHG2017,
   title = {Field Validation of Remote Sensing Methane Emission Measurements},
   journal = {Remote Sensing},
   year = {2017},
   month = {9},
   day = {14},
   volume = {9},
   number = {9},
   number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions},
   pages = {956},
   keywords = {validation; emission measurements; DIAL; remote measurements; methane},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {2072-4292},
   DOI = {10.3390/rs9090956},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, R. and Innocenti, F. and Helmore, J. and Gardiner, T.}
}

@Article { SeguiniMLZIFDPRDB2017,
   subid = {480},
   title = {Influence of block copolymer feature size on reactive ion etching pattern transfer into silicon},
   journal = {Nanotechnology},
   year = {2017},
   month = {9},
   day = {12},
   volume = {28},
   number = {40},
   number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies},
   pages = {404001},
   keywords = {block copolymers, reactive ion etching, self-assembly, cryogenic RIE, holey silicon},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6528/aa8144},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-4484, 1361-6528},
   DOI = {10.1088/1361-6528/aa8144},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dialameh, M. and Ferrarese Lupi, F. and Imbraguglio, D. and Zanenga, F. and Lamperti, A. and Martella, D. and Seguini, G. and Perego, M. and Rossi, A.M. and De Leo, N. and Boarino, L.}
}

@Proceedings { KirkhamLMDRM2017,
   subid = {859},
   title = {The Case for Redefinition of Frequency and ROCOF to Account for AC Power System Phase Steps},
   journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2017},
   month = {9},
   number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids},
   keywords = {Phasor measurement units, frequency control, circuit faults, relays, time-frequency analysis, time measurement},
   web_url = {https://strathprints.strath.ac.uk/61522/},
   misc2 = {EMPIR 2015: Pre-Co-Normative},
   publisher = {IEEE},
   event_place = {Liverpool, United Kingdom},
   event_name = {Applied Measurements for Power Systems},
   event_date = {20-09-2017 to 22-09-2017},
   language = {30},
   ISBN = {978-1-5386-0343-7},
   ISSN = {2475-2304},
   DOI = {10.1109/AMPS.2017.8078330},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roscoe, A.J. and Dysko, A. and Marshall, B. and Lee, M. and Kirkham, H. and Rietveld, G.}
}

@Article { RotellaCMMVIDLNRSN2017,
   title = {Elemental depth profiling in transparent conducting oxide thin film by X-ray reflectivity and grazing incidence X-ray fluorescence combined analysis},
   journal = {Spectrochimica Acta Part B: Atomic Spectroscopy},
   year = {2017},
   month = {9},
   volume = {135},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {22-28},
   keywords = {Combined >XRR-GIXRF, Depth profiling, thin films, TCO},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0584-8547},
   DOI = {10.1016/j.sab.2017.06.011},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rotella, H. and Caby, B. and M{\'e}nesguen, Y. and Mazel, Y. and Valla, A. and Ingerle, D. and Detlefs, B. and L{\'e}py, M.-C. and Novikova, A. and Rodriguez, G. and Streli, C. and Nolot, E.}
}

@Article { MoldersBHMRR2017,
   title = {Reproducibly emitting reference material on thermoplastic polyurethane basis for quality assurance/quality control of emission test chamber measurements},
   journal = {Building and Environment},
   year = {2017},
   month = {9},
   volume = {122},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   pages = {230-236},
   keywords = {Reference material, Emissions testing, Volatile Organic Compounds, Polymeric material, CO2 assisted impregnation},
   web_url = {https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/40646},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   address = {230 Park Avenue Suite 800 Shantae McGee 360 Park Avenue South New York NY 10169-0935 United States},
   language = {30},
   ISSN = {0360-1323},
   DOI = {10.1016/j.buildenv.2017.06.005},
   stag_bib_extends_levelofaccess = {NA},
   author = {M{\"o}lders, Nils and Br{\"o}dner, Doris and Horn, Wolfgang and Mull, Birte and Richter, Matthias and Renner, Manfred}
}

@Article { BrodnerHSSMR2017,
   title = {Reproducibly emitting reference materials for volatile and semi-volatile organic compounds—using finite element modeling for emission predictions},
   journal = {Air Quality, Atmosphere \& Health},
   year = {2017},
   month = {9},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   keywords = {Emitting reference material, Emission test chamber, Micro-chamber, FEM model},
   web_url = {https://link.springer.com/article/10.1007/s11869-017-0508-6},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1873-9318, 1873-9326},
   DOI = {10.1007/s11869-017-0508-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Br{\"o}dner, Doris and Horn, Wolfgang and Schultealbert, Caroline and Sauerwald, Tilman and Mull, Birte and Richter, Matthias}
}

@Article { FailleauHHPSRBZARGVSSKSPLG2017,
   title = {Metrology for decommissioning nuclear facilities: Partial outcomes of joint research project within the European Metrology Research Program},
   journal = {Applied Radiation and Isotopes},
   year = {2017},
   month = {9},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   keywords = {Decommissioning, Sample preparation, Metrology},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2017.08.032},
   stag_bib_extends_levelofaccess = {NA},
   author = {Failleau, G. and Hay, B. and Holm, P. and Per{\"a}j{\"a}rvi, K. and Sand, J. and Rogiers, B. and Boden, S. and Zapata-Garc{\'i}a, D. and Arnold, D. and Russell, B. and Garcia Miranda, M. and Van Ammel, R. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Plumeri, S. and Laurent Beck, Y. and Grisa, T.}
}

@Article { AntonanzasTorresGPLRTHKGU2017,
   title = {Extensive validation of CM SAF surface radiation products over Europe},
   journal = {Remote Sensing of Environment},
   year = {2017},
   month = {9},
   volume = {199},
   number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification},
   pages = {171-186},
   keywords = {Satellite-based models, Global horizontal irradiance, CM SAF, Solar radiation data, Pyranometer},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0034-4257},
   DOI = {10.1016/j.rse.2017.07.013},
   stag_bib_extends_levelofaccess = {NA},
   author = {Antonanzas-Torres, F. and Gottschalg, R. and Palmer, D. and Lindfors, A. and Riihel{\"a}, A. and Trentmann, J. and Huld, T. and Koubli, E. and Gracia-Amillo, A.M. and Urraca, R.}
}

@Proceedings { ClarksonCHRS2017,
   title = {Validation of Algorithms to Estimate Distribution Network Characteristics Using Power-Hardware-in-the-Loop Configuration},
   journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2017},
   month = {9},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   keywords = {Network topology, Topology, Substations, Estimation, Current measurement, voltage measurement, Load flow},
   tags = {SEG},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   event_place = {Liverpool, United Kingdom},
   event_name = {Applied Measurements for Power Systems},
   event_date = {20-09-2017 to 22-09-2017},
   language = {30},
   ISBN = {978-1-5386-0343-7},
   ISSN = {2475-2304},
   DOI = {10.1109/AMPS.2017.8078349},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clarkson, P. and Chretien, S. and Hong, Q. and Rohouma, I. and Segovia, M.}
}

@Article { ChoiGIBFBGRPH2017,
   title = {Effect of Handling, Packing and Transportation on the Moisture of Timber Wood},
   journal = {International Journal of Thermophysics},
   year = {2017},
   month = {8},
   day = {29},
   volume = {38},
   number = {10},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   keywords = {Effect of ambient humidity, Moisture content, Timber wood,Transportation, Wood handling},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-017-2292-9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Choi, B.I. and Gelil, D.A.E. and Ismail, N. and Beltramino, G. and Fernicola, V. and Ben Ayoub, M.W. and Georgin, E. and Rudolfov{\'a}, M. and Palkova, Z. and Heinonen, M.}
}

@Proceedings { HoutzagerR2017,
   subid = {466},
   title = {High-accuracy reference setup for system calibration of transformer loss measurement systems},
   journal = {e-cigre.org},
   year = {2017},
   month = {8},
   day = {28},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   keywords = {Transformer loss, reference measuring system,},
   tags = {SEG},
   misc2 = {EMPIR 2014: Industry},
   event_place = {Buenos Aires, Argentina},
   event_name = {International symposium on high-voltage engineering 2017},
   event_date = {28-08-2017 to 01-09-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_610-high-accuracy-reference-setup-for-system-calibration-of-transformer-loss-measurement-systems},
   author = {Houtzager, E. and Rietveld, G.}
}

@Article { DegiovanniAPRLVTGBCVG2017,
   subid = {334},
   title = {Determining the quantum expectation value by measuring a single photon},
   journal = {Nature Physics},
   year = {2017},
   month = {8},
   day = {14},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {4},
   keywords = {Protective Measurements, Weak Measurements},
   web_url = {https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf;},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {1745-2473, 1745-2481},
   DOI = {10.1038/nphys4223},
   stag_bib_extends_levelofaccess = {NA},
   author = {Piacentini, F. and Avella, A. and Rebufello, E. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.}
}

@Article { GuardamagnaLINCRCS2017,
   title = {Accurate particle speed prediction by improved particle speed measurement and 3-dimensional particle size and shape characterization technique},
   journal = {Powder Technology},
   year = {2017},
   month = {8},
   volume = {318},
   number = {2017},
   number2 = {IND61: Metrosion: Metrology to enable high temperature erosion testing},
   pages = {95-109},
   keywords = {Computed tomography, Particle shape, Particle size, Particle velocity, Shadow imaging, Sphericity},
   web_url = {http://findit.dtu.dk/en/catalog/2363396961\&\#10;http://www.sciencedirect.com/science/article/pii/S0032591017304412},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0032-5910},
   DOI = {10.1016/j.powtec.2017.05.042},
   stag_bib_extends_levelofaccess = {NA},
   author = {Guardamagna, C. and Lorenzoni, L. and Illemann, J. and Neuschaefer-Rube, U. and Clausen, S. and Rothleitner, C. and Cernuschi, F. and Skinner, E.}
}

@Article { NeuVSMSRGCPK2017,
   subid = {581},
   title = {Calibration of multi-layered probes with low/high magnetic moments},
   journal = {Scientific Reports},
   year = {2017},
   month = {8},
   volume = {7},
   number = {1},
   number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements},
   pages = {7224},
   keywords = {Magnetic straz field, Magnetic force microscopy, multi-layered probe, Hall sensor.},
   web_url = {https://www.nature.com/articles/s41598-017-07327-0},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/s41598-017-07327-0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Panchal, V. and Corte-Le{\'o}n, H. and Gribkov, B. and Rodriguez, L.A. and Snoeck, E. and Manzin, A. and Simonetto, E. and Vock, S. and Neu, V. and Kazakova, O.}
}

@Article { DuaneFSBGSBR2017,
   subid = {429},
   title = {Reply to Comment on ‘Development of a primary standard for absorbed dose from unsealed radionuclide solutions’},
   journal = {Metrologia},
   year = {2017},
   month = {7},
   day = {27},
   volume = {54},
   number = {4},
   number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy},
   pages = {615-616},
   keywords = {dosimetry, radionuclide solution, extrapolation chamber, primary standard,validation of dose calculation},
   web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa78ff/meta},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa78ff},
   stag_bib_extends_levelofaccess = {NA},
   author = {Billas, I and Shipley, D and Galer, S and Bass, G and Sander, T and Fenwick, A and Duane, S and Smyth, V.}
}

@Article { RajteriTF2017,
   title = {LEDs: Sources and Intrinsically Bandwidth-Limited Detectors},
   journal = {Sensors},
   year = {2017},
   month = {7},
   day = {20},
   volume = {17},
   number = {7},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {1673},
   keywords = {LED; light emitting diode; photodetector; radiometer; LED detector},
   web_url = {http://www.mdpi.com/1424-8220/17/7/1673},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {MDPI AG},
   language = {30},
   ISSN = {1424-8220},
   DOI = {10.3390/s17071673},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rajteri, M. and Taralli, E. and Filippo, R.}
}

@Article { RuhlBTRFUPKHKHU2017,
   subid = {848},
   title = {Enhancing the sensitivity of nano-FTIR spectroscopy},
   journal = {Optics Express},
   year = {2017},
   month = {7},
   volume = {25},
   number = {14},
   number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance},
   pages = {16574},
   keywords = {Instrumentation, measurement, and metrology; Near-field microscopy},
   web_url = {https://www.osapublishing.org/DirectPDFAccess/158D237A-A0E8-5960-84426107CE1CBCF4_369006/oe-25-14-16574.pdf?da=1\&id=369006\&seq=0\&mobile=no},
   misc2 = {EMPIR 2015: Health},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.25.016574},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hermann, P. and K{\"a}stner, B. and Hoehl, A. and Kashcheyevs, V. and Patoka, P. and Ulrich, G. and Feikes, J. and Ries, M. and Tydecks, T. and Beckhoff, B. and Ruhl, E. and Ulm, G.}
}

@Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017,
   subid = {477},
   title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks},
   journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)},
   year = {2017},
   month = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   keywords = {optical fibre, network, clock, time, dissemination, service},
   web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/FCS.2017.8089004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Krehlik, P. and Śliwczyński, L. and Dostal, J. and Radil, J. and Smotlacha, V. and Velc, R. and Vojtech, J. and Campanella, M. and Calonico, D. and Clivati, C. and Levi, F. and Č{\'i}p, O. and Rerucha, S. and Holzwarth, R. and Lessing, M. and Camargo, F. and Desruelle, B. and Lautier-Gaud, J. and English, E.L. and Kronj{\"a}ger, J. and Whibberley, P. and Pottie, P.E. and Tavares, R. and Tuckey, P. and John, F. and Snajder, M. and Stefl, J. and Nogaś, P. and Urbaniak, R. and Binczewski, A. and Bogacki, W. and Turza, K. and Grosche, G. and Schnatz, H. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.}
}

@Article { FrigoRDHC2017,
   title = {Metrological characterization of a PMU calibrator in the 25 Hz to 3 kHz range},
   journal = {2017 IEEE Manchester PowerTech},
   year = {2017},
   month = {6},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   keywords = {Phasor Measurement Unit (PMU), PMU calibrator, distribution networks, IEEE C37.118},
   web_url = {http://ieeexplore.ieee.org/document/7981109/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/PTC.2017.7981109},
   stag_bib_extends_levelofaccess = {NA},
   author = {Frigo, G. and Rietveld, G. and Dierikx, E. and Hoogenboom, D. and Colangelo, D.}
}

@Article { HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017,
   subid = {141},
   title = {Test of Special Relativity Using a Fiber Network of Optical Clocks},
   journal = {Physical Review Letters},
   year = {2017},
   month = {6},
   volume = {118},
   number = {22},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   web_url = {https://arxiv.org/abs/1703.04426},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.118.221102},
   stag_bib_extends_levelofaccess = {NA},
   author = {Delva, P. and Lodewyck, J. and Bilicki, S. and Bookjans, E. and Vallet, G. and Le Targat, R. and Pottie, P.-E. and Guerlin, C. and Meynadier, F. and Le Poncin-Lafitte, C. and Lopez, O. and Amy-Klein, A. and Lee, W.-K. and Quintin, N. and Lisdat, C. and Al-Masoudi, A. and D{\"o}rscher, S. and Grebing, C. and Grosche, G. and Kuhl, A. and Raupach, S. and Sterr, U. and Hill, I. R. and Hobson, R. and Bowden, W. and Kronj{\"a}ger, J. and Marra, G. and Rolland, A. and Baynes, F. N. and Margolis, H. S. and Gill, P.}
}

@Article { RollandGSGPF2017,
   title = {New Generation of Low-Frequency Current Comparators Operated at Room Temperature},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2017},
   month = {6},
   volume = {66},
   number = {6},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {1417-1424},
   keywords = {Cryogenic current comparator (CCC), Current comparator, Low-frequency, Resistance measurement, Sensitivity, Quantum Hall resistance},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2017.2652198},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rolland, B. and Gournay, P. and Satrapinski, A. and G{\"o}tz, M. and Pesel, E. and Fletcher, N.}
}

@Article { JongepierPSR2017,
   title = {Pmu-Based Power System Analysis of A MV Distribution Grid},
   journal = {Proceedings of CIRED 2017},
   year = {2017},
   month = {6},
   volume = {1},
   number = {1},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   pages = {1035},
   keywords = {Power Systems, PMU, Smart Grids, Analysis},
   tags = {SEG},
   web_url = {http://cired.net/publications/cired2017/pdfs/CIRED2017_1035_final.pdf;\&\#10;doi: 10.1049/oap-cired.2017.1035},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {CIRED},
   address = {Glasgow},
   language = {30},
   ISBN = {978-178561-483-5},
   ISSN = {2032-9644},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jongepier, A and Popov, M and Save, N and Rietveld, G}
}

@Article { HerkommerRHSKTRGSTSFGR2017,
   subid = {412},
   title = {Single Quantum Dot with Microlens and 3D-Printed Micro-objective as Integrated Bright Single-Photon Source},
   journal = {ACS Photonics},
   year = {2017},
   month = {6},
   volume = {4},
   number = {6},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {1327-1332},
   keywords = {3D direct laser writing; 3D lithography; micro-objective; semiconductor quantum dot; single-photon source},
   web_url = {http://pubs.acs.org/doi/ipdf/10.1021/acsphotonics.7b00253},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2330-4022, 2330-4022},
   DOI = {10.1021/acsphotonics.7b00253},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fischbach, S. and Schlehahn, A. and Thoma, A. and Srocka, N. and Gissibl, T. and Ristok, S. and Thiele, S. and Kaganskiy, A. and Strittmatter, A. and Heindel, T. and Rodt, S. and Herkommer, A. and Giessen, H. and Reitzenstein, S.}
}

@Article { MonteALBGRRKMAG2017,
   title = {Defect characterisation of tensile loaded CFRP and GFRP laminates used in energy applications by means of infrared thermography},
   journal = {Quantitative InfraRed Thermography Journal},
   year = {2017},
   month = {6},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   pages = {1-20},
   keywords = {Defect characterisation CFRP and GFRP laminates energy applications infrared thermography},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Informa UK Limited},
   language = {30},
   ISSN = {1768-6733, 2116-7176},
   DOI = {10.1080/17686733.2017.1334312},
   stag_bib_extends_levelofaccess = {NA},
   author = {Monte, C. and Aktas, A. and Lodeiro, M. and Baker, G. and Gower, M. and Rehmer, B. and R{\"o}llig, M. and Krankenhagen, R. and Maierhofer, C. and Adibekyan, A. and Gutschwager, B.}
}

@Proceedings { SchutzeKSGRSBL2017,
   title = {Highly sensitive benzene detection with MOS gas sensors},
   journal = {Proceedings Sensor 2017},
   year = {2017},
   month = {6},
   volume = {A4 - Gas S},
   number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change},
   pages = {92-97},
   keywords = {metal oxide semiconductor, MOS, temperature-cycled operation, TCO, benzene},
   web_url = {https://www.ama-science.org/proceedings/details/2498},
   misc2 = {EMRP A169: Call 2013 Environment II},
   event_place = {Nurember},
   event_name = {AMA Conferences 2017 – SENSOR 2017},
   event_date = {30-05-2017 to 01-06-2017},
   language = {30},
   ISBN = {978-3-9816876-4-4},
   DOI = {10.5162/sensor2017/A4.3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sch{\"u}tze, Andreas and Kok, Gertjan and Spinelle, Laurent and Gerboles, Michel and Reimringer, Wolfhard and Sauerwald, Tilman and Baur, Tobias and Leidinger, Martin}
}

@Proceedings { WollensackHSRH2017,
   subid = {517},
   title = {VNA tools II: Calibrations involving eigenvalue problems},
   journal = {2017 89th ARFTG Microwave Measurement Conference (ARFTG)},
   year = {2017},
   month = {6},
   volume = {1},
   number = {1},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   pages = {1-4},
   keywords = {Vector Network Analyzer, S-parameters, Calibration, Uncertainty, Traceability},
   web_url = {http://dx.doi.org/10.1109/ARFTG.2017.8000832},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   event_place = {Honolulu},
   event_name = {Wollensack, Michael, et al.},
   event_date = {09-06-2017 to 10-06-2017},
   language = {30},
   ISBN = {978-1-5386-2748-8},
   DOI = {10.7795/EMPIR.14IND02.CA.20190404},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wollensack, M. and Hoffmann, J. and Stalder, D. and Ruefenacht, J. and Hoffmann, J.}
}

@Article { SantarelliLLCCMWKKCSNRQDLBRGGAWGALLPG2017,
   subid = {138},
   title = {First international comparison of fountain primary frequency standards via a long distance optical fiber link},
   journal = {Metrologia},
   year = {2017},
   month = {5},
   volume = {54},
   number = {3},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {348-354},
   keywords = {optical fiber frequency transfer, atomic fountain clocks, international fountain, clock comparison},
   web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa65fe},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa65fe},
   stag_bib_extends_levelofaccess = {NA},
   author = {Guena, J and Weyers, S and Abgrall, M and Grebing, C and Gerginov, V and Rosenbusch, P and Bize, S and Lipphardt, B and Denker, H and Quintin, N and Raupach, S M F and Nicolodi, D and Stefani, F and Chiodo, N and Koke, S and Kuhl, A and Wiotte, F and Meynadier, F and Camisard, E and Chardonnet, C and Le Coq, Y and Lours, M and Santarelli, G and Amy-Klein, A and Le Targat, R and Lopez, O and Pottie, P E and Grosche, G}
}

@Article { BhattacharyaUPRH2017,
   title = {Temperature measurement using frequency comb absorption spectroscopy of CO2},
   journal = {Review of Scientific Instruments},
   year = {2017},
   month = {5},
   volume = {88},
   number = {5},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   pages = {053113},
   keywords = {spectroscopy, frequency comb laser},
   web_url = {http://aip.scitation.org/doi/10.1063/1.4984252},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.4984252},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bhattacharya, N. and Urbach, H. P. and Persijn, S. T. and Reyes-Reyes, A. and H{\"a}nsel, A.}
}

@Article { SchmittWJRLSMK2017,
   subid = {604},
   title = {Validation of 4D dose calculation using an independent motion monitoring by the calypso tracking system and 3D polymer gel dosimetry},
   journal = {Journal of Physics: Conference Series},
   year = {2017},
   month = {5},
   volume = {847},
   number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy},
   pages = {012040},
   keywords = {3D dosimetry, gel dosimeter, radiotherapy, MRgRT},
   misc2 = {EMPIR 2015: Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/847/1/012040},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mann, P and Saito, N and Lang, C and Runz, A and Johnen, W and Witte, M and Schmitt, D and Karger, C P}
}

@Article { PrancePPJHHGGBPB2017,
   subid = {504},
   title = {On-chip magnetic cooling of a nanoelectronic device},
   journal = {Scientific Reports},
   year = {2017},
   month = {4},
   volume = {7},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {45566},
   keywords = {Electronic devices, Electronic properties and materials},
   web_url = {https://www.nature.com/articles/srep45566},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/srep45566},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bradley, D. I. and Gu{\'e}nault, A. M. and Gunnarsson, D. and Haley, R. P. and Holt, S. and Jones, A. T. and Pashkin, Y. A. and Penttil{\"a}, J. and Prance, J. R. and Prunnila, M. and Roschier, L.}
}

@Article { CarmeleRBSSSGSSvTHKR2017,
   subid = {234},
   title = {A bright triggered twin-photon source in the solid state},
   journal = {Nature Communications},
   year = {2017},
   month = {4},
   volume = {8},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {14870},
   keywords = {Quantum dots, Quantum optics, Single photons and quantum effects .},
   web_url = {https://www.nature.com/articles/ncomms14870},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/ncomms14870},
   stag_bib_extends_levelofaccess = {NA},
   author = {Heindel, T. and Thoma, A. and von Helversen, M. and Schmidt, M. and Schlehahn, A. and Gschrey, M. and Schnauber, P. and Schulze, J. -H. and Strittmatter, A. and Beyer, J. and Rodt, S. and Carmele, A. and Knorr, A. and Reitzenstein, S.}
}

@Miscellaneous { RoscoeB,
   title = {Real-time measurement of Phasor Measurement Unit (PMU) reporting latency},
   journal = {Github},
   year = {2017},
   month = {3},
   day = {20},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   keywords = {Communications, IEC 61850, IEEE 1588, IEEE C37.118, phasor measurement units (PMUs), Sampled Values, time synchronisation},
   misc2 = {EMRP A169: Call 2013 Energy II},
   language = {30},
   DOI = {10.5281/zenodo.400934},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roscoe, Andrew and Blair, Steven}
}

@Article { NovikovaMLR2017,
   title = {Measurement of K fluorescence yields of niobium and rhodium using monochromatic radiation},
   journal = {X-Ray Spectrometry},
   year = {2017},
   month = {3},
   day = {15},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   keywords = {radiation, fluorescence},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Wiley-Blackwell},
   address = {111 River Street Hoboken,NJ 07030, USA},
   language = {30},
   ISSN = {0049-8246},
   DOI = {10.1002/xrs.2757},
   stag_bib_extends_levelofaccess = {NA},
   author = {Novikova, Anastasiia and M{\'e}nesguen, Yves and L{\'e}py, Marie-Christine and Riffaud, Jonathan}
}

@Article { MarsteinPHRCDS2017,
   title = {Surface Passivation Properties of $\{\textbackslashtextrm\{HfO\}\}_\{2\}$ Thin Film on n-Type Crystalline Si},
   journal = {IEEE Journal of Photovoltaics},
   year = {2017},
   month = {3},
   volume = {7},
   number = {2},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {479-485},
   keywords = {Passivation,  Hafnium compounds,  Silicon,  Annealing,  Temperature, silicon,  atomic layer deposition,  carrier lifetime,  crystal growth from melt,  dielectric thin films,  electrical resistivity,  hafnium compounds,  passivation,  refractive index, Si,  surface passivation,  hafnium oxide thin film,  atomic layer deposition,  resistivity,  low temperature anneal,  precleaning,  precursors,  deposition temperature,  postannealing temperature,  minority carrier lifetime,  surface recombination velocity,  Czochralski n-type wafers,  light soaking,  refractive index,  solar cells,  HfO2, silicon surface passivation,  Atomic layer deposition (ALD),  defect density,  fixed charges,  hafnium oxide (HfO2),  photovoltaic cells},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA},
   language = {30},
   ISSN = {2156-3381, 2156-3403},
   DOI = {10.1109/JPHOTOV.2016.2645399},
   stag_bib_extends_levelofaccess = {NA},
   author = {Marstein, Erik Stensrud and Perros, Alexander Pyymaki and Halvard, Haug and Repo, Paivikki and Cheng, Xuemei and Di Sabatino, Marisa and Savin, Hele}
}

@Article { YacootRPCHCL2017,
   title = {Laser source for dimensional metrology: investigation of an iodine stabilized system based on narrow linewidth 633 nm DBR diode},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {2},
   day = {16},
   volume = {28},
   number = {4},
   number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom},
   pages = {045204},
   keywords = {optical metrology, DBR laser diode, frequency stabilization, laser interferometry, dimensional metrology, iodine stabilization, displacement measurement},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   address = {Temple Circus,Temple Way, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/aa5ab9},
   stag_bib_extends_levelofaccess = {NA},
   author = {Yacoot, Andrew and Rerucha, Simon and Pham, Tuan M and Cizek, Martin and Hucl, Vaclav and Č{\'i}p, Ondřej and Lazar, Josef}
}

@Article { RobinsonSGWZMRLHSY2017,
   title = {1.5 \(\mu\)m lasers with sub 10 mHz linewidth},
   journal = {APS Physics},
   year = {2017},
   month = {2},
   day = {15},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   keywords = {tiem and frequency metrology, ultra-stable laser, oprical clock},
   web_url = {https://arxiv.org/abs/1702.04669},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   language = {30},
   DOI = {10.1103/PhysRevLett.118.263202},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, J.M.  and Sonderhouse, L. and Grebing, C. and Weyrich, R.  and Zhang, W. and Matei, D.G. and Riehle, F. and Legero, T. and H{\"a}fner, S. and Sterr, U. and Ye, J.}
}

@Article { StagniRPNNMMLFBBAACZC2017,
   subid = {134},
   title = {A VLBI experiment using a remote atomic clock via a coherent fibre link},
   journal = {Scientific Reports},
   year = {2017},
   month = {2},
   volume = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {40992},
   keywords = {VLBI experiment, remote atomic clock},
   web_url = {https://www.nature.com/articles/srep40992},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   address = {New York},
   language = {30},
   ISSN = {2045-2322},
   DOI = {10.1038/srep40992},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clivati, C. and Ambrosini, R. and Artz, T. and Bertarini, A. and Bortolotti, C. and Frittelli, M. and Levi, F. and Mura, A. and Maccaferri, G. and Nanni, M. and Negusini, M. and Perini, F. and Roma, M. and Stagni, M. and Zucco, M. and Calonico, D.}
}

@Article { PavsiDBFVJSeHRKMAAM2017,
   subid = {2144},
   title = {Inter-laboratory assessment of different digital PCR platforms for quantification of human cytomegalovirus DNA},
   journal = {Analytical and Bioanalytical Chemistry},
   year = {2017},
   month = {1},
   day = {26},
   volume = {409},
   number = {10},
   number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms},
   pages = {2601-2614},
   keywords = {Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Springer Science and Business Media LLC},
   language = {30},
   ISSN = {1618-2642, 1618-2650},
   DOI = {10.1007/s00216-017-0206-0},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pavšič, J. and Devonshire, A. and Blejec, A. and Foy, C.A. and Van Heuverswyn, F. and Jones, G.M. and Schimmel, H. and Zel, J. and Huggett, J.F. and Redshaw, N. and Karczmarczyk, M. and Mozioglu, E. and Aky{\"u}rek, S. and Akg{\"o}z, M. and Milavec, M.}
}

@Article { ,
   title = {Atomic force microscope adhesion measurements and atomistic molecular dynamics simulations at different humidities},
   journal = {Measurement Science and Technology},
   year = {2017},
   month = {1},
   day = {23},
   volume = {28},
   number = {3},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   pages = {034004 (10pp)},
   keywords = {Atomic force microscopy, metrology, adhesion, capillary effects, humidity, force measurement},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034004/meta;jsessionid=1CDCAA65608F84971489636A33CB4FD2.c3.iopscience.cld.iop.org},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0957-0233},
   DOI = {10.1088/1361-6501/28/3/034004},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2018-1-23},
   author = {Sepp{\"a}, J and Reischl, B and Sairanen, H and Korpelainen, V and Husu, H and Heinonen, M and Raiteri, P and Rohl, A and Nordlund, K and Lassila, A}
}

@Article { CalonicoLCCMBRTP2017,
   subid = {111},
   title = {Absolute frequency measurement of the 1S0 – 3P0 transition of 171Yb},
   journal = {Metrologia},
   year = {2017},
   month = {1},
   day = {20},
   volume = {54},
   number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty},
   pages = {102-112},
   keywords = {optical lattice clock, SI second, frequency metrology},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa4e62},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pizzocaro, M and Thoumany, P and Rauf, B and Bregolin, F and Milani, G and Clivati, C and Costanzo, G.A. and Levi, F and Calonico, D}
}

@Article { NovikovaKGBWLRBMNL2017,
   title = {CASTOR, a new instrument for combined XRR-GIXRF analysis at SOLEIL},
   journal = {X-Ray Spectrometry},
   year = {2017},
   month = {1},
   day = {13},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   keywords = {x-ray},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Wiley-Blackwell},
   address = {111 River Street Hoboken, NJ 07030, USA},
   language = {30},
   ISSN = {0049-8246},
   DOI = {10.1002/xrs.2742},
   stag_bib_extends_levelofaccess = {NA},
   author = {Novikova, A. and Kanngie{\ss}er, B. and Gr{\"o}tzsch, D. and Beckhoff, B. and Weser, J. and Lubeck, J. and Rotella, H. and Boyer, B. and M{\'e}nesguen, Y. and Nolot, E. and L{\'e}py, M.-C.}
}

@Article { BecherLSGCSPHLRK2017_2,
   title = {Experimental realization of an absolute single-photon source based on a single nitrogen vacancy center in a nanodiamond},
   journal = {Optica},
   year = {2017},
   month = {1},
   volume = {4},
   number = {1},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {71},
   keywords = {Metrology, Radiometry, Sources, Photon statistics},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {2334-2536},
   DOI = {10.1364/OPTICA.4.000071},
   stag_bib_extends_levelofaccess = {NA},
   author = {Becher, C. and Lindner, S. and Sandoghdar, V. and G{\"o}tzinger, S. and Chu, X.L. and Smid, M. and Porrovecchio, G. and Hofer, H. and L{\'o}pez, M. and Rodiek, B. and K{\"u}ck, S.}
}

@Article { BuermannR2017,
   subid = {1320},
   title = {Dynamic determination of equivalent CT source models for personalized dosimetry},
   journal = {Current Directions in Biomedical Engineering},
   year = {2017},
   month = {1},
   volume = {3},
   number = {2},
   number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion},
   keywords = {dosimetry, personalised medicine, CT source models},
   misc2 = {EMPIR 2015: Health},
   publisher = {Walter de Gruyter GmbH},
   language = {30},
   ISSN = {2364-5504},
   DOI = {10.1515/cdbme-2017-0167},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rosendahl, S. and B{\"u}ermann, L.}
}

@Proceedings { RoskeTL2017,
   title = {Practical applications of an enhanced uncertainty model for build-up systems},
   journal = {IMEKO-TC3-2017},
   year = {2017},
   number2 = {SIB63: Force: Force traceability within the meganewton range},
   keywords = {Transfer standard, force measurement, buildup system},
   web_url = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-012.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Helsinki Finland},
   event_name = {IMEKO 23rd TC3, 13th TC5 and 4th TC22 International Conference},
   event_date = {30-05-2017 to 01-06-2017},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-012.pdf},
   author = {R{\"o}ske, D. and Tegtmeier, F. and Lang, W.}
}

@Article { MuelanerRYM2017,
   title = {Thermal compensation for large volume metrology and structures},
   journal = {International Journal of Metrology and Quality Engineering},
   year = {2017},
   volume = {8},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {21},
   keywords = {thermal compensation, large volume metrology, finite element analysis , assembly},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {EDP Sciences},
   language = {30},
   ISSN = {2107-6847},
   DOI = {10.1051/ijmqe/2017004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Muelaner, J. and Ross-Pinnock, D. and Yang, B. and Mullineux, G.}
}

@Article { PenttilaRGPMKMHP2016,
   subid = {94},
   title = {Traceable Coulomb blockade thermometry},
   journal = {Metrologia},
   year = {2016},
   month = {12},
   day = {20},
   volume = {54},
   number = {1},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   pages = {69-76},
   keywords = {Coulomb blockade thermometry, primary thermometer, traceability, thermodynamic temperature},
   web_url = {https://arxiv.org/abs/1609.06943v2},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/aa4f84},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hahtela, O and Mykk{\"a}nen, E and Kemppinen, A and Meschke, M and Prunnila, M and Gunnarsson, D and Roschier, L. and Penttil{\"a}, J and Pekola, J}
}

@Article { HenaultBRPDBFBH2016,
   title = {Development of facilities and methods for the metrological characterization of distributed temperature sensing systems based on optical fibres},
   journal = {Measurement Science and Technology},
   year = {2016},
   month = {12},
   volume = {28},
   number = {1},
   number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities},
   pages = {015009},
   keywords = {Distributed sensing, Temperature, Metrology, Raman},
   web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/1/015009},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0957-0233, 1361-6501},
   DOI = {10.1088/1361-6501/28/1/015009},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\'e}nault, J M and Beck, Y L and Razouk, R and Plumeri, S and Delepine-Lesoille, S and Beaumont, O and Failleau, G and Bertrand, J and Hay, B}
}

@Article { ReitzensteinKLRSSKSMRWFDJK2016,
   subid = {336},
   title = {Impact of Phonons on Dephasing of Individual Excitons in Deterministic Quantum Dot Microlenses},
   journal = {ACS Photonics},
   year = {2016},
   month = {11},
   day = {22},
   volume = {3},
   number = {12},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {2461-2466},
   keywords = {single-photon source, 3D lithography, 3D direct laser writing, semiconductor quantum dot, micro-objective},
   web_url = {http://pubs.acs.org/doi/pdf/10.1021/acsphotonics.7b00253},
   misc2 = {EMPIR 2014: Industry},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {2330-4022, 2330-4022},
   DOI = {10.1021/acsphotonics.6b00707},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jakubczyk, T. and Delmonte, V. and Fischbach, S. and Wigger, D. and Reiter, D.E. and Mermillod, Q. and Schnauber, P. and Kaganskiy, A. and Schulze, J.H. and Strittmatter, A. and Rodt, S. and Langbein, W. and Kuhn, T. and Reitzenstein, S. and Kasprzak, J.}
}

@Article { RietveldZOBCL2016,
   title = {Traceable measurements of the electrical parameters of solid-state lighting products},
   journal = {Metrologia},
   year = {2016},
   month = {11},
   day = {21},
   volume = {53},
   number = {6},
   number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting},
   pages = {1384-1394},
   keywords = {uncertainty analysis, electrical measurement, solid-state lighting},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/0026-1394/53/6/1384},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, G and Zhao, D and Overney, F and Braun, J-P and Christensen, A and Lippert, T}
}

@Article { ,
   title = {Near-unity quantum efficiency of broadband black silicon photodiodes with an induced junction},
   journal = {Nature Photonics},
   year = {2016},
   month = {11},
   day = {14},
   volume = {-},
   number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry},
   keywords = {Imaging and sensing, Nanowires, Optical metrology, Optical sensors,  X-rays},
   web_url = {http://www.nature.com/nphoton/journal/vaop/ncurrent/full/nphoton.2016.226.html},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Nature},
   address = {-},
   language = {30},
   DOI = {10.1038/nphoton.2016.226},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Juntunen, M.A. and Heinonen, J. and V{\"a}h{\"a}nissi, V. and Repo, P. and Valluru, D. and Savin, H.}
}

@Article { KraehnertHORH2016,
   title = {Ellipsometric porosimetry on pore-controlled TiO2 layers},
   journal = {Applied Surface Science},
   year = {2016},
   month = {11},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   keywords = {Spectroscopic ellipsometry; Porous materials; Porosimetry; Multi-sample analysis; Thin film metrology},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   address = {New York, USA},
   language = {30},
   ISSN = {0169-4332},
   DOI = {10.1016/j.apsusc.2016.11.055},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kraehnert, Ralph and Hodoroaba, Vasile-Dan and Ortel, Erik and Rosu, Dana-Maria and Hertwig, Andreas}
}

@Article { GorenBTZSMPRFAF2016,
   title = {Towards tributyltin quantification in natural water at the Environmental Quality Standard level required by the Water Framework Directive},
   journal = {Talanta},
   year = {2016},
   month = {11},
   volume = {160},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {499-511},
   keywords = {ICP-MS, Isotope Dilution, Limit of quantification, Metrological traceability, Tributyltin, Water Framework Directive},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0039-9140},
   DOI = {10.1016/j.talanta.2016.07.056},
   stag_bib_extends_levelofaccess = {NA},
   author = {Goren, A.C. and B{\'i}lsel, M. and Tun\c{c}, M. and Zuliani, T. and Sčančar, J. and Milačič, R. and Philipp, R. and Richter, J. and Fettig, I. and Alasonati, E. and Fisicaro, P.}
}

@Article { EngertRGPMKHSCLSKMP2016,
   title = {New Evaluation of T − T2000 from 0.02K to 1K by Independent Thermodynamic Methods},
   journal = {International Journal of Thermophysics},
   year = {2016},
   month = {10},
   day = {20},
   volume = {37},
   number = {12},
   number2 = {15SIB02: InK 2: Implementing the new kelvin 2},
   keywords = {Temperature, Thermodynamic Methods, Kelvin},
   web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/new-evaluation-of-t-t2000-from-002k-to-1k-by-independent-thermodynamic-methods(dc393a64-8d59-4083-9435-f2bd70eea8ed).html},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-016-2123-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Engert, J and Kirste, A. and Shibahara, A. and Casey, A. and Levitin, L.V. and Saunders, J. and Hahtela, O. and Kemppinen, A. and Mykk{\"a}nen, E. and Prunnila, M. and Gunnarsson, D. and Roschier, L. and Meschke, M. and Pekola, J.}
}

@Article { KhoramshahiRVKHHNN2016,
   title = {Close-range environmental remote sensing with 3D hyperspectral technologies},
   journal = {Earth Resources and Environmental Remote Sensing/GIS Applications VII},
   year = {2016},
   month = {10},
   day = {18},
   volume = {10005},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   keywords = {Remote sensing, Unmanned aerial vehicles, Clouds, Radiative energy transfer, Modeling, RGB color model, Radiation, Hyperspectral imaging, LIDAR, Anisotropy},
   web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2571414\&resultClick=1},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {SPIE},
   language = {30},
   DOI = {10.1117/12.2240936},
   stag_bib_extends_levelofaccess = {NA},
   author = {Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Kaasalainen, S. and Hakala, T. and Honkavaara, E. and Nevalainen, O. and N{\"a}si, R.}
}

@Article { RietveldvJJNCAC2016,
   title = {Measurement of the harmonic impedance of the aggregated distribution network},
   journal = {2016 17th International Conference on Harmonics and Quality of Power (ICHQP)},
   year = {2016},
   month = {10},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   keywords = {Phasor measurement units, Power Quality, Power system harmonics, Impedance measurement, Harmonic impedance, Load modeling},
   tags = {SEG},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/ICHQP.2016.7783374},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, G. and van den Brom, H.E. and Jongepier, A. and Jin, W. and Ni, F. and Cuk, V. and Acanski, M. and Cobben, J.F.G.}
}

@Article { RantosonNAM2016,
   subid = {1551},
   title = {Improved curvature-based registration methods for high-precision dimensional metrology},
   journal = {Precision Engineering},
   year = {2016},
   month = {10},
   volume = {46},
   number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses},
   pages = {232-242},
   keywords = {Improved curvature-based registration methods for high-precision dimensional metrology},
   web_url = {https://hal.archives-ouvertes.fr/hal-01363750/document},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0141-6359},
   DOI = {10.1016/j.precisioneng.2016.05.002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rantoson, R. and Nouira, H. and Anwer, N. and Mehdi-Souzani, C.}
}

@Article { SmithHRGLI2016,
   title = {Estimation of background gas concentration from differential absorption lidar measurements},
   journal = {Atmospheric Measurement Techniques},
   year = {2016},
   month = {10},
   volume = {9},
   number = {10, 2016},
   number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions},
   pages = {4879-4890},
   keywords = {gas concentration, differential absorption, atmosphere, metrology, emission fluxes, lidar, pollutants, measurement},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   address = {G{\"o}ttingen},
   language = {30},
   ISSN = {18678548},
   DOI = {10.5194/amt-9-4879-2016},
   stag_bib_extends_levelofaccess = {NA},
   author = {Smith, N. and Harris, P. and Robinson, R. and Gardiner, T. and Livina, V. and Innocenti, F.}
}

@Article { ReganCBABS2016,
   title = {A comparison of emerging gamma detector technologies for airborne radiation monitoring},
   journal = {Journal of Physics: Conference Series},
   year = {2016},
   month = {10},
   volume = {763},
   number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe},
   pages = {012010},
   keywords = {gamma detector, airborne radiation monitoring, radiation monitoring},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1742-6588, 1742-6596},
   DOI = {10.1088/1742-6596/763/1/012010},
   stag_bib_extends_levelofaccess = {NA},
   author = {Regan, P H and Collins, S M and Beeke, S and Aitken-Smith, P and Bell, S J and Shearman, R}
}

@Article { RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016,
   title = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network},
   journal = {Atmospheric Chemistry and Physics},
   year = {2016},
   month = {9},
   day = {23},
   volume = {16},
   number = {18},
   number2 = {ENV51: MeTra: Traceability for mercury measurements},
   pages = {11915-11935},
   keywords = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   language = {30},
   ISSN = {1680-7324},
   DOI = {10.5194/acp-16-11915-2016},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ramachandran, R. and Fu, X. and Zhang, H. and Feng, X.B. and Wip, D. and Obolkin, V. and Mashyanov, N. and Sena, F. and Gawlik, B.M. and Neves, L.M. and Read, K.A. and Kotnik, J. and Horvat, M. and Skov, H. and Magand, O. and Angot, H. and Dommergue, A. and Garcia, P.E. and Di{\'e}guez, M.D.C and Barbante, C. and Cairns, W. and Brito, J. and Barbosa, H.D.M.J and Morais, F. and Artaxo, P. and W{\"a}ngberg, I. and Munthe, J. and Martin, L. and Labuschagne, C. and Brunke, E.G. and Weigelt, A. and Ebinghaus, R. and Landis, M. and Mannarino, V. and Cinnirella, S. and Carbone, F. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Cossa, D. and Knoery, J. and Marusczak, Nicolas and Nerentorp, M. and Fisicaro, P.}
}

@Article { BennettBHWRBBRC2016,
   title = {Double differential cross sections for proton induced electron emission from molecular analogues of DNA constituents for energies in the Bragg peak region},
   journal = {The Journal of Chemical Physics},
   year = {2016},
   month = {9},
   day = {14},
   volume = {145},
   number = {10},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {104301},
   keywords = {DNA, cross sections, proton impact, tetrahydrofuran, pyrimidine, trimethylphosphate, Bragg peak},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {AIP Publishing},
   address = {2 Huntington Quadrangle, Ste 1 No 1 Suite 300, Melville 11747-4502 ,United States},
   language = {30},
   ISSN = {0021-9606, 1089-7690},
   DOI = {10.1063/1.4962171},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bennett, Daniel and Bug, Marion U. and Hilgers, Gerhard and Wang, Mingjie and Rudek, Benedikt and Baek, Woon Yong and Buhr, Ticia and Rabus, Hans and Champion, Christophe}
}

@Proceedings { ,
   title = {Methodology for testing a parameter-free fault locator for transmission lines},
   journal = {Electric Power Systems Research},
   year = {2016},
   month = {9},
   day = {1},
   volume = {138},
   number = {n/a},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {92 - 98},
   keywords = {Fault location; 
Line parameters; 
ATPDraw; 
Parameter-free; 
Transmission line; 
Protection},
   web_url = {http://www.sciencedirect.com/science/article/pii/S037877961630013X},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elesvier},
   address = {Amsterdam},
   event_place = {Cavtat, Croatia,},
   event_name = {Special Issue: Papers from the 11th International Conference on Power Systems Transients (IPST)},
   event_date = {15-06-2015 to ‐18-6-2015},
   language = {30},
   ISBN = {n/a},
   ISSN = {N/A},
   DOI = {10.1016/j.epsr.2016.02.007},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2018-9-1},
   author = {Popov, M and Parmar, S and Rietveld, G and Preston, G and Radojevic, Z and Terzija, V}
}

@Proceedings { IrvineBR2016,
   title = {Real-time compression of IEC 61869-9 sampled value data},
   journal = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2016},
   month = {9},
   volume = {1},
   number = {1},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-6},
   keywords = {Communications, IEC 61850-9-2, IEC 61869-9, merging units, phasor measurement units, power system protection, time synchronization},
   tags = {SEG},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA},
   event_place = {E.ON Energy Research Centre, RWTH Aachen University, Aachen, Germany},
   event_name = {IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   event_date = {28-09-2016 to 30-09-2016},
   language = {30},
   ISBN = {978-1-5090-2373-8},
   ISSN = {978-1-5090-2374-5},
   DOI = {10.1109/AMPS.2016.7602854},
   stag_bib_extends_levelofaccess = {NA},
   author = {Irvine, James and Blair, Steven M. and Roscoe, Andrew J.}
}

@Proceedings { BlairR2016,
   title = {Choice and properties of adaptive and tunable digital boxcar (moving average) filters for power systems and other signal processing applications},
   journal = {2016 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   year = {2016},
   month = {9},
   volume = {1},
   number = {1},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-6},
   keywords = {Adaptive filters, Array signal processing, Finite impulse response filters, Power system measurements, Fourier transforms, Frequency measurement, Phase estimation, Power system state estimation, Power system parameter estimation},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA},
   event_place = {E.ON Energy Research Centre, RWTH Aachen University, Aachen, Germany},
   event_name = {IEEE International Workshop on Applied Measurements for Power Systems (AMPS)},
   event_date = {28-09-2016 to 30-09-2016},
   language = {30},
   ISBN = {978-1-5090-2373-8},
   ISSN = {978-1-5090-2374-5},
   DOI = {10.1109/AMPS.2016.7602853},
   stag_bib_extends_levelofaccess = {NA},
   author = {Blair, Steven M. and Roscoe, Andrew J.}
}

@Article { ,
   title = {Comparing methods for evaluating measurement uncertainty given in the JCGM ‘Evaluation of Measurement Data’ documents},
   journal = {Measurement},
   year = {2016},
   month = {8},
   day = {31},
   volume = {94},
   number = {December 2016},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   pages = {847–851},
   keywords = {measurement uncertainty, GUM, GUM supplements, microwave scattering parameters, standard uncertainty},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116304766},
   misc2 = {EMPIR 2014: Industry},
   publisher = {Elsevier},
   address = {Amsterdam, Netherlands},
   language = {30},
   DOI = {10.1016/j.measurement.2016.08.015},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-8-31},
   author = {Stant, L.T. and Aaen, P.H. and Ridler, N. M.}
}

@Proceedings { ,
   title = {Accurate Phase Calibration of PMUs and PMU Calibrators},
   journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2016},
   year = {2016},
   month = {8},
   day = {11},
   volume = {2016},
   number = {1},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-2},
   keywords = {aperture delay, calibration, phasor measurement unit, phase measurement, PMU, synchrophasor.},
   web_url = {http://ieeexplore.ieee.org/document/7540461/},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {Ottawa, Canada},
   event_name = {Conference on Precision Electromagnetic Measurements (CPEM)},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540461},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Acanski, M and Rietveld, G and Hoogenboom, D}
}

@Proceedings { ,
   title = {Convenient Graphene-Based Quantum Hall Resistance Standards},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Graphene, materials science and technology, measurement standards, metrology, quantum Hall effect devices},
   web_url = {http://ieeexplore.ieee.org/document/7540650/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540650},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Brun-Pcard, J. and Ribeiro-Palau, R. and Lafont, F. and Kazazis, D. and Michon, A. and Cheynis, F. and Couturaud, O. and Consejo, C. and Jouault, B. and Poirier, W. and Schopfer, F.}
}

@Proceedings { ,
   title = {Experimental Study of Carrier Density Tuning in Epitaxial Graphene QHR Devices},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Epitaxial graphene, graphene fabrication, carrier concentration, chemical functionalization, precision measurement},
   web_url = {http://ieeexplore.ieee.org/document/7540518/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540518},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Fletcher, N. and Gournay, P. and Rolland, B. and G{\"o}tz, M. and Notikov, S. and Lebedeva, N. and Satrapinski, A.}
}

@Proceedings { ,
   title = {Testing the new generation of low-frequency current comparators},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Resistance measurement, CCC, current comparator, low frequency, measurement uncertainty, sensitivity},
   web_url = {http://ieeexplore.ieee.org/document/7540594/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540594},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Satrapinski, A. and G{\"o}tz, M. and Pesel, E. and Fletcher, N. and Gournay, P. and Rolland, B.}
}

@Proceedings { ,
   title = {Fabrication of graphene quantum Hall resistance standard in a cryogen-freee table-top system},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {Epitaxial layers, Graphene, measurement standards, microfabrication, quantum hall effect},
   web_url = {http://ieeexplore.ieee.org/document/7540516/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540516},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {He, H. and Janssen, T.J.B.M. and Rozhko, S. and Tzalenchuk, A. and Lara-Avila, S. and Yakimova, R. and Kubatkin, S.}
}

@Proceedings { ,
   title = {Towards a cryogen-free table-top primary resistance standard},
   journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)},
   year = {2016},
   month = {8},
   day = {11},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   keywords = {quantum Hall effect, graphene, primary resistance metrology, cryogenic current comparators.},
   web_url = {http://ieeexplore.ieee.org/document/7540654/?denied},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Ottawa, Canada},
   event_name = {CPEM 2016},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540654},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Janssen, T.J.B.M. and Rhozhko, S. and Williams, J.M. and Ireland, J. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Tzalenchuk, A.}
}

@Proceedings { ,
   title = {Measurement comparison up to 65 GHz in coaxial 1.85 mm line},
   journal = {Proceedings of the Conference on Precision Electromagnetic Measurements},
   year = {2016},
   month = {8},
   day = {11},
   volume = {n/a},
   number = {n/a},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-2},
   keywords = {high frequency circuits, metrology,},
   web_url = {http://ieeexplore.ieee.org/document/7540504/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Melville},
   event_place = {Ottawa, Canada},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540504},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ei⊘, C and Allal, D and Huerlimann, P and Ruefenacht, J and Zinal, S}
}

@Proceedings { ,
   title = {Calibration of Si-SPAD detectors using the double attenuator technique and a low noise silicon photodiode},
   journal = {DGaO Proceedings 2016},
   year = {2016},
   month = {8},
   day = {8},
   volume = {117},
   number = {none},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {28-29},
   keywords = {Calibration, SPAD},
   web_url = {http://www.dgao-proceedings.de/download/117/117_p28.pdf},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {DGaO},
   address = {Erlangen},
   event_place = {Hannover},
   event_name = {DGaO - Deutschen Gesellschaft f{\"u}r angewandte Optik},
   event_date = {12-05-2016 to 17-05-2016},
   language = {30},
   ISSN = {1614-8436},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.dgao-proceedings.de/download/117/117_p28.pdf},
   author = {Lopez, M. and Porrovecchio, G. and Hofer, H. and Rodiek, B. and Šmid, M. and K{\"u}ck, S.}
}

@Article { ,
   title = {Characterisation of nitrogen-vacancy based single-photon sources},
   journal = {DGaO Proceedings 2016},
   year = {2016},
   month = {8},
   day = {8},
   volume = {117},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {117_p32},
   keywords = {single-photon source, nitrogen-vacancy in nanodiamonds, calibration, single-photon detectors, antibunching},
   web_url = {http://www.dgao-proceedings.de/download/117/117_p32.pdf},
   web_url2 = {http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Deutschen Gesellschaft f{\"u}r angewandte Optik e.V.},
   address = {Erlangen},
   language = {30},
   ISSN = {1614-8436},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6},
   author = {Rodiek, B. and L{\'o}pez, M. and Hofer, H. and Chu, X.-L. and G{\"o}tzinger, S. and K{\"u}ck, S.}
}

@Article { ,
   title = {The calibration of a prototype occluded ear simulator designed for neonatal hearing assessment applications},
   journal = {AIP Citation},
   year = {2016},
   month = {8},
   day = {5},
   volume = {140 (2016)},
   number = {2},
   number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound},
   pages = {806–813},
   keywords = {occluded ear simulator, prototype, neonatal hearing assessment applications, Microphones, Ears, Calibration, Acoustic impedance measurement, Sound pressure},
   web_url = {http://scitation.aip.org/content/asa/journal/jasa/140/2/10.1121/1.4960517},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {The Journal of the Acoustical Society of America},
   address = {Melville, NY},
   language = {30},
   DOI = {10.1121/1.4960517},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Barham, R. and Olsen, E.S. and Rodrigues, D. and Barrera-Figueroa, S. and Sadikoğlu, E. and Karab{\"o}ce, B.}
}

@Article { SvecSSRPNMLKJGFFDMAHBTTVW2016_2,
   title = {60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy},
   journal = {Applied Radiation and Isotopes},
   year = {2016},
   month = {8},
   volume = {114},
   number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry},
   pages = {167-172},
   keywords = {Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2016.05.014},
   stag_bib_extends_levelofaccess = {NA},
   author = {Svec, A. and Solc, J. and Silva, L. and Reis, M. and Peyres, V. and Nečemer, M. and Moser, H. and Luca, A. and Klemola, S. and Javornik, A. and Garc{\'i}a-Tora{\~n}o, E. and Ferreux, L.. and Fazio, A. and Dry{\'a}k, P. and Marroyo, B.C. and Arnold, D. and Hult, M. and Burda, O. and Tzika, F. and Tyminski, Z. and Vodenik, B. and W{\"a}tjen, U.}
}

@Article { SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016,
   subid = {135},
   title = {A clock network for geodesy and fundamental science},
   journal = {Nature Communications},
   year = {2016},
   month = {8},
   volume = {7},
   number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network},
   pages = {12443},
   keywords = {Clock network; geodesy;},
   web_url = {https://www.nature.com/articles/ncomms12443},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {Springer Nature},
   address = {New York},
   language = {30},
   ISSN = {2041-1723},
   DOI = {10.1038/ncomms12443},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and Doerscher, S. and Haefner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G. and Amy-Klein, A. and Le Targat, R. and Lodewyck, J. and Lopez, O and Pottie, P.-E.}
}

@Article { ,
   title = {On-Site Radiated Emissions Measurements in Semi-Reverberant Environments},
   journal = {IEEE Transactions on Electromagnetic Compatibility},
   year = {2016},
   month = {8},
   volume = {Not known yet},
   number = {Not known yet},
   number2 = {IND60: EMC: Improved EMC test methods in industrial environments},
   pages = {1-8},
   keywords = {radiated emissions; in-situ testing; reverberation chambers;},
   web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=15},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {Piscataway, NJ},
   language = {30},
   ISSN = {not known yet},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Vogt-Ardatjew, R.A. and Lundgren, U. and Romero, S.F.}
}

@Article { ,
   title = {The Feasibility of Thermal Imaging as a Future Portal Imaging Device for Therapeutic Ultrasound},
   journal = {Ultrasound in Medicine and Biology},
   year = {2016},
   month = {8},
   volume = {42},
   number = {8},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {2033–2038},
   keywords = {High intensity focused ultrasound dosimetry, Quality assurance, Thermal mapping, Acoustic field evaluation, Magnetic resonance–guided focused ultrasound surgery, Infrared camera},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0301562916300047},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Elsevier},
   language = {30},
   ISSN = {0301-5629},
   DOI = {10.1016/j.ultrasmedbio.2016.03.028},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-9-1},
   author = {Miloro, P and Civale, J and Rivens, I and Shaw, A}
}

@Article { ,
   title = {Effect of different ALD Al2O3 oxidants on the surface passivation of black silicon},
   journal = {Energy Procedia},
   year = {2016},
   month = {8},
   volume = {92},
   number = {-},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {381-385},
   keywords = {black silicon; surface passivatoin; aluminum oxide},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1876610216305434},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier},
   address = {-},
   language = {30},
   DOI = {10.1016/j.egypro.2016.07.116},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Repo, P. and Savin, H.}
}

@Article { FisicaroPJPFRA2016,
   title = {Determination of tributyltin in whole water matrices under the European Water Framework Directive},
   journal = {Journal of Chromatography A},
   year = {2016},
   month = {8},
   volume = {1459},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {112-119},
   keywords = {Environmental quality standard (EQS), Humic acid, Isotope dilution, Surface water, Suspended particulate matter, Tributyltin (TBT)},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0021-9673},
   DOI = {10.1016/j.chroma.2016.06.068},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fisicaro, P. and Panne, U. and Jakubowski, N. and Philipp, R. and Fettig, I. and Richter, J. and Alasonati, E.}
}

@Article { ShortisRKMB2016_2,
   title = {Optimised multi-camera systems for dimensional control in factory environments},
   journal = {Proceedings of the Institution of Mechanical Engineers, Part B: Journal of Engineering Manufacture},
   year = {2016},
   month = {8},
   volume = {232},
   number = {10},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {1707-1718},
   keywords = {Industrial photogrammetry, camera calibration, refraction correction, manufacturing, part assembly},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {SAGE Publications},
   language = {30},
   ISSN = {0954-4054, 2041-2975},
   DOI = {10.1177/0954405416654936},
   stag_bib_extends_levelofaccess = {NA},
   author = {Shortis, M. and Robson, S. and Kyle, S. and MacDonald, L. and Boehm, J.}
}

@Article { ,
   title = {Accurate quantification of selenoproteins in human plasma/serum by isotope dilution ICP-MS: focus on selenoprotein P},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2016},
   month = {7},
   day = {26},
   volume = {31},
   number = {09/2016},
   number2 = {HLT05: Metallomics: Metrology for metalloproteins},
   pages = {1904-1912},
   keywords = {selenoproteins, isotope dilution, ICP-MS,},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00122J\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {The Royal Society of Chemistry},
   address = {Cambridge, United Kingdom},
   language = {30},
   DOI = {10.1039/c6ja00122j},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {del Castillo Busto, M. Estela and Oster, Caroline and Cuello-Nunez, Susana and Deitrich, Christian L. and Raab, Andrea and Konopka, Anna and Lehmann, Wolf D. and Goenaga-Infante, Heidi and Fisicaro, Paola}
}

@Manual { ,
   title = {Coping with Thermal Expansion in Large Volume Metrology: Good Practice Guide},
   journal = {LUMINAR project website},
   year = {2016},
   month = {7},
   day = {25},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {1-23},
   keywords = {Large Volume Metrology, thermal compensation, CTE, good practice guide},
   web_url = {http://projects.npl.co.uk/luminar/publications/luminar-gpg-thermal-expansion-lvm.pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {LUMINAR website hosted by NPL},
   address = {NPL, Hampton Road, Teddington},
   institution = {University of Bath},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://projects.npl.co.uk/luminar/publications/luminar-gpg-thermal-expansion-lvm.pdf},
   author = {Ross-Pinnock, D and Mullineux, G and Muelaner, J}
}

@Proceedings { ,
   title = {Close range calibration of long focal length lenses in a changing environment},
   journal = {The International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences},
   year = {2016},
   month = {7},
   day = {19},
   volume = {2016},
   number = {XLI-B5},
   number2 = {IND53: Large Volume: Large volume metrology in industry},
   pages = {115-122},
   keywords = {Camera, calibration, close range, physical parameter, correlation, temperature, wavelength},
   web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B5/115/2016/isprs-archives-XLI-B5-115-2016.pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {ISPRS},
   address = {Hannover},
   event_place = {Prague, Czech Republic},
   event_name = {XXIII International Socirty of Photogrammetry and Remote Sensing Congress},
   event_date = {12-19 July 2016},
   language = {30},
   DOI = {10.5194/isprs-archives-XLI-B5-115-2016},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Robson, S and MacDonald, L and Kyle, S and Shortis, M R}
}

@Proceedings { ,
   title = {Traceable DC - 18 GHz Characterization of Coaxial 50 ohm Impedance Standards},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   day = {15},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   keywords = {Impedance, calibration, vector network analyzers, impedance analyzers, precision measurements.},
   web_url = {http://ieeexplore.ieee.org/document/7540479/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {NA},
   language = {30},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540479},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mubarak, F.A. and Dierikx, E. and Rietveld, G.}
}

@Proceedings { ,
   title = {Verification concepts in S-parameter measurements},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   day = {15},
   volume = {NA},
   number = {NA},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {NA},
   keywords = {Verification, scattering parameter, vector network analyzer.},
   web_url = {http://ieeexplore.ieee.org/document/7540508/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {NA},
   language = {30},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540508},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mubarak, F. and Zeier, M. and Hoffmann, J. and Ridler, N.M. and Salter, M.J. and Kuhlmann, K.}
}

@Proceedings { ,
   title = {A Nonlinear Verification Device for Nonlinear Vector Network Analyzers},
   journal = {Proceedings Conference on Precision Electromagnetic Measurements 2016},
   year = {2016},
   month = {7},
   day = {10},
   volume = {1},
   number = {1},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-2},
   keywords = {Impedance matching, electromagnetic modeling, measurement uncertainty, microwave integrated circuits, nonlinear network analysis, semiconductor diodes.},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7540467\&isnumber=7539723},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {Westin Hotel, Ottawa, Ontario, Canada},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {10-07-2016 to 16-07-2016},
   language = {30},
   ISBN = {N/A},
   ISSN = {05891485},
   DOI = {10.1109/CPEM.2016.7540467},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Humphreys, D. A. and Rajabi, M. and Schreur, D. and Nielsen, T.}
}

@Article { ,
   title = {Comparison at the sub-100 fW optical power level of calibrating a single-photon detector using a high-sensitive, low-noise silicon photodiode and the double attenuator technique},
   journal = {Metrologia},
   year = {2016},
   month = {7},
   day = {8},
   volume = {53},
   number = {4},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {1115-1122},
   keywords = {detection efficiency, Si-SPAD, calibration, comparison},
   web_url = {http://iopscience.iop.org/journal/0026-1394},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Oxford},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/53/4/1115},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Porrovecchio, G. and Šmid, M. and Lopez, M. and Hofer, H. and Rodiek, B. and K{\"u}ck, S.}
}

@Article { ,
   title = {Optical to microwave clock frequency ratios with a nearly continuous strontium optical lattice clock},
   journal = {Metrologia},
   year = {2016},
   month = {7},
   day = {8},
   volume = {53},
   number = {4},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {1123},
   keywords = {atomic clocks, high precision spectrocopy, frequency ratios, optical lattice clocks},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1123/meta},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/53/4/1123},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Lodewyck, J and Bilicki, S and Bookjans, E and Robyr, J-L and Shi, C and Vallet, G and Le Targat, R and Nicolodi, D and Le Coq, Y and Gu{\'e}na, J and Abgrall, M and Rosenbusch, P and Bize, S}
}

@Article { ,
   title = {A second generation of low thermal noise cryogenic silicon  resonators},
   journal = {Journal of Physics: Conference Series},
   year = {2016},
   month = {7},
   day = {4},
   volume = {723},
   number = {1},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {012031},
   keywords = {ultrastable laser, thermal noise, coating, silicon resonator},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012031/meta},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {1742-6596},
   DOI = {10.1088/1742-6596/723/1/012031},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Matei, D and Legero, T and Grebing, C and H{\"a}fner, S and Lisdat, C and Weyrich, R and Zhang, W and Sonderhouse, L and Robinson, J M and Riehle, F and Ye, J and Sterr, U}
}

@Article { ,
   title = {Irradiation-induced degradation of PTB7 investigated by valence band and S 2p photoelectron spectroscopy},
   journal = {Nanotechnology},
   year = {2016},
   month = {7},
   day = {1},
   volume = {27},
   number = {32},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {324005},
   keywords = {organic photo voltaics, XPS, UPS},
   web_url = {http://iopscience.iop.org/article/10.1088/0957-4484/27/32/324005},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0957-4484},
   DOI = {10.1088/0957-4484/27/32/324005},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Darlatt, E and Muhsin, B and Roesch, R and Lupulescu, C and Roth, F and Kolbe, M and Gottwald, A and Hoppe, H and Richter, M}
}

@Article { vandenBromRWCB2016,
   title = {Smart grid power quality and stability measurements in Europe},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   year = {2016},
   month = {7},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   keywords = {instrument transformers, smart grids, metrology, phasor measurement units, synchrophasors, power quality,impedance measurement},
   tags = {SEG},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/CPEM.2016.7540462},
   stag_bib_extends_levelofaccess = {NA},
   author = {van den Brom, H. E. and Rietveld, G. and Wright, P. S. and Crotti, G. and Braun, J. P.}
}

@Proceedings { ,
   title = {Characterization and Optimization of Ultrasonic Tests for Inspection of Fiber-Reinforced Plastic Composites in Energy Related Applications, 19th World Conference on Non-Destructive Testing 13-17 June 2016, Munich},
   journal = {19th World Conference on Non-Destructive Testing 2016},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {Energy Generation},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   pages = {1-8},
   web_url = {http://www.ndt.net/article/wcndt2016/papers/we4d5.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {NDT.net},
   address = {Bad Breisig, Germany},
   event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany},
   event_name = {19th World Conference on Non-Destructive Testing 2016},
   event_date = {13-06-2016 to 17-06-2016},
   language = {30},
   ISBN = {978-3-940283-78-8},
   ISSN = {1435-4934},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hosseini, SH and Segur, DS and Boehm, RB and Gohlke, DG and Heckel, TH and Riemer, SR and Brackrock, DB and Gaal, MG}
}

@Proceedings { ,
   title = {Characterisation of Artificial and Natural Defects in Fibre Reinforced Plastics Designed for Energy Applications Using Active Thermography},
   journal = {19th World Conference on Non-Destructive Testing 2016},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {Composite Materials},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   pages = {1-9},
   web_url = {http://www.ndt.net/article/wcndt2016/papers/we2i4.pdf},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {NDT.net},
   address = {Bad Breisig, Germany},
   event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany},
   event_name = {19th World Conference on Non-Destructive Testing 2016},
   event_date = {13-06-2016 to 17-06-2016},
   language = {30},
   ISBN = {978-3-940283-78-8},
   ISSN = {1435-4934},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Maierhofer, CM and Krankenhagen, RK and R{\"o}llig, MR and Riemer, SR and Gower, MG and Baker, GB and Lodeiro, ML and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Adibekyan, AA and Gutschwager, BG}
}

@Proceedings { ,
   title = {Design and manufacture of reference and natural defect artefacts for the evaluation of NDE techniques for fibre reinforced plastic (FRP) composites in energy applications},
   journal = {19th World Conference on Non-Destructive Testing 2016},
   year = {2016},
   month = {7},
   volume = {2016},
   number = {Composite Materials},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   pages = {1-10},
   keywords = {Infrared Testing (IRT), Ultrasonic Testing (UT), Visual and Optical Testing (VT/OT), Other Methods, delamination, validation, carbon fiber reinforced plastic (CFRP), Glass Fiber Reinforced Plastic (GFRP), tensile load, flat bottom hole},
   web_url = {http://www.ndt.net/article/wcndt2016/papers/we1e4.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {NDT.net},
   address = {Bad Breisig, Germany},
   event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany},
   event_name = {19th World Conference on Non-Destructive Testing 2016},
   event_date = {13-06-2016 to 17-06-2016},
   language = {30},
   ISBN = {978-3-940283-78-8},
   ISSN = {1435-4934},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Gower, MG and Lodeiro, ML and Aktas, AA and Shaw, RS and Maierhofer, CM and Krankenhagen, RK and Augustin, SA and R{\"o}llig, MR and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Judaschke, RJ and Segur, DS}
}

@Proceedings { ,
   title = {A Calibration Method of the Linearity of Lock In Amplifiers},
   journal = {CPEM 2016 Digest},
   year = {2016},
   month = {7},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {549-550},
   keywords = {Impedance bridge, lock in amplifier, linearity, phase sensitive detector, resistive divider},
   web_url = {http://ieeexplore.ieee.org/document/7540691/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {CPEM 2016},
   address = {Ottawa},
   event_place = {The Westin Ottawa. Ottawa, Ontario (Canada).},
   event_name = {Conference on Precision Electromagnetics Measurements 2016},
   event_date = {10-07-2016 50 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {2160-0171},
   DOI = {10.1109/CPEM.2016.7540691},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Raso Alonso, F{\'e}lix isidro and Hortelano0 Garc{\'i}a, Alexandra and Izquierdo Garc{\'i}a, Mª Mar}
}

@Thesis { ,
   title = {Reducing surface recombination in black silicon photovoltaic devices using atomic layer deposition},
   year = {2016},
   month = {6},
   day = {20},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   keywords = {black silicon, atomic layer deposition, surface passivation, photovoltaic devices},
   web_url = {http://urn.fi/URN:ISBN:978-952-60-6919-7},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Unigrafia Oy},
   address = {Helsinki},
   school = {Aalto University},
   language = {30},
   ISBN = {978-952-60-6919-7},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://urn.fi/URN:ISBN:978-952-60-6919-7},
   author = {Repo, P.R.}
}

@Proceedings { OliveiraNKRVNHHT2016,
   title = {Geometric and Reflectance Signature Characterization of Complex Canopies using Hyperspectral Stereoscopic Images from UAV and Terrestrial Platforms},
   journal = {ISPRS - International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences},
   year = {2016},
   month = {6},
   day = {17},
   volume = {XLI-B7},
   number2 = {ENV53: MetEOC2: Metrology for earth observation and climate},
   pages = {77-82},
   keywords = {Hyperspectral, Radiometry, Photogrammetry, Geometry, Matching, Uncertainty},
   web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B7/77/2016/isprs-archives-XLI-B7-77-2016.pdf},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Copernicus GmbH},
   address = {Gottingen},
   event_place = {Prague, Czech Republic},
   event_name = {XXIII ISPRS Congress},
   event_date = {12-07-2016 to 19-07-2016},
   language = {30},
   ISSN = {2194-9034},
   DOI = {10.5194/isprsarchives-XLI-B7-77-2016},
   stag_bib_extends_levelofaccess = {NA},
   author = {Oliveira, R. and N{\"a}si, R. and Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Nevalainen, O. and Hakala, T. and Honkavaara, E. and Tommaselli, A.}
}

@Article { ,
   title = {High-performance near- and mid-infrared crystalline coatings},
   journal = {Optica},
   year = {2016},
   month = {6},
   day = {13},
   volume = {3},
   number = {6},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {647},
   keywords = {(300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings;
(310.1860) Deposition and fabrication; (140.4780) Optical resonators.},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {Optical Society of America},
   address = {Washington, D.C. 20036-1012 USA},
   language = {30},
   ISSN = {2334-2536},
   DOI = {10.1364/OPTICA.3.000647},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {COLE, G D and ZHANG, W and BJORK, B J and FOLLMAN, D and HEU, P and DEUTSCH, C and SONDERHOUSE, L and ROBINSON, J and FRANZ, C and ALEXANDROVSKI, A and NOTCUTT, M and HECKL, O H and YE, J and ASPELMEYER, M}
}

@Article { DauresRODB2016,
   title = {Accuracy of a dose-area product compared to an absorbed dose to water at a point in a 2 cm diameter field},
   journal = {Medical Physics},
   year = {2016},
   month = {6},
   day = {10},
   volume = {43},
   number = {7},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {4085-4092},
   keywords = {small fields, dose-area product, EBT3, dosimetric references},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {0094-2405},
   DOI = {10.1118/1.4953207},
   stag_bib_extends_levelofaccess = {NA},
   author = {Daures, J. and Rapp, B. and Ostrowsky, A. and Dufreneix, S. and Bordy, J. M.}
}

@Article { ,
   title = {Atomic fountains and optical clocks at SYRTE: Status and perspectives},
   journal = {Comptes Rendus Physique},
   year = {2016},
   month = {6},
   day = {1},
   volume = {16},
   number = {5},
   number2 = {SIB55: ITOC: International timescales with optical clocks},
   pages = {461 - 470},
   keywords = {Atomic fountain clocks, Optical lattice clocks, Optical frequency combs, Stability of natural constants, Timekeeping},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1631070515000614},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1016/j.crhy.2015.03.010},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-6-1},
   author = {Abgrall, M and Chupin, B and De Sarlo, L and Guena, J and Laurent, P and Le Coq, Y and Le Targat, R and Lodewyck, J and Lours, M and Rosenbuch, P and Rovera, G. D. and Bize, S}
}

@Proceedings { ,
   title = {Maximizing the Benefit of Existing Equipment for Nonlinear and Communication Measurements},
   journal = {N/A},
   year = {2016},
   month = {5},
   day = {27},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Nonlinear measurements, oscilloscope, sampling, analogue to digital conversion},
   web_url = {http://www.arftg.org/},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {San Francisco, CA, USA},
   event_name = {87th ARFTG Microwave Measurement Conference},
   event_date = {27-05-2016},
   language = {30},
   ISBN = {978-1-5090-1308-1},
   ISSN = {N/A},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-9-30},
   stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART},
   author = {Humphreys, D.  A. and Raffo, A. and Bosi, G. and Vannini, G. and Schreurs, D. and Gebremicael, K. N. and Morris, K.}
}

@Proceedings { ,
   title = {Impact of Microwave Measurement Uncertainty on the Nonlinear Embedding Procedure},
   journal = {N/A},
   year = {2016},
   month = {5},
   day = {27},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Microwave measurements uncertainty, microwave transistors, nonlinear embedding, power amplifiers, vector-calibrated nonlinear measurements.},
   web_url = {http://www.arftg.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {San Francisco, CA, USA},
   event_name = {87th ARFTG Microwave Measurement Conference},
   event_date = {27-05-2016},
   language = {30},
   ISBN = {978-1-5090-1308-1},
   ISSN = {N/A},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-9-30},
   stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART},
   author = {Bosi, G. and Raffo, A. and Avolio, G. and Schreurs, D. and Humphreys, D. A.}
}

@Article { WangBRdBBRBH2016,
   title = {Cross sections for ionization of tetrahydrofuran by protons at energies between 300 and 3000 keV},
   journal = {Physical Review A},
   year = {2016},
   month = {5},
   day = {20},
   volume = {93},
   number = {5},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {DNA cross sections, proton impact, tetrahydrofuran, Bragg peak},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {American Physical Society (APS)},
   address = {1 Research Road,Ridge, NY 11961-2701, (631) 591-4000, United States},
   language = {30},
   ISSN = {2469-9926, 2469-9934},
   DOI = {10.1103/PhysRevA.93.052711},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wang, Mingjie and Bennett, Daniel and Rudek, Benedikt and de Vera, Pablo and Bug, Marion and Buhr, Ticia and Rabus, Hans and Baek, Woon Yong and Hilgers, Gerhard}
}

@Proceedings { NeuschaeferRubeRI2016,
   title = {Dreidimensionale Form- und Gr{\"o}{\ss}encharaketrisierung von Erosionspartikeln mittels R{\"o}ntgen-Computertomographie},
   journal = {Sensoren und Messsysteme 2016},
   year = {2016},
   month = {5},
   day = {16},
   volume = {5},
   number = {4},
   number2 = {IND61: Metrosion: Metrology to enable high temperature erosion testing},
   pages = {391-396},
   keywords = {R{\"o}ntgen-Computertomographie (CT), abrasive Mikropartikel, Form und Gr{\"o}{\ss}e von Partikeln, 3-dimensionelle Messtechnik, Charakterisierung von Erosionspartikeln},
   web_url = {https://www.ama-science.org/proceedings/details/2380},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {AMA},
   address = {Wunstorf},
   event_place = {N{\"u}rnberg, Germany},
   event_name = {18. GMA/ITG-Fachtagung Sensoren und Messsysteme 2016},
   event_date = {10-05-2016 to 11-05-2016},
   language = {43},
   ISBN = {978-3-9816876-0-6},
   DOI = {10.5162/sensoren2016/5.4.2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Neuschaefer-Rube, U and Rothleitner, Ch and Illmann, J}
}

@Proceedings { ,
   title = {Traceable Calibration with 1.0mm Coaxial Standards},
   journal = {2016 87th ARFTG Microwave Measurement Conference (ARFTG)},
   year = {2016},
   month = {5},
   volume = {May 2016},
   number = {1},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Coaxial, S-parameters, transmission, reflection, vector network analyzer},
   web_url = {http://ieeexplore.ieee.org/document/7501943/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {New York},
   event_place = {San Francisco},
   event_name = {87th ARFTG Microwave Measurement Conference},
   event_date = {27.5.2016},
   language = {30},
   ISBN = {n/a},
   ISSN = {n/a},
   DOI = {10.1109/ARFTG.2016.7501943},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hoffmann, J and Wollensack, M and Ruefenacht, J and Stalder, D and Zeier, M}
}

@Article { CoutinR2016,
   title = {Caract{\'e}risation et validation d’un nouveau radiom{\`e}tre cryog{\'e}nique au LNE-LCM},
   journal = {Revue fran\c{c}aise de m{\'e}trologie},
   year = {2016},
   month = {4},
   day = {25},
   number = {41},
   number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry},
   pages = {11-20},
   keywords = {Caract{\'e}risation et validation d’un nouveau radiom{\`e}tre cryog{\'e}nique au LNE-LCM},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {EDP Sciences},
   language = {30},
   ISSN = {1772-1792, 1776-3215},
   DOI = {10.1051/rfm/2016002},
   stag_bib_extends_levelofaccess = {NA},
   author = {Coutin, J.-M. and Rougi{\'e}, B.}
}

@Article { ,
   title = {Towards joint reconstruction of noise and losses in quantum channels},
   journal = {Quantum Measurements and Quantum Metrology},
   year = {2016},
   month = {4},
   day = {21},
   volume = {3},
   number = {1},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {27–31},
   keywords = {Quantum Communication, Quantum Metrology, Calibration},
   web_url = {https://www.degruyter.com/view/j/qmetro},
   misc2 = {EMPIR 2014: Industry},
   publisher = {DE GRUYTER OPEN},
   address = {Warsaw (Poland)},
   language = {30},
   ISSN = {2299-114X},
   DOI = {10.1515/qmetro-2016-0005},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {https://www.degruyter.com/downloadpdf/j/qmetro.2016.3.issue-1/qmetro-2016-0005/qmetro-2016-0005.pdf},
   author = {Piacentini, F. and Avella, A. and Traina, P. and Lolli, L. and Taralli, E. and Monticone, E. and Rajteri, M. and Fukuda, D. and Degiovanni, I. P. and Brida, G.}
}

@Article { ,
   title = {Absolute calibration of an EMCCD camera by quantum correlation, linking photon counting to the analog regime},
   journal = {Optics Letters},
   year = {2016},
   month = {4},
   day = {14},
   volume = {41},
   number = {8},
   number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication},
   pages = {1841-1844},
   keywords = {CCD, charge-coupled device; Quantum detectors; Calibration.},
   web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-8-1841},
   misc2 = {EMPIR 2014: Industry},
   publisher = {OSA Publishing},
   address = {Washington, D.C. 20036-1012 USA},
   language = {30},
   ISSN = {0146-9592/16/081841-04},
   DOI = {10.1364/OL.41.001841},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-4-14},
   author = {Avella, A. and Ruo-Berchera, I. and Degiovanni, I. P. and Brida, G. and Genovese, M.}
}

@Article { ,
   title = {Investigation of the beam quality of a terahertz emitting vertical-external-cavity surface-emitting laser},
   journal = {Journal of Infrared, Millimeter and Terahertz Waves},
   year = {2016},
   month = {4},
   day = {4},
   volume = {37},
   number = {6},
   number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security},
   pages = {536-539},
   keywords = {beam quality, Vertical-External-Cavity Surface-Emitting Laser},
   web_url = {http://link.springer.com/article/10.1007\%2Fs10762-016-0274-9},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Springer},
   address = {Cham, Switzerland},
   language = {30},
   ISSN = {1866-6892},
   DOI = {10.1007/s10762-016-0274-9},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Zhang, Fan and Wang, Siming and Rehn, Arno and Wichmann, Matthias and Urbasch, Gunter and Rahimi-Iman, Arash and Koch, Stephan W. and Koch, Martin}
}

@Article { ,
   title = {Progress towards the determination of thermodynamic temperature with ultra-low uncertainty},
   journal = {Philosophical Transactions of the Royal Society A},
   year = {2016},
   month = {3},
   day = {28},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {20150046},
   keywords = {Boltzmann constant, thermodynamic temperature, International Temperature Scale},
   web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150046},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society Publishing},
   address = {London},
   language = {30},
   ISSN = {1364-503X},
   DOI = {10.1098/rsta.2015.0046},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-3-28},
   stag_bib_extends_persistent_identifier = {http://rsta.royalsocietypublishing.org/content/374/2064/20150046},
   author = {Gavioso, R M and Madonna Ripa, D and Steur, P P M and Gaiser, C and Zandt, T and Fellmuth, B and de Podesta, M and Underwood, R and Sutton, G and Pitre, L and Sparasci, F and Risegari, L and Gianfrani, L and Castrillo, A and Machin, G}
}

@Article { ,
   title = {Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points},
   journal = {Philosophical Transactions of the Royal Society A},
   year = {2016},
   month = {3},
   day = {28},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {20150044},
   keywords = {high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics},
   web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150044},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society},
   address = {London},
   language = {30},
   DOI = {10.1098/rsta.2015.0044},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Wooliams, E.R and Anhalt, K and Ballico, M and Bloembergen, P and Bourson, F and Briaudeau, S and Campos, J and Cox, M.G and del Campo, D and Dong, W and Dury, M.R and Gavrilov, V and Grigoryeva, I and Hernanz, M.L and Jahan, F and Khlevnoy, B and Khromchenko, V and Lowe, D.H and Lu, X and Machin, G and Mantilla, J.M and Martin, M.J and McEvoy, H.C and Rougie, B and Saldi, M and Salim, S.G.R and Sasajima, N and Taubert, D.R and Todd, A.D.W and Van den Bossche, R}
}

@Article { ,
   title = {DABAM: an open-source database of x-ray mirrors metrology},
   journal = {Journal of Synchrotron Radiation},
   year = {2016},
   month = {3},
   day = {24},
   volume = {23},
   number = {23},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {665-678},
   keywords = {X-ray mirror; metrology; database; Python; statistics.},
   web_url = {http://scripts.iucr.org/cgi-bin/paper?S1600577516005014},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IUCr Journals},
   address = {Chester CH1 2HU, England},
   language = {30},
   ISSN = {1600-5775},
   DOI = {10.1107/S1600577516005014},
   extern = {1},
   stag_bib_extends_fe_group = {59,80},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Sanchez del Rio, M and Bianchi, D and Cocco, D and Glass, M and Idir, M and Metz, J and Raimondi, L and Rebuffi, L and Reininger, R and Shi, X and Siewert, F and Spielmann-Jaeggi, S and Takacs, P and Tomasset, M and Tonnessen, T and Tonnessenivo, A and Yashchuk, VV}
}

@Article { ,
   title = {Accurate and precise quantification of Cu,Zn-SOD in human red blood cells using species-specific double and triple IDMS},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2016},
   month = {3},
   day = {17},
   volume = {9 / 2016},
   number = {31},
   number2 = {HLT05: Metallomics: Metrology for metalloproteins},
   pages = {1922-1928},
   keywords = {Clinical/biomedical analysis, Metalloproteins, Reference materials,  Reference measurement procedures},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/c5ja00459d\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {The Royal Society of Chemistry},
   address = {Cambridge, United Kingdom},
   language = {30},
   ISSN = {0267-9477 (print) ; 1364-5544 (online)},
   DOI = {10.1039/c5ja00459d},
   extern = {1},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Gleitzmann, Julia and Raab, Andrea and Schulze, Dirk and Waetzig, Hermann and Feldmann, Joerg and Swart, Claudia}
}

@Article { ,
   title = {Dissemination of thermodynamic temperature above the freezing point of silver},
   journal = {Philosophical Transactions of the Royal Society A},
   year = {2016},
   month = {2},
   day = {22},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {20150043},
   keywords = {high-temperature fixed points, thermodynamic temperature, filter radiometer, radiation thermometer},
   web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150043},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society},
   address = {London},
   language = {30},
   DOI = {10.1098/rsta.2015.0043},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Sadli, M and Machin, G and Anhalt, K and Bourson, F and Biraudeau, S and del Campo, D and Diril, A and Kozlova, O and Lowe, D.H and Mantilla Amor, J.M and Martin, M.J and McEvoy, H.C and Ojanen-Saloranta, M and Pehlivan, {\"O} and Rougi{\'e}, B and Salim, S.G.R}
}

@Article { MonteyneVPRFEBE2016,
   title = {Preparation and evaluation of sufficiently homogeneous and stable reference materials for priority hazardous substances in whole water},
   journal = {Accreditation and Quality Assurance},
   year = {2016},
   month = {2},
   volume = {21},
   number = {2},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {113-120},
   keywords = {Homogeneity, Stability, Uncertainty, Whole water, Reference materials, PAHs, PBDEs, TBT, Water Framework Directive},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0949-1775, 1432-0517},
   DOI = {10.1007/s00769-015-1189-1},
   stag_bib_extends_levelofaccess = {NA},
   author = {Monteyne, E. and Vanermen, G. and Philipp, R. and Richter, J. and Fettig, I. and Elordui-Zapatarietxe, S. and Boom, G. and Emteborg, H.}
}

@Article { SawalNPGZRBTGSGACFEERBP2016,
   title = {An interlaboratory comparison on whole water samples},
   journal = {Accreditation and Quality Assurance},
   year = {2016},
   month = {1},
   day = {29},
   volume = {21},
   number = {2},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {121-129},
   keywords = {Water Framework Directive, Interlaboratory comparison, Whole water sample, Suspended particulate matter, Polycyclic aromatic hydrocarbons, Polybrominated diphenyl ethers, Tributlyltin},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0949-1775, 1432-0517},
   DOI = {10.1007/s00769-015-1190-8},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sawal, G. and Nousiainen, M. and Pr{\"o}frock, D. and Gago, A.G. and Zuliani, T. and Rodr{\'i}guez-Cea, A. and Binici, B. and Tun\c{c}, M. and Gokcen, T. and Swart, C. and Gantois, F. and Alasonati, E. and Cabillic, J. and Fettig, I. and Emteborg, H. and Elordui-Zapatarietxe, S. and Richter, J. and Buzoianu, M. and Philipp, R.}
}

@Proceedings { MonteBKALBGRRKMAG2016,
   title = {Characterisation of artificial defects in CFRP and GFRP sheets designed for energy applications using active thermography},
   journal = {Proceedings of the 2016 International Conference on Quantitative InfraRed Thermography},
   year = {2016},
   month = {1},
   day = {16},
   number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications},
   keywords = {Characterisation artificial defects CFRP and GFRP active thermography},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {QIRT Council},
   address = {1065 ave. de la Medecine Quebec City Quebec G1V 0A6 Canada},
   event_place = {Gdansk},
   event_name = {QIRT 16},
   event_date = {04-07-2016 to 08-07-2016},
   language = {30},
   DOI = {10.21611/qirt.2016.076},
   stag_bib_extends_levelofaccess = {NA},
   author = {Monte, C. and Blahut, A. and Knazovicka, L. and Aktas, A. and Lodeiro, M. and Baker, G. and Gower, M. and Rehmer, B. and R{\"o}llig, M. and Krankenhagen, R. and Maierhofer, C. and Adibekyan, A. and Gutschwager, B.}
}

@Article { ,
   title = {Electron beam controlled covalent attachment of small organic molecules to graphene},
   journal = {Nanoscale},
   year = {2016},
   month = {1},
   day = {4},
   number = {8},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {2711-2719},
   keywords = {graphene, polyaromatic molecules, measurement},
   web_url = {http://pubs.rsc.org/en/content/articlehtml/2016/nr/c5nr07539d},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {The Royal Society of Chemistry},
   language = {30},
   DOI = {10.1039/C5NR07539D},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Markevich, A. and Kurasch, S. and Lehtinen, O. and Reimer, O. and Feng, X. and M{\"u}llen, K. and Turchanin, A. and Khlobystov, A. N. and Kaiser, U. and Besley, E.}
}

@Article { DenoziereJPPPPGBR2016,
   title = {First international comparison of primary absorbed dose to water standards in the medium-energy X-ray range},
   journal = {Metrologia},
   year = {2016},
   month = {1},
   volume = {53},
   number = {1A},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {06007-06007},
   keywords = {absorbed dose to water, medium energy x ray, comparison},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/0026-1394/53/1A/06007},
   stag_bib_extends_levelofaccess = {NA},
   author = {Denoziere, M. and Jansen, B and Prez, L.d and Pooter, J.d. and Pinto, M. and Pimpinella, M. and Guerra, A.S. and B{\"u}ermann, L. and Rapp, B.}
}

@Article { WeigeltSRRMGGDY2016,
   title = {Microfocusing at the PG1 beamline at FLASH},
   journal = {Journal of Synchrotron Radiation},
   year = {2016},
   month = {1},
   volume = {23},
   number = {1},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {123-131},
   keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {International Union of Crystallography (IUCr)},
   language = {30},
   ISSN = {1600-5775},
   DOI = {10.1107/S1600577515023127},
   stag_bib_extends_levelofaccess = {NA},
   author = {Weigelt, H. and Siewert, F. and R{\"u}bhausen, M. and Reininger, R. and Mey, T. and Goderich, R. and Gerasimova, N. and Dziarzhytski, S. and Yandayan, T.}
}

@Article { ,
   title = {Quantum and Classical Characterization of Single/Few Photon Detectors},
   journal = {Quantum Matter},
   year = {2016},
   volume = {4},
   number = {3},
   number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications},
   pages = {1-13},
   keywords = {Quantum Tomography, Quantum Information, Single Photon Detectors, POVM},
   web_url = {http://www.aspbs.com/qm.html},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {30},
   ISSN = {2164-7615},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Mingolla, M. G. and Piacentini, F. and Avella, A. and Gramegna, M. and Lolli, L. and Meda, A. and Ruo Berchera, I. and Taralli, E. and Traina, P. and Rajteri, M. and Brida, G. and Degiovanni, I. P. and Genovese, M.}
}

@Proceedings { ,
   title = {Brightness and sparkle appearance of goniochromatic samples},
   year = {2016},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   keywords = {brightness, sparkle, appearance},
   web_url = {http://www.ingentaconnect.com/content/ist/ei/2016/00002016/00000009/art00013;jsessionid=15huth3un63uh.x-ic-live-03},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   event_place = {San francisco, California, United States},
   event_name = {Measuring, Modeling, and Reproducing Material Appearance 2016},
   language = {30},
   DOI = {10.2352/ISSN.2470-1173.2016.9.MMRMA-365},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Iacomussi, P. and Radis, M. and Rossi, G.}
}

@Article { ,
   title = {Low-cost Instrument for Whispering-Gallery Thermometry up to 19 GHz},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2016},
   number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination},
   keywords = {Frequency conversion;Frequency measurement;Instruments;Microwave measurement;Resonant frequency;Standards;Uncertainty;Microwave resonance measurement;whispering gallery thermometry.},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Institute of Electrical and Electronics Engineers, Incorporated (the ''IEEE'')},
   address = {Piscataway},
   language = {30},
   DOI = {10.1109/TIM.2015.2508258},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Corbellini, S. and Ramella, C. and Pirola, M. and Fernicola, V. and Cappella, A.}
}

@Article { ,
   title = {Estimates of the difference between thermodynamic temperature and the ITS-90 in the range 118 K to 303 K},
   journal = {Philosophical Transactions of the Royal Society A},
   year = {2016},
   volume = {374},
   number = {2064},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {16},
   keywords = {primary thermometry, acoustic gas thermometry, ITS-90},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society Publishing},
   address = {London},
   language = {30},
   ISSN = {1364-503X},
   DOI = {10.1098/rsta.2015.0048},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Underwood, R and de Podesta, M and Sutton, G and Stanger, L and Rusby, R and Harris, P and Morantz, P and Machin, G}
}

@Proceedings { ,
   title = {The Propagation Constant of Coaxial Offset Shorts with Rough Surfaces},
   journal = {CPEM 2014 Digest},
   year = {2016},
   volume = {2014},
   number = {2014},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {14-15},
   keywords = {attenuation constant, calibration, offset short, phase constant, propagation constant, vector network analyzer},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {n/a},
   event_place = {Rio de Janeiro, Brazil},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {25-08-2014 to 29-08-2014},
   language = {30},
   ISBN = {978-1-4799-5205-2},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898235},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No option selected},
   author = {Hoffmann, J and Ruefenacht, J and Zeier, M}
}

@Proceedings { ,
   title = {Comparison of methods for measurement of equivalent source match},
   journal = {Proceedings of the 45th European Microwave Conference},
   year = {2016},
   volume = {2015},
   number = {2015},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {730-733},
   keywords = {Vector Network Analyzer, splitter, equivalent source match, calibration standard, connector},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {n/a},
   event_place = {Paris, France},
   event_name = {European Microwave Conference},
   event_date = {07-09-2015 to 10-09-2015},
   language = {30},
   ISBN = {n/a},
   ISSN = {n/a},
   DOI = {10.1109/EuMC.2015.7345867},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hoffmann, J and Wollensack, M and Ruefenacht, J and Zeier, M}
}

@Article { ,
   title = {Extended S-parameters for imperfect test ports},
   journal = {Metrologia},
   year = {2016},
   volume = {52},
   number = {1},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {121-129},
   keywords = {vector network analyzer, S-parameter, connector},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP},
   address = {n/a},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1088/0026-1394/52/1/121},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-19},
   author = {Hoffmann, J and Wollensack, M and Ruefenacht, J and Zeier, M and Zeier, Markus}
}

@Article { ,
   title = {METROLOGICALLY TRACEABLE DETERMINATION OF THE WATER CONTENT IN BIOPOLYMERS: INRIM ACTIVITY},
   journal = {International Journal of Thermophysics},
   year = {2016},
   volume = {-},
   number = {Special Issue Tempmeko 2016},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {-},
   keywords = {Water content, metrological traceability, coulometric Karl Fischer titration, Evolved Water Vapour analysis, biopolymers},
   web_url = {-},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer},
   address = {Berlin},
   language = {30},
   ISSN = {ISSN: 0195-928X},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rolle, F. and Beltramino, G. and Fernicola, V. and Sega, M. and Verdoja, A.}
}

@Article { ,
   title = {Characterization of a series of absolute isotope reference materials for magnesium: ab initio calibration of the mass spectrometers, and determination of isotopic compositions and relative atomic weights},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2016},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society of Chemistry},
   address = {London},
   language = {30},
   DOI = {10.1039/c6ja00013d},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Vogl, Jochen and Brandt, Bj¨orn and Noordmann, Janine and Rienitz, Olaf and Malinovskiy, Dmitriy}
}

@Article { ,
   title = {Annihilation of structural defects in chalcogenide absorber films for high-efficiency solar cells},
   journal = {Energy \& Environmental Science},
   year = {2016},
   volume = {9},
   number = {5},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {1818-1827},
   keywords = {Thin films, solar cells, Cu(In,Ga)Se2, XRD, XRF, in-situ, planar defects, TEM},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {The Royal Society of Chemistry},
   address = {London},
   language = {30},
   ISSN = {1754-5692},
   DOI = {10.1039/c6ee00402d},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2017-4-18},
   author = {Mainz, R. and Simsek Sanli, E. and Stange, H. and Azulay, D. and Brunken, S. and Greiner, D. and Hajaj, S. and Heinemann, M. D. and Kaufmann, C. A. and Klaus, M. and Ramasse, Q. M. and Rodriguez-Alvarez, H. and Weber, A. and Balberg, I. and Millo, O. and van Aken, P. A. and Abou-Ras, D.}
}

@Proceedings { LiDHRVAR2016,
   subid = {80},
   title = {Development of a Reference Wafer for On-wafer Testing of Extreme Impedance Devices},
   journal = {IEEE XPlore},
   year = {2016},
   number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components},
   keywords = {Standards,  Calibration,  Impedance,  Nanoscale devices,  Impedance measurement,  Probes,  Transmission line measurements, extreme impedance measurement,  Calibration,  on-wafer measurement,  nano-scale,  co-planar waveguide,  RF nanotechnology},
   web_url = {http://epubs.surrey.ac.uk/813783/1/Votsi_88th_ARFTG_Paper_Summary\%20\%28002\%29.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   address = {USA \& Canada},
   event_place = {Austin, TX, USA},
   event_name = {Microwave Measurement Conference (ARFTG)},
   event_date = {08-12-2016 to 09-12-2016},
   language = {30},
   DOI = {10.1109/ARFTG.2016.7839719},
   stag_bib_extends_levelofaccess = {NA},
   author = {Votsi, H. and Roch-Jeune, I. and Haddadi, K. and Li, C. and Dambrine, G. and Aaen, P.H. and Ridler, N.}
}

@Proceedings { ,
   title = {A Low Frequency Josephson Impedance Bridge},
   journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest},
   year = {2016},
   volume = {n / a},
   number = {n / a},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {7540509 (2 pp.)},
   keywords = {Impedance bridge, Josephson array, Josephson impedance bridge, Josephson voltage standard.},
   web_url = {http://ieeexplore.ieee.org/document/7540509/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Piscataway, USA},
   event_place = {Ottawa, Canada},
   event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)},
   event_date = {10-07-2016 to 15-07-2016},
   language = {30},
   ISBN = {978-1-4673-9134-4},
   ISSN = {Electronic ISSN: 2160-0171},
   DOI = {10.1109/CPEM.2016.7540509},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540509/},
   author = {Eklund, G and Bergsten, T and Rydler, K-E}
}

@Proceedings { ,
   title = {New Approach for Measuring Moisture in Solids Using Radio Frequency and Microwave},
   journal = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances},
   year = {2016},
   volume = {11th},
   number = {2016},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {297},
   keywords = {dielectric permittivity, capacitive cell, coaxial cell, moisture measurement},
   web_url = {http://www.isema2016.org/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Edifir-Edizioni},
   address = {Firenze},
   event_place = {Firenze (Italy)},
   event_name = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances},
   event_date = {23-05-2016 to 27-05-2016},
   language = {30},
   ISBN = {978-88-7970-800-5},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ben Ayoub, MW and Georgin, E and Rochas, J F and Hubert, S and Achard, P and Neves, L and Sabouroux, P}
}

@Article { ,
   title = {Multi-mode absorption spectroscopy using a quantum cascade laser for simultaneous detection of NO and H2O},
   journal = {Applied Physics B},
   year = {2016},
   volume = {122},
   number = {8},
   number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments},
   pages = {226},
   keywords = {FREQUENCY COMB; TEMPERATURE; MUMAS},
   web_url = {http://link.springer.com/article/10.1007/s00340-016-6499-4/fulltext.html},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Springer},
   address = {New  York},
   language = {30},
   ISSN = {0946-2171},
   DOI = {10.1007/s00340-016-6499-4},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {O'Hagan, S and Pinto, T and Ewart, P and Ritchie, GAD}
}

@Article { ,
   title = {Metrological challenges for measurements of key climatological observables: oceanic salinity and pH, and atmospheric humidity. Part 1: overview},
   journal = {Metrologia},
   year = {2016},
   volume = {53},
   number = {1},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {R1-R11},
   keywords = {seawater salinity, seawater pH, relative humidity, traceability},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1/R1},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Institute of Physics},
   address = {London},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/53/1/R1},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Feistel, R and Wielgosz, R and Bell, S A and Cam{\~o}es, M F and Cooper, J R and Dexter, P and Dickson, A G and Fisicaro, P and Harvey, A H and Heinonen, M and Hellmuth, O and Kretzschmar, H-J and Lovell-Smith, J W and McDougall, T J and Pawlowicz, R and Ridout, P and Seitz, S and Spitzer, P and Stoica, D and Wolf, H}
}

@Article { ,
   title = {Reassessing changes in diurnal temperature range: A  new  data set and characterization  of  data biases},
   journal = {Journal  of  Geophysical Research: Atmospheres},
   year = {2016},
   volume = {121},
   number = {10},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {5115–5137},
   keywords = {diurnal temperature range, data set, reassessment},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/2015JD024583/abstract},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Wiley},
   address = {Hoboken},
   language = {30},
   ISSN = {2169-897X},
   DOI = {10.1002/2015JD024583},
   extern = {1},
   stag_bib_extends_fe_group = {79,59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Thorne, P W and Menne, M J and Williams, C N and Rennie, J J and Lawrimore, J H and Vose, R S and Petersono, T C and Durre, I and Davy, R and Esau, I and Klein-Tank, A M G and Merlone, A}
}

@Article { ,
   title = {The linkup of mono-elemental solutions to the SI using INAA: a measurement procedure and the achievable uncertainty},
   journal = {Journal of Radioanalytical and Nuclear Chemistry},
   year = {2015},
   month = {12},
   day = {30},
   volume = {306},
   number = {3},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   pages = {1-10},
   keywords = {Neutron activation analysis Metrological traceability Reference solution Molybdenum},
   web_url = {http://link.springer.com/article/10.1007\%2Fs10967-015-4676-2\#/page-1},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer},
   address = {Berlib},
   language = {30},
   ISSN = {ISSN 0236-5731},
   DOI = {10.1007/s10967-015-4676-2},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {D’Agostino, Giancarlo and Bergamaschi, Luigi and Di Luzio, Marco and Noordmann, Janine and Oddone, Massimo and Rienitz, Olaf}
}

@Article { RappDGSLODDB2015,
   title = {Using a dose-area product for absolute measurements in small fields: a feasibility study},
   journal = {Physics in Medicine and Biology},
   year = {2015},
   month = {12},
   day = {22},
   volume = {61},
   number = {2},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {650-662},
   keywords = {small fields, dosimetric reference, dose-area product, absolute dosimetry},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/0031-9155/61/2/650},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rapp, B and Delaunay, F and Gouriou, J and Sommier, L and Le Roy, M and Ostrowsky, A and Dufreneix, S and Daures, J and Bordy, J-M}
}

@Article { ,
   title = {A multi-thermogram-based Bayesian model for the determination of the thermal diffusivity of a material},
   journal = {Metrologia},
   year = {2015},
   month = {12},
   day = {16},
   volume = {53},
   number = {1},
   number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation},
   pages = {1-9},
   keywords = {inverse problem, Bayesian framework, Metropolis–Hastings, measurement
uncertainty, prior distributions, thermal diffusivity},
   tags = {MAT},
   web_url = {-},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {BIPM},
   address = {S{\`e}vres},
   language = {30},
   ISSN = {-},
   DOI = {10.1088/0026-1394/53/1/S1},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Allard, A. and Fischer, N. and Ebrard, G. and Hay, B. and Harris, P. and Wright, L. and Rochals, D. and Mattout, J.}
}

@Article { ,
   title = {R{\'e}f{\'e}rences radiom{\'e}triques pour les mesures de rayonnement optique},
   journal = {Techniques de l'ing{\'e}nieur},
   year = {2015},
   month = {12},
   day = {10},
   volume = {none},
   number = {none},
   number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry},
   pages = {Article R6412},
   keywords = {none},
   web_url = {http://www.techniques-ingenieur.fr/base-documentaire/mesures-analyses-th1/metrologie-optique-et-photonique-42143210/references-radiometriques-pour-les-mesures-de-rayonnement-optique-r6412/grandeurs-caracteristiques-des-rayonnements-r6412niv10002.html},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {http://www.techniques-ingenieur.fr/},
   address = {Saint-Denis Cede},
   language = {37},
   ISSN = {none},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rougi{\'e}, B. and Coutin, J. M.}
}

@Article { BallesterNebotAFRRG2015,
   title = {Determination of ultratrace levels of tributyltin in waters by isotope dilution and gas chromatography coupled to tandem mass spectrometry},
   journal = {Journal of Chromatography A},
   year = {2015},
   month = {12},
   volume = {1425},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {265-272},
   keywords = {EU Water Framework Directive, GC–MS/MS, Isotope Dilution Mass Spectrometry, Tributyltin},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0021-9673},
   DOI = {10.1016/j.chroma.2015.11.031},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ballester Nebot, S. and Aranda Mares, J.L. and Font Cardona, N. and Rodr{\'i}guez-Gonz{\'a}lez, P. and Rodr{\'i}guez-Cea, A. and Garc{\'i}a Alonso, J.I.}
}

@Article { ,
   title = {Ion beam analysis of Cu(In,Ga)Se2 thin film solar cells},
   journal = {Applied Surface Science},
   year = {2015},
   month = {11},
   day = {30},
   volume = {356},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {631–638},
   keywords = {Thin solar Cu(In,Ga)Se2 cells, Ion beam analysis, RBS/PIXE techniques, Synchrotron GIXRF analysis, Depth profiling},
   web_url = {http://ac.els-cdn.com/S0169433215019467/1-s2.0-S0169433215019467-main.pdf?_tid=cba9d288-1c21-11e6-9bf0-00000aab0f26\&acdnat=1463484395_b9279df87868924a41b103cfe0aeacf7},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier},
   language = {30},
   ISSN = {0169-4332},
   DOI = {10.1016/j.apsusc.2015.08.133},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Karydas, AGK and Streeck, CS and Bogdanovic Radovic, IBR and Kaufmann, CK and Rissom, TR and Beckhoff, BB and Jakšic, MJ and Barradas, NPB}
}

@Proceedings { SperlingPTRPJBR2015,
   title = {Multiple Transfer Standard for characterisation of sphere test setups},
   journal = {Proceedings of the CIE Tutorial and Expert Symposium on the  CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard},
   year = {2015},
   month = {11},
   day = {26},
   volume = {1},
   number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting},
   pages = {1-5},
   keywords = {LED standard, multiple standard, characterisation sphere setup},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Commission Internationale de L'Eclairage},
   address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A,  1010 Vienna, Austria},
   event_place = {Braunschweig, Germany},
   event_name = {CIE Tutorial and Expert Symposium on the  CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard},
   event_date = {26-11-2015 to 26-11-2015},
   language = {30},
   ISBN = {978-3-902842-28-2},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sperling, A. and Penda, S. and Taddeo, M. and Revtova, E. and Poikonen, T. and Jordan, W. and Blattner, P. and Renoux, D.}
}

@Article { ,
   title = {A clock network for geodesy and fundamental science},
   journal = {Nature Communication},
   year = {2015},
   month = {11},
   day = {24},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   web_url = {arxiv.org/abs/1511.07735},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and D{\"o}rscher, S. and H{\"a}fner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G.}
}

@Article { ,
   title = {Local weighting of nanometric track structure properties in macroscopic voxel geometries for particle beam treatment planning},
   journal = {Physics in Medicine and Biology},
   year = {2015},
   month = {11},
   day = {12},
   volume = {60},
   number = {23},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {9145 –9156},
   keywords = {Geant4-DNA, nanodosimetry, proton therapy},
   web_url = {http://iopscience.iop.org/article/10.1088/0031-9155/60/23/9145},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {0031-9155},
   DOI = {10.1088/0031-9155/60/23/9145},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Alexander, F and Villagrasa, C and Rabus, H and Wilkens, J J}
}

@Article { ,
   title = {An in-depth evaluation of accuracy and precision in Hg isotopic analysis via pneumatic nebulization and cold vapor generation multi-collector ICP-mass spectrometry},
   journal = {Anal Bioanal Chem},
   year = {2015},
   month = {11},
   day = {9},
   volume = {408},
   number = {2},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   pages = {417–429},
   keywords = {Mass spectrometry . ICP-MS . Biological  samples . Metals . Heavy metals . Reference materials . Geochemistry . Geology},
   web_url = {http://link.springer.com/article/10.1007\%2Fs00216-015-9131-2},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer},
   address = {Berlin},
   language = {30},
   DOI = {10.1007/s00216-015-9131-2},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rua-Ibarz, Ana and Bolea-Fernandez, Eduardo and Vanhaecke, Frank}
}

@Article { ,
   title = {Inter-comparison of halocarbons in an atmospheric dry whole air sample},
   journal = {Elementa},
   year = {2015},
   month = {11},
   day = {3},
   volume = {3},
   number = {N/A},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {N/A},
   keywords = {None supplied},
   web_url = {https://www.elementascience.org/articles/75},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {BioOne},
   address = {Washington DC},
   language = {30},
   ISSN = {2325-1026},
   DOI = {10.12952/journal.elementa.000075},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rhoderick, G C and Hall, B D and Harth, C M and Kim, J S and Lee, J and Montzka, S A and Muhle, J and Reimann, S and Vollmer, M K and Weiss, R F}
}

@Article { RossiRI2015,
   title = {European EMRP Projects About LED Lighting},
   journal = {Energy Procedia},
   year = {2015},
   month = {11},
   volume = {78},
   number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting},
   pages = {2675-2680},
   keywords = {LED lighting, metrology, efficiency, European Community},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1876610215020779},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1876-6102},
   DOI = {10.1016/j.egypro.2015.11.345},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rossi, G. and Radis, M. and Iacomussi, P.}
}

@Article { ,
   title = {Towards a shock tube method for the dynamic calibration of pressure sensors},
   journal = {PTB-Mitteilungen},
   year = {2015},
   month = {11},
   volume = {125},
   number = {2},
   number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities},
   pages = {24-37},
   keywords = {dynamic measurement, pressure sensor calibration, primary calibration, GUM, shock tube, step response},
   web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4115465/},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Physikalisch-Technische Bundesanstalt},
   address = {Braunschweig},
   language = {30},
   ISSN = {ISSN 0030-834X},
   DOI = {10.7795/310.20150205},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Downes, S. and Knott, A. and Robinson, I.}
}

@Article { GarciaAlonsoRR2015,
   title = {Study of the degradation of butyltin compounds in surface water samples under different storage conditions using multiple isotope tracers and GC-MS/MS},
   journal = {Environmental Science and Pollution Research},
   year = {2015},
   month = {11},
   volume = {23},
   number = {5},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {4876-4885},
   keywords = {Tributyltin, Multiple isotopic tracers, Storage conditions, Whole water samples},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0944-1344, 1614-7499},
   DOI = {10.1007/s11356-015-5686-x},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garc{\'i}a Alonso, J.I. and Rodr{\'i}guez-Gonz{\'a}lez, P. and Rodr{\'i}guez-Cea, A.}
}

@Article { ,
   title = {Probing the homogeneity of the isotopic composition and molar mass of the ''Avogadro''-crystal},
   journal = {Metrologia},
   year = {2015},
   month = {10},
   day = {28},
   volume = {52},
   number = {2015},
   number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies},
   pages = {800 - 810},
   keywords = {molar mass, silicon, Avogadro project, isotopic composition, homogeneity},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP},
   language = {30},
   DOI = {10.1088/0026-1394/52/6/800},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-1},
   author = {Pramann, A. and Lee, K.-S. and Noordmann, J. and Rienitz, O.}
}

@Article { ,
   title = {Effect of Na presence during CuInSe2 growth on stacking fault annihilation and electronic properties},
   journal = {Applied Physics Letters},
   year = {2015},
   month = {10},
   day = {14},
   volume = {107},
   number = {15},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {152103},
   keywords = {Stacking faults, Cu(In,Ga)Se2, thin films, solar cells, XRD, GIXRD, GDOES, grain growth, optical pump terahertz probe spectroscopy},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {AIP Publishing LLC},
   address = {College Park},
   language = {30},
   ISSN = {0003-6951},
   DOI = {10.1063/1.4933305},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Stange, H. and Brunken, S. and Hempel, H. and Rodriguez-Alvarez, H. and Sch{\"a}fer, N. and Greiner, D. and Scheu, A. and Lauche, J. and Kaufmann, C. A. and Unold, T. and Abou-Ras, D. and Mainz, R.}
}

@Article { ,
   title = {Sudden stress relaxation in compound semiconductor thin films triggered by secondary phase segregation},
   journal = {Physical Review B},
   year = {2015},
   month = {10},
   day = {12},
   volume = {92},
   number = {15},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {155310},
   keywords = {Thin films, solar cells, Cu(In,Ga)Se2, stress relaxation, recrystallization, grain growth, in-situ, XRD, XRF},
   web_url2 = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.155310},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {American Physical Society},
   address = {College Park},
   language = {30},
   ISSN = {2469-9969},
   DOI = {10.1103/PhysRevB.92.155310},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mainz, R. and Rodriguez-Alvarez, H. and Klaus, M. and Thomas, D. and Lauche, J. and Weber, A. and Heinemann, M. D. and Brunken, S. and Greiner, D. and Kaufmann, C. A. and Unold, T. and Schock, H.-W. and Genzel, C.}
}

@Article { ,
   title = {Highly directive and Gaussian far-field emission from “giant” photonic trumpets},
   journal = {APPLIED PHYSICS LETTERS},
   year = {2015},
   month = {10},
   day = {6},
   volume = {107},
   number = {14},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {141106-4},
   keywords = {photonic antennas; photonic wire; quantum dot},
   web_url = {http://scitation.aip.org/content/aip/journal/apl},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {AIP Publishing},
   address = {Melville, NY},
   language = {30},
   ISSN = {0003-6951},
   DOI = {10.1063/1.4932574},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Stepanov, P. and Delga, A. and Gregersen, N. and Peinke, E. and Munsch, M. and Teissier, J. and M{\o}rk, J. and Richard, M. and Bleuse, J. and G{\'e}rard, J.M. and Claudon, J.}
}

@Article { ,
   title = {Ion induced fragmentation cross-sections of DNA constituents},
   journal = {The European Physical Journal D},
   year = {2015},
   month = {10},
   volume = {69},
   number = {237},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {1-9},
   keywords = {DNA, impact ionization, fragmentation, cross-sections},
   web_url = {http://link.springer.com/article/10.1140\%2Fepjd\%2Fe2015-60204-7},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer},
   address = {Berlin},
   language = {30},
   ISSN = {1434-6079 (print) ; 1434-6079 (online)},
   DOI = {10.1140/epjd/e2015-60204-7},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rudek, B. and Arndt, A. and Bennett, D. and Wang, M. and Rabus, H.}
}

@Article { ,
   title = {Secondary ionisations in a wall-less ion-counting nanodosimeter: quantitative analysis and the effect on the comparison of measured and simulated track structure parameters in nanometric volumes.},
   journal = {The European Physical Journal D},
   year = {2015},
   month = {10},
   volume = {69},
   number = {239},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {1-18},
   keywords = {Nanodosimetry, track structure, Monte Carlo},
   web_url = {http://link.springer.com/article/10.1140\%2Fepjd\%2Fe2015-60176-6},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {EDP Sciences},
   address = {Orsay},
   language = {30},
   ISSN = {1434-6060 (print) ; 1434-6079 (online)},
   DOI = {10.1140/epjd/e2015-60176-6},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hilgers, G. and Bug, M. and Gargioni, E. and Rabus, H.}
}

@Article { ReganFJPCP2015,
   title = {The half-life of 227Th by direct and indirect measurements},
   journal = {Applied Radiation and Isotopes},
   year = {2015},
   month = {10},
   volume = {104},
   number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity},
   pages = {203-211},
   keywords = {Half-Life, 227Th, Radioactivity ,Nucleardata, Radioactivity ,\(\gamma\)-rayspectrometry ,Ionisation chamber ,Nuclearmedicine, NORM, TENORM},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2015.07.001},
   stag_bib_extends_levelofaccess = {NA},
   author = {Regan, P.H. and Ferreira, K.M. and Jerome, S.M. and Pomm{\'e}, S. and Collins, S.M. and Pearce, A.K.}
}

@Proceedings { ,
   title = {Metrology to underpin future regulation of industrial emissions},
   journal = {International Congress of Metrology (CIM) 2015, Proceedings},
   year = {2015},
   month = {9},
   day = {23},
   volume = {2015},
   number = {n.a.},
   number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions},
   pages = {07008},
   keywords = {EMRP, industrial emissions},
   web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07008/metrology_metr2015_07008.html},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {EDP Sciences - Web of Conferences},
   address = {Les Ulis Cedex},
   event_place = {Paris},
   event_name = {17th International Comgress of Metrology 2015},
   event_date = {2015-09-21 to 2015-09-24},
   language = {30},
   ISBN = {n.a.},
   ISSN = {n.a.},
   DOI = {10.1051/metrology/20150007008},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rausch, Anne and Werhahn, Olav and Witzel, Oliver and Ebert, Volker and Vuelban, Edgar Moreno and Gersl, Jan and Kvernmo, Gjermund and Korsman, John and Coleman, Marc and Gardiner, Tom and Robinson, Rod}
}

@Proceedings { ,
   title = {Metrology for MRI Safety},
   year = {2015},
   month = {9},
   day = {21},
   number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI},
   web_url = {http://cfmetrologie.edpsciences.org},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {EDP Sciences},
   address = {Les Ulis},
   event_place = {Paris, France},
   event_name = {17th International Congress of Metrology},
   event_date = {September 21-24, 2015},
   language = {30},
   DOI = {10.1051/metrology/20150009001},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ittermann, B and Bottauscio, O and Hand, J and de Pooter, J and de Prez, L and Rabus, H and Seifert, F and Szymanowski, H and Weidemann, G and Zilberti, L}
}

@Article { ,
   title = {A European project to enhance process efficiency through improved temperature measurement: EMPRESS},
   journal = {17 International Congress of Metrology, 0 00 (20 5 )},
   year = {2015},
   month = {9},
   day = {21},
   volume = {17},
   number = {17},
   number2 = {14IND04: EMPRESS: Enhancing process efficiency through improved temperature measurement},
   pages = {08001},
   keywords = {efficiency, temperature measurement},
   web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08001.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {International Congress of Metrology},
   address = {London},
   language = {30},
   ISSN = {NA},
   DOI = {10.1051/metrology/20150008001},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Pearce, J V and Edler, F and Elliott, C J and Rosso, L and Sutton, G and Zante, R and Machin, G}
}

@Article { ,
   title = {METefnet: developments in metrology for moisture in materials},
   journal = {17th International Congress of Metrology},
   year = {2015},
   month = {9},
   day = {21},
   volume = {17th},
   number = {2015},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {15003},
   keywords = {Development - Moisture in materials},
   web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {EDP Sciences},
   address = {London},
   language = {30},
   ISSN = {NA},
   DOI = {10.1051/metrology/20150015003},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Bell, S and Aro, A and Arpino, F and Aytekin, S and Cortellessa, G and Dell’Isola, M and Ferenč{\'i}kov{\'a}, Z and Fernicola, V and Gavioso, R and Georgin, E and Heinonen, M and Hudoklin, D and Jalukse, L and Karab{\"o}ce, N and Leito, I and M{\"a}kynen, A and Miao, P and Nielsen, J and Nicolescu, I and Rudolfov{\'a}, M and Ojanen-Saloranta, M and {\"O}sterberg, P and {\O}stergaard, P and Rujan, M and Sega, M and Strnad, R and Vachova, T}
}

@Proceedings { ,
   title = {Experimental assessment of methods of dissemination of the thermodynamic temperature at the highest temperatures},
   journal = {International Congress of Metrology},
   year = {2015},
   month = {9},
   day = {21},
   volume = {17},
   number = {15001},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {1-5},
   web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15001/metrology_metr2015_15001.html},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {EDP Sciences},
   address = {London/Parc d'Activit{\'e} de Courtabœuf},
   event_place = {Paris},
   event_name = {17th International Congress of Metrology},
   event_date = {September 2015},
   language = {30},
   DOI = {10.1051/metrology/201515001},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Sadli, M and Anhalt, K and Bourson, F and Briaudeau, S and del Campo, D and Diril, A and Lowe, D and Machin, G and Manuel Mantilla Amor, J and Martin, M.J and McEvoy, H and Ojanen, M and Pehlivan, O and Rougie, B and Salim, S.G.R}
}

@Article { ,
   title = {Dynamic properties during wood humidification},
   journal = {17 th  International Congress of  Metrology, 14009 (2015 )},
   year = {2015},
   month = {9},
   day = {21},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   keywords = {humiditiy,  wood samples,  humidification wood},
   web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_14009.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   address = {Paris},
   language = {30},
   DOI = {10.1051/metrology/20150014009},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rudolfov{\'a}, M.R. and Pitrov{\'a} Netolick{\'a}, L.P. N. and Ferenč{\'i}kov{\'a}, Z. F. and V{\'a}chov{\'a}, T. V. and Strnad, R. S.}
}

@Article { ,
   title = {First steps in development of a new transfer standard, for moisture measurement, based on radio-frequency wave and micro-wave.},
   journal = {17th International Congress of Metrology},
   year = {2015},
   month = {9},
   day = {21},
   volume = {17th},
   number = {2015},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {15008},
   keywords = {Moisture, high frequencies, micro-waves, metrology, transfer standard.},
   web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15008/metrology_metr2015_15008.html},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {EDP Sciences},
   address = {London},
   language = {30},
   ISSN = {NA},
   DOI = {10.1051/metrology/20150015008},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Georgin, E and Rochas, JF and Achard, P and Hubert, S and Ben Ayoub, MW and Sabouroux, P}
}

@Article { ,
   title = {Characterization of surface topography of a newly developed metrological gloss scale},
   journal = {Surface Topography: Metrology and Properties},
   year = {2015},
   month = {9},
   day = {15},
   volume = {3},
   number = {4},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {045001},
   keywords = {Gloss, roughness, PSD},
   web_url = {http://iopscience.iop.org/article/10.1088/2051-672X/3/4/045001},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {2051-672X},
   DOI = {10.1088/2051-672X/3/4/045001},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-9-15},
   author = {Flys, O and K{\"a}llberg, S and Ged, G and Silvestri, Z and Ros{\'e}n, B-G}
}

@Article { ,
   title = {Optical injection locking based amplification in phase coherent transfer of optical frequencies},
   journal = {Optics Letters},
   year = {2015},
   month = {9},
   day = {3},
   volume = {40},
   number = {18},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {4198-4201},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   DOI = {10.1364/OL.40.004198},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Kim, J. and Schnatz, H. and Wu, D. S. and Marra, G. and Richardson, D.J. and Slav{\'i}k, R.}
}

@Article { ,
   title = {Methodology of Designing an Occluded Ear Simulator},
   journal = {ACTA ACUSTICA UNITED WITH ACUSTICA},
   year = {2015},
   month = {9},
   day = {1},
   volume = {101 (2015)},
   number = {5},
   number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound},
   pages = {1007 – 1015},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {S. Hirzel Verlag},
   address = {Stuttgart},
   language = {30},
   DOI = {10.3813/AAA.918895},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rodrigues, D and Lavergne, T and Sandermann Olsen, E and Fedtke, T and Barham, R and Durocher, J.-N.}
}

@Article { ,
   title = {3-D Printed Metal-Pipe Rectangular Waveguides},
   journal = {IEEE Transactions on Components, Packaging and Manufacturing Technology},
   year = {2015},
   month = {9},
   day = {1},
   volume = {5},
   number = {9},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1339 - 1349},
   keywords = {3-D printing, additive manufacturing, fused deposition modeling (FDM), metal-pipe rectangular waveguide (MPRWG), rapid manufacturing, rectangular waveguide, stereolithography apparatus (SLA).},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7217811},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   language = {30},
   ISSN = {N/A},
   DOI = {10.1109/TCPMT.2015.2462130},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {D’Auria, M. and Otter, W. J. and Hazell, J and Gillatt, B. T. W. and Long-Collins, C. and Ridler, N. M. and Lucyszyn, S.}
}

@Proceedings { ,
   title = {Moisture determination for food quality assessment},
   journal = {Proceedings of CIM 2015 - 17th International Congress of Metrology},
   year = {2015},
   month = {9},
   volume = {-},
   number = {-},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {-},
   keywords = {Moisture, Food, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis},
   web_url = {www.metrologie2015.com},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {EDP Sciences},
   address = {Paris},
   event_place = {Paris},
   event_name = {CIM 2015 - 17th International Congress of Metrology},
   event_date = {21-24 September 2015},
   language = {30},
   ISBN = {-},
   ISSN = {-},
   DOI = {10.1051/metrology/20150015006},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rolle, F. and Beltramino, G. and Fernicola, V. and Sega, M. and Verdoja, A.}
}

@Proceedings { ,
   title = {Metrological traceability for moisture content analysis in wood pellets},
   journal = {Proceedings of CIM 2015 - 17th International Congress of Metrology},
   year = {2015},
   month = {9},
   volume = {-},
   number = {-},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {-},
   keywords = {Moisture, Metrological Traceability, Wood Pellets, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis},
   web_url = {www.metrologie2015.com},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {EDP Sciences},
   address = {Paris},
   event_place = {Paris},
   event_name = {CIM 2015 - 17th International Congress of Metrology},
   event_date = {21-24 September 2015},
   language = {30},
   ISBN = {-},
   ISSN = {-},
   DOI = {10.1051/metrology/20150008002},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Sega, M. and Beltramino, G. and Fernicola, V. and Rolle, F. and Verdoja, A.}
}

@Article { ViefhausNSRHAHPYY2015,
   title = {A new compact soft x-ray spectrometer for resonant inelastic x-ray scattering studies at PETRA III},
   journal = {Review of Scientific Instruments},
   year = {2015},
   month = {9},
   volume = {86},
   number = {9},
   number2 = {SIB58: Angles: Angle metrology},
   pages = {093109},
   keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {AIP Publishing},
   language = {30},
   ISSN = {0034-6748, 1089-7623},
   DOI = {10.1063/1.4930968},
   stag_bib_extends_levelofaccess = {NA},
   author = {Viefhaus, J. and Nordgren, J. and Siewert, F. and Reininger, R. and Hage, A. and Ag{\aa}ker, M. and Hahn, U. and Peters, H. B. and Yin, Z. and Yandayan, Tanfer}
}

@Proceedings { ,
   title = {Numerical Modeling of Hysteresis Applied on Force Transducer},
   journal = {Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque (2015)},
   year = {2015},
   month = {8},
   day = {30},
   volume = {22},
   number = {1},
   number2 = {SIB63: Force: Force traceability within the meganewton range},
   pages = {4},
   keywords = {Hysteresis, Reversibility, Transducer, Maxwell-Slip, Calibration},
   web_url = {http://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC3-073.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IMEKO},
   address = {Budapest},
   language = {30},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No option selected},
   author = {Rabault, T. and Averlant, P. and Boineau, F.}
}

@Article { HolzwarthBHRMLGDG2015,
   title = {Characterization of a 450 km baseline GPS carrier-phase link using an optical fiber link},
   journal = {New Journal of Physics},
   year = {2015},
   month = {8},
   day = {26},
   volume = {17},
   number = {8},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {083044},
   keywords = {frequency transfer, global positioning system, optical fiber link, atomic clock},
   web_url = {http://iopscience.iop.org/article/10.1088/1367-2630/17/8/083044/pdf},
   web_url2 = {http://arxiv.org/abs/1505.02144},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {1367-2630},
   DOI = {10.1088/1367-2630/17/8/083044},
   stag_bib_extends_levelofaccess = {NA},
   author = {Holzwarth, R. and Bauch, A. and H{\"a}nsch, T.W. and Raupach, S.M.F. and Matveev, A. and Leute, J. and Grebing, C. and Droste, S. and Grosche, G.}
}

@Article { ,
   title = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system},
   journal = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system},
   year = {2015},
   month = {8},
   day = {19},
   volume = {2},
   number = {3},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {035015},
   keywords = {graphene, Quantum Hall, cryogen-free, measurement},
   web_url = {http://iopscience.iop.org/2053-1583/2/3/035015/video/abstract},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing Ltd},
   language = {30},
   ISSN = {2053-1583},
   DOI = {10.1088/2053-1583/2/3/035015},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Janssen, T.J.B.M. and Rozhko, S. and Antonov, I. and Tzalenchuk, A. and Williams, J. M. and Melhem, Z. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R.}
}

@Article { ,
   title = {Determination of the Boltzmann constant k from the speed of sound in helium gas at the triple point of water},
   journal = {Metrologia},
   year = {2015},
   month = {8},
   day = {19},
   volume = {52},
   number = {5},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {S263–S273},
   keywords = {Acoustic resonance, Boltzmann constant, Definition of the kelvin, Microwave resonance, Quasi-sphere, Speed of sound, Triaxial ellipsoid},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S263/meta},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Science},
   address = {Bristol},
   language = {30},
   ISSN = {NA},
   DOI = {10.1088/0026-1394/52/5/S263},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Pitre, L and Risegari, L and Sparasci, F and Plimmer, M D and Himbert, M E and Giuliano Albo, P A}
}

@Article { ,
   title = {Improved electronic measurement of the Boltzmann constant by Johnson noise Thermometry},
   journal = {Metrologia},
   year = {2015},
   month = {8},
   day = {19},
   volume = {52},
   number = {5},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {S242-S256},
   keywords = {Boltzmann constant, Johnson noise, quantum voltage, noise thermometry},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S242/meta},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Science},
   address = {Bristol},
   language = {30},
   ISSN = {NA},
   DOI = {10.1088/0026-1394/52/5/S242},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Qu, J and Benz, S P and Pollarolo, A and Roglla, H and Tew, W L and White, R and Zhou, K}
}

@Article { ,
   title = {Preparation and characterization of primary magnesium mixtures for the ab initio calibration of absolute magnesium isotope ratio measurements},
   journal = {Journal of Analytical Atomic Spectrometry},
   year = {2015},
   month = {8},
   day = {17},
   volume = {31},
   number = {1},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   pages = {179–196},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society of Chemistry},
   address = {London},
   language = {30},
   DOI = {10.1039/C5JA00284B},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Brandt, Bj¨orn and Vogl, Jochen and Noordmann, Janine and Kaltenbach, Angela and Rienitz, Olaf}
}

@Proceedings { ,
   title = {LED-based field radiometer for sensor web in-situ measurements},
   journal = {IEEE International Workshop on Metrology for Aerospace, MetroAeroSpace 2015 - Proceedings 08/2015},
   year = {2015},
   month = {8},
   volume = {2},
   number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate},
   keywords = {radiometer, LED, vicarious calibration, sensor web, in-situ},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7180675},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {IEEE},
   event_place = {Benevento, Italy},
   event_name = {2nd IEEE International Workshop on Metrology for Aerospace, MetroAeroSpace 2015},
   event_date = {04-06-2015 to 05-06-2015},
   language = {30},
   DOI = {10.1109/MetroAeroSpace.2015.7180675},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Taralli, ET and Filippo, RF and Brida, GB and Rajteri, MR and Hall, SRGH and Bialek, AB and Greenwell, CG and Fox, NF}
}

@Article { ,
   title = {Measuring Compositions in Organic Depth Profiling: Results from a VAMAS Interlaboratory Study},
   journal = {Journal of Physical Chemistry (B)},
   year = {2015},
   month = {7},
   day = {23},
   volume = {119},
   number = {33},
   number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices},
   pages = {10784–10797},
   web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b05625},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {ACS},
   address = {Washington DC},
   language = {30},
   DOI = {10.1021/acs.jpcb.5b05625},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-6},
   author = {Shard, A. and Havelund, R. and Spencer, S. and Gilmore, I. and Alexander, M.R. and Angerer, T.B. and Aoyagi, S. and Barnes, J.P. and Benayad, A. and Bernasik, A. and Ceccone, G. and Counsell, J.D.P and Deeks, C. and Fletcher, J.S. and Graham, D.J. and Heuser, C. and Lee, T.G. and Marie, C. and Marzec, M.M. and Mishra, G. and Rading, D. and Renault, O. and Scurr, D.J and Shon, H.K. and Spampinato, V. and Tian, H. and Wang, F. and Winograd, N. and Wu, K. and Wucher, A.}
}

@Article { LalereGPRFESE2015,
   title = {Interaction of 15 priority substances for water monitoring at ng L−1 levels with glass, aluminium and fluorinated polyethylene bottles for the containment of water reference materials},
   journal = {Accreditation and Quality Assurance},
   year = {2015},
   month = {7},
   day = {11},
   volume = {20},
   number = {6},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {447-455},
   keywords = {Water Framework Directive, Reference materials, Hydrophobic organic pollutants, Bottles, Adsorption, Glass, Aluminium, Fluorinated polyethylene},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0949-1775, 1432-0517},
   DOI = {10.1007/s00769-015-1150-3},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lal{\`e}re, B. and Gantois, F. and Philipp, R. and Richter, J. and Fettig, I. and Elordui-Zapatarietxe, S. and Swart, C. and Emteborg, H.}
}

@Article { ,
   title = {Primary standards for measuring flow rates from 100 nl/min to 1 ml/min – gravimetric principle},
   journal = {Biomed. Eng.-Biomed.},
   year = {2015},
   month = {7},
   day = {10},
   volume = {60},
   number = {4},
   number2 = {HLT07: MeDD: Metrology for drug delivery},
   pages = {301-316},
   keywords = {dynamic gravimetric calibration; intercomparison; liquid; metrology for drug delivery; microflow; primary standard; validation.},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   language = {30},
   DOI = {10.1515/bmt-2014-0145},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Bissig, H. and Petter, H.T. and Lucas, P. and Batista, E. and Fillipe, E. and Almeida, N. and Ribeiro, L.F. and Gala, J. and Martins, R. and Savanier, B. and Ogheard, F. and Niemann, A.K. and L{\"o}tters, J. and Sparreboom, W.}
}

@Article { ,
   title = {Tip-enhanced Raman spectroscopy: principles and applications},
   journal = {EPJ Techniques and Instrumentation},
   year = {2015},
   month = {7},
   day = {1},
   volume = {2:9},
   number = {2015},
   number2 = {NEW02: Raman: Metrology for Raman Spectroscopy},
   pages = {2:9},
   keywords = {Tip-enhanced Raman spectroscopy; Nanotechnology; Nanophotonics},
   web_url = {http://epjtechniquesandinstrumentation.springeropen.com/articles/10.1140/epjti/s40485-015-0019-5},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Springer Open},
   address = {Heidelberg},
   language = {30},
   ISSN = {N/A},
   DOI = {10.1140/epjti/s40485-015-0019-5},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-7-1},
   author = {Kumar, N. and Mignuzzi, S. and Su, W. and Roy, D.}
}

@Article { ,
   title = {Filter design masks for C37.118.1a-compliant frequency-tracking and fixed-filter M-class Phasor Measurement Units (PMUs)},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2015},
   month = {6},
   day = {25},
   volume = {64},
   number = {8},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {2096 - 2107},
   keywords = {Power system measurements, Fourier transforms, Frequency measurement, Power system faults, Phase estimation, Power system state estimation, Power system parameter estimation},
   web_url = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=7134789\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fiel7\%2F19\%2F4407674\%2F07134789.pdf\%3Farnumber\%3D7134789},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {n/a},
   language = {30},
   ISSN = {0018-9456},
   DOI = {10.1109/TIM.2015.2445111},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Roscoe, A. J. and Dickersen, B. and Martin, K. E.}
}

@Proceedings { ,
   title = {Length characterization of a piezoelectric actuator travel with a mode-locked femtosecond laser},
   journal = {Proceedings SPIE 9525, Optical Measurement Systems for Industrial Inspection IX},
   year = {2015},
   month = {6},
   day = {22},
   volume = {9525},
   number = {95254K},
   number2 = {SIB60: Surveying: Metrology for long distance surveying},
   keywords = {piezoelectric actuator, passive cavity, mode-locked laser},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {SPIE},
   event_place = {Munich, Germany},
   event_name = {SPIE Optical Measurement Systems for Instrustrial Inspection IX, World of Photonics},
   event_date = {22-06-2015 to 25-06-2015},
   language = {30},
   ISBN = {9781628416855},
   DOI = {10.1117/12.2190745},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Pradova, L. and Lesundak, A. and Hucl, V. and Cizek, M. and Mikel, B. and Hrabina, J. and Rerucha, S. and Cip, O. and Lazar, J.}
}

@Proceedings { ,
   title = {Analysis of the propagation of Power Quality phenomena using wide-area measurements},
   journal = {Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution},
   year = {2015},
   month = {6},
   day = {15},
   volume = {n/a},
   number = {n/a},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-4},
   keywords = {power quality, power networks},
   tags = {SEG},
   web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_0663_final.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {n/a},
   address = {n/a},
   event_place = {Lyon, France},
   event_name = {23rd International Conference and Exhibition on Electricity Distribution},
   event_date = {14-06-2015 to 15-06-2015},
   language = {30},
   ISBN = {n/a},
   ISSN = {n/a},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://cired.net/publications/cired2015/papers/CIRED2015_0663_final.pdf},
   author = {Cuk, V and van den Brom, H and Cobben, S and Rietveld, G}
}

@Proceedings { ,
   title = {Application of PMUs for monitoring a 50 kV distribution grid},
   journal = {Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 2015},
   year = {2015},
   month = {6},
   day = {15},
   volume = {n/a},
   number = {n/a},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1-5},
   keywords = {phasor measurement units, smart grids, renewable energy sources},
   web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {n/a},
   address = {n/a},
   event_place = {Lyon, France},
   event_name = {23rd International Conference and Exhibition on Electricity Distribution (CIRED)},
   event_date = {14-06-15 to 15-06-15},
   language = {30},
   ISBN = {n/a},
   ISSN = {n/a},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf},
   author = {Rietveld, G and Jongepier, A and van Seters, J and Visser, M and Liu, P and Acanski, M and Hoogenboom, D and van den Brom, H. E.}
}

@Article { ,
   title = {Testing equivalency of an alternative method based on portable FTIR to the European Standard Reference Methods for monitoring emissions to air of CO, NOx, SO2, HCl, and H2O},
   journal = {Journal of the Air \& Waste Management Association},
   year = {2015},
   month = {6},
   day = {11},
   volume = {Vol. 65},
   number = {Iss. 8,2015},
   number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions},
   pages = {1011-1019},
   keywords = {CEN/TS 14793, FTIR, TGN M22, EN 15058, 2010/75/EU, Industrial, Emissions, pollution, SRMs, UNECE, CLRTAP, E-PRTR, CEMs, AMSs, BIPM, Fourier-transform infrared, measurement.},
   web_url = {http://www.tandfonline.com/doi/full/10.1080/10962247.2015.1058868},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Taylor \& Francis},
   address = {London},
   language = {30},
   ISSN = {1096-2247},
   DOI = {10.1080/10962247.2015.1058868},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-6-11},
   author = {Coleman, M.D. and Render, S. and Dimopoulos, C. and Lilley, A. and Robinson, R.A. and Smith, T.O.M. and Camm, R. and Standring, R.}
}

@Article { ,
   title = {How physical infusion system parameters cause clinically relevant dose deviations after setpoint changes},
   journal = {Biomed. Eng.-Biomed. Tech.},
   year = {2015},
   month = {6},
   day = {10},
   volume = {60},
   number = {4},
   number2 = {HLT07: MeDD: Metrology for drug delivery},
   pages = {365-376},
   keywords = {drug delivery; metrology; multi-infusion; standards; syringe compliance},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   language = {30},
   DOI = {10.1515/bmt-2014-0139},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Timmerman, A.M.D.E. and Snijder, R.A. and Lucas, P. and Lagerwij, M.C. and Radermacher, J.H. and Konings, M.K.}
}

@Proceedings { ,
   title = {Impact of the ecodesign directive on traceability in power transformer loss measurements},
   journal = {Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution (CIRED), Lyon, France},
   year = {2015},
   month = {6},
   volume = {2015},
   number = {-},
   number2 = {14IND08: ElPow: Metrology for the electrical power industry},
   pages = {1-5},
   keywords = {Loss measurement, Load loss, efficiency, losses, Ecodesign Directive, power transformers, reactors, ELPOW, high voltage, current transformers},
   web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_1538_final.pdf},
   misc2 = {EMPIR 2014: Industry},
   publisher = {International Conference and Exhibition on Electricity Distribution},
   address = {-},
   event_place = {Lyon, France},
   event_name = {International Conference and Exhibition on Electricity Distribution},
   event_date = {June 2015},
   language = {30},
   ISBN = {-},
   ISSN = {-},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rietveld, G and Houtzager, E and Zhao, D}
}

@Article { ,
   title = {Topographical orientation effects on friction and wear in sliding DLC and steel contacts, Part 1: Experimental},
   journal = {Wear},
   year = {2015},
   month = {6},
   volume = {330–331},
   number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces},
   pages = {3–22},
   keywords = {Friction, Wear, Topography, Orientation, Modelling},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0043164815001234},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Elsevier},
   language = {30},
   ISSN = {0043-1648},
   DOI = {10.1016/j.wear.2015.02.014},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Holmberg, KH and Laukkanen, AL and Roikainen, HR and Waudby, RW and Stachowiak, GS and Wolski, MW and Podsiadlo, PP and Gee, MG and Nunn, JN and Gachot, CG and Li, LL}
}

@Article { WrightFCR2015,
   title = {Testing and Validation of an Algorithm for Optimising Distribution Grid Sensor Networks},
   journal = {Proceedings of CIRED 2015},
   year = {2015},
   month = {6},
   volume = {1},
   number = {1},
   number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids},
   pages = {0779},
   keywords = {smart grids, distribution grid sensor networks, sensor placement algorithm, power flow, Electrical engineering. Electronics Nuclear engineering, Electrical and Electronic Engineering},
   web_url = {https://strathprints.strath.ac.uk/53767/1/Clarkson_etal_CIRED2015_algorithm_for_configuring_distribution_grid_sensor_networks.pdf},
   misc2 = {EMRP A169: Call 2009 Energy},
   publisher = {CIRED},
   address = {Lyon, France},
   language = {30},
   ISBN = {978-1-78561-483-5},
   ISSN = {2032-9644},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wright, P.S and Forbes, A and Clarkson, P and Roscoe , A}
}

@Article { ,
   title = {Design and application of a versatile gas calibration for non-metal determination by carrier gas hot extraction},
   journal = {Analytical Methods},
   year = {2015},
   month = {5},
   day = {19},
   volume = {7},
   number = {13},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   pages = {5468-5475},
   web_url = {http://pubs.rsc.org/En/content/articlelanding/2015/ay/c5ay00845j\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Royal Society of Chemistry},
   address = {London},
   language = {30},
   DOI = {10.1039/c5ay00845j},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Kramer, Claus and Ried, Peter and Mahn, Stefan and Richter, Silke and Langhammer, Nicole and Kipphardt, Heinrich}
}

@Article { ,
   title = {Novel automated methods for coarse and fine registrations of point clouds in high precision metrology},
   journal = {The International Journal of Advanced Manufacturing Technology},
   year = {2015},
   month = {5},
   day = {14},
   volume = {81},
   number = {5},
   number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products},
   pages = {795-810},
   keywords = {Coarse registration, Fine registration, Discrete curvatures, Hough transform, Moving least squares surface,
Computational tomography, Measurement errors, Dimensional metrology},
   web_url = {http://link.springer.com/article/10.1007/s00170-015-7131-1},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Springer},
   address = {London},
   language = {30},
   ISSN = {0268-3768},
   DOI = {10.1007/s00170-015-7131-1},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rantoson, R. and Nouira, H. and Anwer, N. and Mehdi-Souzani, C.}
}

@Article { ,
   title = {Frequency and time transfer for metrology and beyond using telecommunication network fibres},
   journal = {Comptes Rendus Physique},
   year = {2015},
   month = {5},
   day = {8},
   volume = {16},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {531–539},
   keywords = {Time and frequency metrology
Optical links
Frequency stabilized lasers
Fibre optics},
   web_url = {www.sciencedirect.com},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   DOI = {10.1016/j.crhy.2015.04.005},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lopez, O. and K{\'e}f{\'e}lian, F. and Jiang, H. and Haboucha, A. and Bercy, A. and Stefani, F. and Chanteau, B. and Kanj, A. and Rovera, D. and Achkar, J. and Chardonnet, C and Pottie, P.-O. and Amy-Klein, A. and Santarelli, G.}
}

@Proceedings { ,
   title = {Low-Cost Instrument for the Accurate Measurement of Whispering-Gallery Resonances up to 19 GHz},
   year = {2015},
   month = {5},
   number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination},
   pages = {887-892},
   keywords = {frequency standards;measurement standards;network analysers;portable instruments;temperature measurement;whispering gallery modes;GPS-based solution;SWGT;VNA;complex resonance frequency detection;low-cost measurement system;rubidium frequency standard;sapphire whispering gallery thermometry;transfer temperature standard;vector network analyzer;Accuracy;Frequency measurement;Global Positioning System;Instruments;Resonant frequency;Standards;Temperature measurement;microwave measurements;microwave resonances;whispering gallery thermometry},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {The Institute of Electrical and Electronics Engineers, Incorporated (the ''IEEE'')},
   address = {Piscataway},
   event_place = {Pisa, Italy},
   event_name = {2015 IEEE International Instrumentation and Measurement Technology Conference (I2MTC 2015)},
   event_date = {11-14 May 2015},
   language = {30},
   DOI = {10.1109/I2MTC.2015.7151386},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Corbellini, S. and Ramella, C. and Pirola, M. and Fernicola, V.}
}

@Article { MustoeRBBGBM2015,
   title = {Ten years of mercury measurement at urban and industrial air quality monitoring stations in the UK},
   journal = {Atmospheric Environment},
   year = {2015},
   month = {5},
   volume = {109},
   number = {-},
   number2 = {ENV51: MeTra: Traceability for mercury measurements},
   pages = {1-8},
   keywords = {Ten years of mercury measurement at urban and industrial air quality monitoring stations in the UK},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {1352-2310},
   DOI = {10.1016/j.atmosenv.2015.03.003},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mustoe, C.L. and Robins, C. and Brown, A.S. and Butterfield, D.M. and Goddard, S.L. and Brown, R.J.C. and McGhee, E.A.}
}

@Article { JakubowskiPFR2015,
   title = {Tributyltin—critical pollutant in whole water samples—development of traceable measurement methods for monitoring under the European Water Framework Directive (WFD) 2000/60/EC},
   journal = {Environmental Science and Pollution Research},
   year = {2015},
   month = {5},
   volume = {22},
   number = {13},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {9589-9594},
   keywords = {Tributyltin, European Water Framework Directive, Whole water body, Reference method},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0944-1344, 1614-7499},
   DOI = {10.1007/s11356-015-4614-4},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jakubowski, N. and Philipp, R. and Fettig, I. and Richter, J.}
}

@Article { ,
   title = {Mapping the Optical Absorption of a Substrate-Transferred Crystalline AlGaAs Coating at 1.5um},
   journal = {Classical and Quantum Gravity},
   year = {2015},
   month = {4},
   day = {27},
   volume = {32},
   number = {10},
   number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors},
   pages = {105008},
   keywords = {gravitational wave detectors, absorption, crystalline coating},
   web_url = {http://iopscience.iop.org/article/10.1088/0264-9381/32/10/105008/meta},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {IOP Publishing},
   address = {Bristol, UK},
   language = {30},
   ISSN = {0264-9381},
   DOI = {10.1088/0264-9381/32/10/105008},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Steinlechner, J and Martin, I W and Bell, A and Cole, G and Hough, J and Penn, S and Rowan, S and Steinlechner, S}
}

@Article { ,
   title = {Multiphoton luminescence imaging of chemically functionalized multi-walled carbon nanotubes in cells and solid tumors†},
   journal = {ChemComm},
   year = {2015},
   month = {4},
   day = {24},
   volume = {51},
   number = {45},
   number2 = {NEW02: Raman: Metrology for Raman Spectroscopy},
   pages = {9366-9369},
   keywords = {N/A},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/CC/c5cc02675j\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Royal Society of Chemistry},
   address = {Picadilly UK},
   language = {30},
   ISSN = {N/A},
   DOI = {10.1039/c5cc02675j},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-1},
   author = {Rubio, N. and Hirvonen, L.M. and Chong, E.Z. and Wang, J.T.W. and Bourgognon, M. and Kafa, H. and Hassan, H.A.F.M. and Al-Jamal, W.T. and McCarthy, D. and Hogstrand, C. and Festy, F. and Al-Jamal, K.T.}
}

@Article { ,
   title = {EXPERIMENTAL INVESTIGATION OF IONISATION TRACK STRUCTURE OF CARBON IONS AT HIL WARSAW},
   journal = {Radiation Protection Dosimetry},
   year = {2015},
   month = {4},
   day = {20},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   web_url = {http://rpd.oxfordjournals.org/content/early/2015/04/20/rpd.ncv191.abstract},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   DOI = {10.1093/rpd/ncv191},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Bantsar, A and Hilgers, G. and Pszona, S. and Rabus, H. and Szeflinski, Z.}
}

@Article { ,
   title = {Measurement Infrastructure to Support the Reliable Operation of Smart Electrical Grids},
   journal = {IEEE transactions on instrumentation and measurement},
   year = {2015},
   month = {4},
   day = {20},
   volume = {64},
   number = {6},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {1355 - 1363},
   keywords = {smart grid, metrology, synchrophasor, phasor measurement unit, revenue metering, power quality, grid modelling, electrical grids},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7089250},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   address = {n/a},
   language = {30},
   ISSN = {0018-9456},
   DOI = {10.1109/TIM.2015.2406056},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rietveld, Gert and Braun, Jean-Pierre and Martin, Ricardo and Wright, Paul and Heins, Weibke and Ell, Nikola and Clarkson, Paul and Zisky, Norbert}
}

@Article { ,
   title = {Quantum Hall resistance standard in graphene devices under relaxed experimental conditions},
   journal = {Nature Nanotechnology},
   year = {2015},
   month = {4},
   day = {20},
   volume = {10},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {965-971},
   keywords = {graphene, QHR, measurement},
   web_url = {https://www.ptb.de/emrp/resources/documents/graphohm/Sonstige_Fotos/NatureComms7806-2015-Lafont.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Macmillan Publishers},
   language = {30},
   DOI = {10.1038/ncomms7806},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Lafont, F. and Ribeiro-Palau, R. and Kazazis, D. and Michon, A. and Couturaud, O. and Consejo, C. and Chassagne, T. and Zielinski, M. and Portrail, M. and Jouault, B. and Schopfer, F. and Poirier, W.}
}

@Article { ,
   title = {‘BIOQUART’ PROJECT: DESIGN OF A NOVEL IN SITU PROTOCOL FOR THE SIMULTANEOUS VISUALISATION OF CHROMOSOMAL ABERRATIONS AND MICRONUCLEI AFTER IRRADIATION AT MICROBEAM FACILITIES},
   journal = {Radiation Protection Dosimetry},
   year = {2015},
   month = {4},
   day = {15},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   web_url = {http://rpd.oxfordjournals.org/content/early/2015/04/15/rpd.ncv160.abstract},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   DOI = {10.1093/rpd/ncv160},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Patrono, C. and Monteiro Gil, O. and Giesen, U. and Langner, F. and Pinto, M. and Rabus, H. and Testa, A.}
}

@Proceedings { ,
   title = {Goniometric and colorimetric properties of paints and varnish},
   journal = {SPIE Proceedings  Measuring, Modeling, and Reproducing Material Appearance 2015},
   year = {2015},
   month = {4},
   day = {14},
   volume = {9398},
   number = {2015},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {9398-23},
   keywords = {goniometry, lighting engineering, protective varnish, colour, works of arts, gloss, luminance coefficient spatial distribution},
   web_url = {http://spie.org/Publications/Proceedings/Volume/9398?\&origin_id=x4318\&event_id=2051795},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {SPIE IS\&T},
   address = {Bellingham},
   event_place = {San Francisco, California, United States | February 08, 2015},
   event_name = {Measuring, Modeling, and Reproducing Material Appearance 2015},
   event_date = {8-13 february 2015},
   language = {30},
   ISBN = {9781628414882},
   ISSN = {0277-786x},
   DOI = {10.1117/12.2077710},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Iacomussi, P. and Radis, M and Rossi, G.}
}

@Article { AlexanderRVW2015,
   title = {Exploring the potential of nanometric track structure based quantities for particle beam treatment planning},
   journal = {Radiotherapy and Oncology},
   year = {2015},
   month = {4},
   volume = {115},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {S796},
   keywords = {BioQuaRT, track structure, ion beam therapy, nanodosimetry, treatment planning},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Elsevier BV},
   address = {Suite 800, 230 Park Avenue, New York, NY 10169 United States},
   language = {30},
   ISSN = {0167-8140},
   DOI = {10.1016/S0167-8140(15)41460-4},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Alexander, F. and Rabus, H. and Villagrasa, C. and Wilkens, J.J.}
}

@Article { BaekRB2015,
   title = {Calculation of electron track structure in water and DNA medium},
   journal = {Radiotherapy and Oncology},
   year = {2015},
   month = {4},
   volume = {115},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {S76},
   keywords = {BioQuaRT, track structure, particle track simulation, nanodosimetry, low energy electrons, PTra, cross sections, DNA molecules},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Elsevier BV},
   address = {Suite 800, 230 Park Avenue, New York, NY 10169, United States},
   language = {30},
   ISSN = {0167-8140},
   DOI = {10.1016/S0167-8140(15)40154-9},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Baek, W.Y. and Rabus, H. and Bug, M.U.}
}

@Article { SchneiderRB2015,
   title = {A database application to investigate the validity of the nanodosimetric approach},
   journal = {Radiotherapy and Oncology},
   year = {2015},
   month = {4},
   volume = {115},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {S734-S735},
   keywords = {BioQuaRT, track structure, ion beam therapy, nanodosimetry, biological effectiveness},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Elsevier BV},
   address = {Suite 800, 230 Park Avenue, New York, NY 10169, United States},
   language = {30},
   ISSN = {0167-8140},
   DOI = {10.1016/S0167-8140(15)41355-6},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schneider, T. and Rabus, H. and Bug, M.U.}
}

@Article { Rabus2015,
   title = {Requirements for multiscale models of radiation action - activities in European projects Nano-IBCT and BioQuaRT},
   journal = {Radiotherapy and Oncology},
   year = {2015},
   month = {4},
   volume = {115},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {S107},
   keywords = {Requirements for multiscale models of radiation action - activities in European projects Nano-IBCT and BioQuaRT},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Elsevier BV},
   address = {New York},
   language = {30},
   ISSN = {0167-8140},
   DOI = {10.1016/S0167-8140(15)40210-5},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rabus, H.}
}

@Article { ,
   title = {Flow Cytometry - Reference Procedure for the Measurement of Stem Cell Concentrations in Apheresis Products},
   journal = {PTB mitteilungen - Traceable Dynamic Measurement of Mechanical Quantities},
   year = {2015},
   month = {4},
   volume = {2},
   number = {02 2015},
   number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules},
   pages = {70-73},
   keywords = {quantitative measurement, stem cells, reference procedure, flow cytometry},
   web_url = {www.ptb.de/cms/resources/internet/publikationen/ptb_mitteilungen/mitt2015/Heft2/PTB-Mitteilungen_2015_Heft_2.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Physikalisch-Technische Bundesanstalt (ed.)},
   address = {Brunswick \& Berlin},
   language = {30},
   ISSN = {-},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://www.ptb.de/cms/resources/internet/publikationen/ptb_mitteilungen/mitt2015/Heft2/PTB-Mitteilungen_2015_Heft_2.pdf},
   author = {Neukammer, J. and Kammel, M. and H{\"o}ckner, J. and Kummrow, A. and Ruf, A.}
}

@Article { MairaniMCVVPMRM2015,
   title = {Dosimetric characterization of a microDiamond detector in clinical scanned carbon ion beams},
   journal = {Medical Physics},
   year = {2015},
   month = {3},
   day = {31},
   volume = {42},
   number = {4},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {2085-2093},
   keywords = {synthetic diamond detector, carbon ions, relative dosimetry},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {0094-2405},
   DOI = {10.1118/1.4915544},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mairani, A. and Mirandola, A. and Ciocca, M. and Verona-Rinati, G. and Verona, C. and Prestopino, G. and Marinelli, M. and Raffaele, L. and Magro, G.}
}

@Article { AzumaBBBBBCDFFHKKKMMMMNNPRRSSVWWZ,
   title = {Improved measurement results for the Avogadro constant using a 28Si-enriched crystal},
   journal = {Metrologia},
   year = {2015},
   month = {3},
   day = {25},
   volume = {52},
   number = {2},
   number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies},
   keywords = {fundamental constants, Avogadro constant, kilogram},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {0957-0233},
   DOI = {10.1088/0026-1394/52/2/360},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Azuma, Y and Barat, P and Bartl, G and Bettin, H and Borys, M and Busch, I and Cibik, L and D’Agostino, G and Fujii, K and Fujimoto, H and Hioki, A and Krumrey, M and Kuetgens, U and Kuramoto, N and Mana, G and Massa, E and Mee{\ss}, R and Mizushima, S and Narukawa, T and Nicolaus, A and Pramann, A and Rabb, S A and Rienitz, O and Sasso, C and Stock, M and Vocke Jr, R D and Waseda, A and Wundrack, S and Zakel, S}
}

@Article { ReimannSHHRRV2015,
   title = {Modern inhalation anesthetics: Potent greenhouse gases in the global atmosphere},
   journal = {Geophysical Research Letters},
   year = {2015},
   month = {3},
   day = {13},
   volume = {42},
   number = {5},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {1606-1611},
   keywords = {inhalation, anaesthetics},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {0094-8276},
   DOI = {10.1002/2014GL062785},
   stag_bib_extends_levelofaccess = {NA},
   author = {Reimann, S. and Schoenenberger, F. and Hofstetter, D. and Hill, M. and Rhee, T.S. and Rigby, M. and Vollmer, M.K.}
}

@Article { BrunnerHRV2015,
   title = {First Observations of the Fourth Generation Synthetic Halocarbons HFC-1234yf, HFC-1234ze(E), and HCFC-1233zd(E) in the Atmosphere},
   journal = {Environmental Science \& Technology},
   year = {2015},
   month = {3},
   volume = {49},
   number = {5},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {2703-2708},
   keywords = {synthetic halocarbons},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {American Chemical Society (ACS)},
   language = {30},
   ISSN = {0013-936X, 1520-5851},
   DOI = {10.1021/es505123x},
   stag_bib_extends_levelofaccess = {NA},
   author = {Brunner, D. and Hill, M. and Reimann, S. and Vollmer, M.K.}
}

@Article { PhilippFRAFFYD2015,
   title = {Experimental design for TBT quantification by isotope dilution SPE–GC–ICP–MS under the European water framework directive},
   journal = {Talanta},
   year = {2015},
   month = {3},
   volume = {134},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {576-586},
   keywords = {experimental design, isotope dilution, organotin compounds, solid-phase extraction, tributyltin, water framework directive},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0039-9140},
   DOI = {10.1016/j.talanta.2014.11.064},
   stag_bib_extends_levelofaccess = {NA},
   author = {Philipp, R. and Fisicaro, P. and Richter, J. and Alasonati, E. and Fabbri, B. and Fettig, I. and Yardin, C. and Del Castillo Busto, M.E.}
}

@Article { ,
   title = {HfTi-nanoSQUID gradiometers with high linearity},
   journal = {Applied Physics Letters},
   year = {2015},
   month = {2},
   day = {17},
   volume = {106},
   number = {n/a},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {072601},
   keywords = {nanoSQUID gradiometers, metrology},
   web_url = {http://scitation.aip.org/content/aip/journal/apl/106/7/10.1063/1.4909523},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {AIP Publishing},
   address = {Melville, New York},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1063/1.4909523},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2015-8-17},
   author = {Bechstein, S and Ruede, F and Drung, D and Storm, J. -H. and Kieler, O. F. and Kohlmann, J. and Weimann, T. and Schurig, T.}
}

@Article { KuepferlingZSVDPRRB2015,
   title = {Vortex dynamics in Co-Fe-B magnetic tunnel junctions in presence of defects},
   journal = {Journal of Applied Physics},
   year = {2015},
   month = {2},
   day = {13},
   volume = {117},
   number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems},
   web_url = {http://scitation.aip.org/content/aip/journal/jap/117/17/10.1063/1.4908142},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   language = {English},
   ISSN = {0021-8979},
   DOI = {10.1063/1.4908142},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kuepferling, M. and Zullino, S. and Sola, A. and Van de Wiele, B. and Durin, G. and Pasquale, M. and Rott, K. and Reiss, G. and Bertotti, G.}
}

@Article { RoyROHCJIWG2015,
   title = {Optical Spin-Transfer-Torque-Driven Domain-Wall Motion in a Ferromagnetic Semiconductor},
   journal = {Physical Review Letters},
   year = {2015},
   month = {2},
   day = {11},
   volume = {114},
   number = {6},
   number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems},
   keywords = {Optical Spin-Transfer-Torque-Driven Domain-Wall Motion in a Ferromagnetic Semiconductor},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {American Physical Society (APS)},
   address = {1 Research Rd, Ridge, NY 11961, USA},
   language = {30},
   ISSN = {0031-9007, 1079-7114},
   DOI = {10.1103/PhysRevLett.114.067202},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roy, P. E. and Ramsay, A. J. and Otxoa, R. M. and Haigh, J. A. and Campion, R. P. and Janda, T. and Irvine, A. C. and Wunderlich, J. and Gallagher, B. L.}
}

@Article { ZikmundRKHA,
   title = {Precise scalar calibration of a tri-axial Braunbek coil system},
   journal = {IEEE Transactions on Magnetics},
   year = {2015},
   month = {2},
   day = {2},
   volume = {51},
   number = {1},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {30},
   ISSN = {0018-9464},
   DOI = {10.1109/TMAG.2014.2357783},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zikmund, A. and Ripka, P. and Ketzler, R. and Harcken, H. and Albrecht, M.}
}

@Techreport { ,
   title = {Progress Report of the Department ‘Fundamentals of Dosimetry’},
   journal = {CCRI(I) working documents},
   year = {2015},
   month = {2},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Arndt, A. and Baek, W. Y. and Bennett, D. and Bug, M. U. and Buhr, T. and Hilgers, G. and Nettelbeck, H. and Pfl{\"u}ger, T. and Rabus, H. and Rahm, J. and Ren, X. and Rudek, B. and Sellner, S. and Szymanowski, H. and Wang, M. and Weyland, M.}
}

@Article { ,
   title = {Structural, optical and electrostatic properties of single and fewlayers MoS2: effect of substrate},
   journal = {Structural, optical and electrostatic properties of single and fewlayers MoS2: effect of substrate},
   year = {2015},
   month = {2},
   volume = {2},
   number = {1},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {015005},
   keywords = {two dimensional materials, MoS2, nanomechanics, substrate interaction, Kelvin probe, ultrasonic force microscopy, Raman},
   web_url = {http://iopscience.iop.org/article/10.1088/2053-1583/2/1/015005},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {2053-1583},
   DOI = {10.1088/2053-1583/2/1/015005},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Robinson, B. J. and Giusca, C. E. and Gonzalez, Y. T. and Kay, N. D. and Kazakova, O. and Kolosov, O. V.}
}

@Article { ZhaoMRHHO2015_2,
   title = {Principal Component Compression Method for Covariance Matrices Used for Uncertainty Propagation},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2015},
   month = {2},
   volume = {64},
   number = {2},
   number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications},
   pages = {356-365},
   keywords = {Covariance matrix, Fourier transforms, frequency-domain measurements, measurement uncertainty, principal component analysis (PCA), timebase drift correction, time-domain measurements, timing jitter, uncertainty propagation},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   language = {30},
   ISSN = {0018-9456, 1557-9662},
   DOI = {10.1109/TIM.2014.2340640},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhao, D. and Mubarak, F.A. and Rodriguez-Higuero, M. and Harris, P.M. and Humphreys, D.A. and Ojasalo, K.}
}

@Article { ,
   title = {En route to traceable reference standards for surface group quantifications by XPS, NMR and fluorescence spectroscopy.},
   journal = {Analyst},
   year = {2015},
   month = {1},
   day = {28},
   volume = {140},
   number = {6},
   number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/AN/C4AN02248C\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   language = {30},
   ISSN = {0003-2654},
   DOI = {10.1039/c4an02248c},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Hennig, A. and Dietrich, P. M. and Hemmann, F. and Thiele, T. and Borcherding, H. and Hoffmann, A. and Schedler, U. and J{\"a}ger, C. and Resch-Genger, U. and Unger, W. E. S.}
}

@Article { ,
   title = {Quantification of Variable Functional-Group Densities of Mixed-Silane Monolayers on Surfaces via a Dual-Mode Fluorescence and XPS Label},
   journal = {Analytical Chemistry},
   year = {2015},
   month = {1},
   day = {26},
   volume = {87},
   number = {5},
   number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices},
   web_url = {http://pubs.acs.org/doi/abs/10.1021/ac503850f},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   language = {30},
   ISSN = {0003-2700},
   DOI = {10.1021/ac503850f},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Fischer, T. and Dietrich, P. M. and Streeck, C. and Ray, S. and Nutsch, A. and Shard, A. and Beckhoff, B. and Unger, W. E. S. and Rurack, K.}
}

@Article { ,
   title = {Traceability of mass II: a study of procedures and materials},
   journal = {Metrologia},
   year = {2015},
   month = {1},
   day = {7},
   volume = {52},
   number = {1},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {89-103},
   keywords = {Mass, XPS, traceability, recontamination, hydrogen plasma, UV/ozone, air-vacuum transfer},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/1/89},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/52/1/89},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Marti, Kilian and Fuchs, Peter and Russi, Stefan}
}

@Article { ,
   title = {Determining the viscoelastic properties obtained by depth sensing microindentation of epoxy and polyester thermosets using a new phenomenological method},
   journal = {Materials Research Express},
   year = {2015},
   month = {1},
   day = {2},
   volume = {2},
   number = {1},
   number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials},
   pages = {015301},
   web_url = {http://iopscience.iop.org/article/10.1088/2053-1591/2/1/015301/pdf},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {IOP Publishing},
   address = {London},
   language = {30},
   ISSN = {2053-1591},
   DOI = {10.1088/2053-1591/2/1/015301},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Kohl, JGK and Schwarzer, NS and Ngo, TTN and Favaro, GF and Rengnet, ER and Bierwisch, NB}
}

@Article { ,
   title = {An active filter for Delta-Sigma-modulated Josephson waveforms},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2015},
   volume = {64},
   number = {6},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {1559-1563},
   keywords = {Active filters, analog circuits, Butterworth filters, harmonic distortion, Josephson voltage standards, low-pass filters, phase distortion, temperature dependence},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {30},
   ISSN = {0018-9456},
   DOI = {10.1109/TIM.2015.2418454},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Bergsten, Tobias and Eklund, Gunnar and Tarasso, Valter and Rydler, Karl-Erik}
}

@Article { GarciaToranoPCRABLD2015,
   title = {A novel radionuclide specific detector system for the measurement of radioactivity at steelworks},
   journal = {Journal of Radioanalytical and Nuclear Chemistry},
   year = {2015},
   number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry},
   keywords = {Metal radioactivity; HPGe detectors; MDA; metallurgy; steel works},
   web_url = {http://www.springer.com/chemistry/journal/10967},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   DOI = {10.1007/s10967-014-3901-8},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Garc{\'i}a-Tora{\~n}o, E. and Peyres, V. and Caro, B. and Roteta, M. and Arnold, D. and Burda, O. and Loan, M-R. and De Felice, P.}
}

@Article { ,
   title = {Results of the EURAMET.RI(II)-S6.I-129 Supplementary Comparison},
   journal = {Metrologia Tech. Suppl.},
   year = {2015},
   volume = {52},
   number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management},
   pages = {06017},
   keywords = {Activity measurements; I-129; International comparisons},
   web_url = {http://iopscience.iop.org/0026-1394},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Institute of Physcis Science},
   address = {Bristol, UK},
   language = {30},
   ISSN = {1681-7575},
   DOI = {10.1088/0026-1394/52/1A/06017},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-8-1},
   author = {Garcia-Tora{\~n}o, E. and Altzitzoglou, T. and Pavel Auerbach, P. and B{\'e}, M.M. and Lourenco, V. and Bobin, C. and Cassette, P. and Dersch, R. and Kossert, K. and N{\"a}hle, O. and Peyr{\'e}s, V. and Pomm{\'e}, S. and Rozkov, A. and Sanchez-Cabezudo, A. and Sochorov{\'a}, J.}
}

@Proceedings { ,
   title = {Measuring and specifying goniochromatic colors},
   journal = {Proceedings of 23rd Congress of the International Commission for Optics},
   year = {2015},
   volume = {1},
   number = {1},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {1},
   keywords = {Goniochormatism, Color measurements, BRDF},
   web_url = {http://hdl.handle.net/10261/111907},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {International Commission for Optics},
   address = {Orlando},
   event_place = {Santiago de Compostela, Spain},
   event_name = {23rd Congress of the International Commission for Optics},
   event_date = {26-29/08/2014},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ferrero, A. and Campos, J. and Perales, E. and Rabal, A. and Mart{\'i}nez-Verd{\'u}, F. and Pons, A. and Chorro, E. and Hernanz, M.L.}
}

@Proceedings { ,
   title = {Color gamut of a typical display for the color reproduction of effect coatings},
   journal = {Proceedings of 23rd Congress of the International Commission for Optics},
   year = {2015},
   volume = {1},
   number = {1},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {1-4},
   keywords = {effect coatings, goniochromatic , color measurement, BRDF},
   web_url = {http://hdl.handle.net/10261/111835},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Proceedings of 23rd Congress of the International Commission for Optics},
   address = {Orlando},
   event_place = {Santiago de Compostela, Spain},
   event_name = {Proceedings of 23rd Congress of the International Commission for Optics},
   event_date = {26-29/08/2014},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Perales, E. and Ferrero, A. and Chorro, E. and Viqueira, V. and Rabal, A. and Mart{\'i}nez-Verd{\'u}, F. and Pons, A. and Campos, J.}
}

@Proceedings { ,
   title = {Development of a microflow primary standard},
   year = {2015},
   number2 = {HLT07: MeDD: Metrology for drug delivery},
   keywords = {Flow. uncertainty, measurement},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   event_place = {Coimbra/Portugal},
   event_name = {5th National meeting of the Portuguese Society of Metrology},
   event_date = {November 2012},
   language = {92},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Batista, Elsa and Gala, Jo{\~a}o and Ribeiro, Luis and Almeida, Nelson and Filipe, Eduarda and Martins, Rui}
}

@Article { ,
   title = {Brillouin amplification supports 1x 10-20 uncertainty in optical frequency transfer over 1400 km of underground fiber},
   journal = {PHYSICAL REVIEW A},
   year = {2015},
   volume = {92},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   DOI = {10.1103/PhysRevA.92.021801},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Raupach, S. and Koczwara, A. and Grosche, G.}
}

@Proceedings { ,
   title = {Design and Analysis of a Verification Device for the Nonlinear Vector Network Analyzer},
   journal = {Proceedings 85th ARFTG Conference},
   year = {2015},
   volume = {85},
   number = {1},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-4},
   keywords = {Verification device, Network analyzer, NVNA, LSNA, Verification of calibration, Traceability},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7162895\&isnumber=7162886},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {Piscataway},
   event_place = {Phoenix, Arizona, USA},
   event_name = {85th ARFTG Microwave Measurement Conference},
   event_date = {22-05-2015},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   DOI = {10.1109/ARFTG.2015.7162895},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7162895\&isnumber=7162886},
   author = {Rajabi, M. and Humphreys, D. A. and Nielsen, T. and Barmuta, P. and Schreurs, D.}
}

@Article { ,
   title = {Energy dependent track structure parametrisations for protons and carbon ions based on nanometric simulations},
   journal = {The European Physical Journal D},
   year = {2015},
   volume = {69},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {216},
   keywords = {track structure; particle beams; radiotherapy},
   web_url = {http://link.springer.com/article/10.1140\%2Fepjd\%2Fe2015-60206-5},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {Springer},
   address = {Cham, Switzerland},
   language = {30},
   ISSN = {1434-6079},
   DOI = {10.1140/epjd/e2015-60206-5},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Alexander, F and Villagrasa, C and Rabus, H and Wilkens, J J}
}

@Article { ,
   title = {A study of thermal dose induced autophagy, apoptosis and necroptosis in colon cancer cells},
   journal = {International Journal of Hyperthermia},
   year = {2015},
   volume = {31},
   number = {5},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {476-488},
   keywords = {Apoptosis, Autophagy, Necroptosis, Thermal Dose, High Intensity Focused Ultrasound},
   web_url = {http://www.ncbi.nlm.nih.gov/pubmed/25974074},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Taylor Francis},
   address = {Abingdon},
   language = {30},
   ISSN = {N/A},
   DOI = {10.3109/02656736.2015.1029995},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Mouratidis, P and Rivens, I and Ter Haar, G}
}

@Article { ,
   title = {Methoden der Zellz{\"a}hlung - Referenzverfahren zur Messung von Stammzellkonzentrationen},
   journal = {BIOspektrum Wissenschaft Special Durchflusszytometrie},
   year = {2015},
   volume = {21. Jahrgang},
   number = {03.15},
   number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules},
   pages = {294-297},
   keywords = {quantitative measurement, cell counting, stem cells, reference procedure},
   web_url = {-},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Springer Science+Business Media (ed.)},
   address = {Berlin, Heidelberg, Luxembourg},
   language = {43},
   ISSN = {-},
   DOI = {10.1007/s12268-015-0577-8},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Neukammer, J. and Kammel, M. and H{\"o}ckner, J. and Kummrow, A. and Ruf, A.}
}

@Article { ,
   title = {Primary standardization of SIR-Spheres based on the dissolution of the 90Y-labelled resin microspheres},
   journal = {Applied Radiation and Isotopes},
   year = {2015},
   volume = {97},
   number = {-},
   number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy},
   pages = {170 176},
   keywords = {Radionuclide metrology, SIR-Spheres standardization, 90Y-labelled resin microspheres, Dissolution of ion exchange resin, TDCR method, Calibration factors of ionization chambers},
   web_url = {-},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {ELSEVIER},
   address = {Amsterdam},
   language = {30},
   ISSN = {0969 8043},
   DOI = {10.1016/j.apradiso.2014.12.024},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S0969804314004515},
   author = {Louren\c{c}o, VL and Bobin, CB and Chist{\'e}, VC and Lacour, DL and Rigoulay, FR and Tapner, MT and Thiam, CT and Ferreux, LF}
}

@Inbook { ,
   title = {Chapter 6 “ Metrology for Vector Network Analyzers (VNA)''},
   year = {2015},
   volume = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {185-250},
   keywords = {Vector Network Analyzers, Metallic waveguides, Network Analyzer Calibration Standards and Methods, Network Analyzer Errors and Uncertainties},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Artech House},
   address = {Norwood, USA},
   booktitle = {Terahertz Metrology},
   language = {30},
   ISBN = {978-1-60807-777-9},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   stag_bib_extends_persistent_identifier = {http://www.artechhouse.com/International/books/2233.aspx},
   author = {Clarke, R. G. and Ridler, N. M.}
}

@Article { SalterR2015,
   subid = {791},
   title = {Analyzing uncertainty matrices associated with multiple S-parameter measurements},
   journal = {IEEE},
   year = {2015},
   number2 = {14IND10: MET5G: Metrology for 5G communications},
   keywords = {S-parameters, uncertainty of measurement, uncertainty matrices, measurement covariance matrices, multivariate measurands},
   web_url = {http://arxiv.org/abs/1809.07297},
   web_url2 = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7162898},
   misc2 = {EMPIR 2014: Industry},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/ARFTG.2015.7162898},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ridler, N.M. and Salter, M.J.}
}

@Article { ,
   title = {Optical-feedback cavity-enhanced absorption spectroscopy in a linear cavity: model and experiments},
   journal = {Applied Physics B},
   year = {2015},
   volume = {120},
   number = {2},
   number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments},
   pages = {329-339},
   keywords = {QUANTUM-CASCADE LASER; INJECTION-LASER; SEMICONDUCTOR-LASERS; NARROW-LINEWIDTH; SELF-LOCKING; MU-M; SPECTROMETER; REGIMES; NOISE; POWER},
   web_url = {http://link.springer.com/article/10.1007/s00340-015-6140-y},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Springer},
   address = {New  York},
   language = {30},
   ISSN = {0946-2171},
   DOI = {10.1007/s00340-015-6140-y},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Manfred, KM and Ciaffoni, L and Ritchie, GAD}
}

@Article { ,
   title = {Optical feedback cavity-enhanced absorption spectroscopy with a 3.24 mu m interband cascade laser},
   journal = {Applied Physics Letters},
   year = {2015},
   volume = {106},
   number = {22},
   number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments},
   pages = {221106},
   keywords = {DIODE-LASERS; SPECTROMETER; TEMPERATURE; SENSOR},
   web_url = {http://scitation.aip.org/content/aip/journal/apl/106/22/10.1063/1.4922149},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Americal Institute of Physics},
   address = {New  York},
   language = {30},
   ISSN = {0003-6951},
   DOI = {10.1063/1.4922149},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Manfred, KM and Ritchie, GAD and Lang, N and Ropcke, J and van Helden, JP}
}

@Article { ,
   title = {In situ calibration of meteorological sensor in Himalayan high mountain environment},
   journal = {METEOROLOGICAL APPLICATIONS},
   year = {2015},
   volume = {22},
   number = {Supplement S1},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {847-853},
   keywords = {Metrology for Meteorology; Everest Pyramid; climatic chamber; MeteoMet; temperature sensors calibration; pressure sensors calibration; uncertainty},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/met.1503/abstract},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Royal Meteorological Society},
   address = {Reading},
   language = {30},
   ISSN = {1350-4827},
   DOI = {10.1002/met.1503},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Merlone, A and Roggero, G and Verza, G P}
}

@Article { ,
   title = {A calibration facility for automatic weather stations},
   journal = {METEOROLOGICAL APPLICATIONS},
   year = {2015},
   volume = {22},
   number = {1},
   number2 = {ENV58: MeteoMet2: Metrology for essential climate variables},
   pages = {842 - 846},
   keywords = {automatic weather station calibration; calibration chamber; pressure; 
simultaneous calibration of pressure and temperature;temperature;thermometercalibrationinair;traceabilityformeteorologicalobservations;uncertainty},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/met.1514/abstract},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Royal Meteorological Society},
   address = {Reading},
   language = {30},
   ISSN = {1350-4827},
   DOI = {10.1002/met.1514},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lopardo, G and Bellagarda, S and Bertiglia, F and Merlone, A and Roggero, G and Jandric, N}
}

@Proceedings { RoscoeFVCW2015,
   title = {Testing and validation of an algorithm for configuring distribution grid sensor networks},
   journal = {23rd International Conference on Electricity Distribution},
   year = {2015},
   number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics},
   keywords = {Smart grids, Distribution grid sensor networks, Sensor placement algorithm, Power flow, Electrical engineering},
   tags = {SEG},
   web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_0779_final.pdf},
   misc2 = {EMRP A169: Call 2013 Energy II},
   event_place = {Lyon, France},
   event_name = {International Conference on Electricity Distribution},
   event_date = {15-06-2015 to 18-06-2015},
   language = {30},
   ISSN = {2032-9644},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roscoe, Andrew and Forbes, Alistair and Venturi, Alberto and Clarkson, Paul and Wright, Paul}
}

@Article { ,
   title = {Error Distributions on Large Entangled States with Non-Markovian Dynamics},
   journal = {Physical Review Letters},
   year = {2014},
   month = {12},
   day = {30},
   volume = {113},
   number = {26},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {260503},
   keywords = {Non-Markovian Dynamics, Entangled States, dephasing},
   web_url = {http://journals.aps.org/prl/},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {American Physical Society},
   address = {Washington},
   language = {30},
   ISSN = {0031-9007},
   DOI = {10.1103/PhysRevLett.113.260503},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No option selected},
   author = {McCutcheon, Dara P. S. and Lindner, Netanel H. and Rudolph, Terry}
}

@Article { ,
   title = {Accurate measurement of enhancement factor in tip-enhanced Raman spectroscopy through elimination of far-field artefacts},
   journal = {Applied Physics Letters},
   year = {2014},
   month = {12},
   day = {28},
   volume = {104},
   number = {12},
   number2 = {NEW02: Raman: Metrology for Raman Spectroscopy},
   pages = {123106},
   web_url = {http://scitation.aip.org/content/aip/journal/apl/104/12/10.1063/1.4869184},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {AIP Scitation},
   address = {American Institute of Physics},
   language = {30},
   ISSN = {0003-6951},
   DOI = {10.1063/1.4869184},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-1},
   author = {Kumar, N. and Rae, A. and Roy, D.}
}

@Article { PolyakovGMKPBDRG2014_2,
   title = {Reconstruction of mode structure of faint light sources and its applications},
   journal = {Physica Scripta},
   year = {2014},
   month = {12},
   day = {19},
   volume = {2014},
   number = {T163},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   keywords = {photon-number statistics, photon-number resolving detection, hight-order correlation function, mode reconstruction},
   web_url = {http://iopscience.iop.org/1402-4896/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   ISSN = {0031-8949},
   DOI = {10.1088/0031-8949/2014/T163/014024},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Polyakov, S. V. and Goldschmidt, E. A. and Migdall, A. and K{\"u}ck, S. and Piacentini, F. and Brida, G. and Degiovanni, I. P. and Ruo Berchera, I. and Genovese, M.}
}

@Proceedings { ,
   title = {Residual Error Analysis of a Calibrated Vector Network Analyzer},
   journal = {Microwave Measurement Conference (ARFTG)},
   year = {2014},
   month = {12},
   day = {4},
   volume = {n/a},
   number = {84th ARFTG proceedings},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-6},
   keywords = {S-parameter, VNA, VNA calibration, VNA verification, airline, ripple technique, residual error, assessment technique.},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {n/a},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1109/ARFTG.2014.7013417},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mubarak, F.A. and Rietveld, G.}
}

@Article { ,
   title = {A calculable and correlation-based magnetic field fluctuation thermometer},
   journal = {Journal of Physics},
   year = {2014},
   month = {12},
   day = {4},
   volume = {568},
   number = {3},
   number2 = {SIB01: InK: Implementing the new kelvin},
   pages = {032012},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/568/3/032012/pdf},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Science},
   address = {Bristol},
   language = {30},
   ISSN = {NA},
   DOI = {10.1088/1742-6596/568/3/032012},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Kirste, A and Regin, M and Engert, J and Drung, D and Schurig, T}
}

@Proceedings { ,
   title = {Evaluating the Effect of Using Precision Alignment Dowels on Connection Repeatability of Waveguide Devices at Frequencies from 750 GHz to 1.1 THz},
   journal = {84th ARFTG Microwave Measurement Conference (ARFTG)},
   year = {2014},
   month = {12},
   day = {4},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {N/A},
   keywords = {Measurement repeatability, Submillimeter-wave measurements, VNA measurements, Waveguide flanges, Waveguide interfaces, Waveguide measurements},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7013405},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   event_place = {Boulder, Colorado, USA},
   event_name = {84th ARFTG Microwave Measurement Conference (ARFTG)},
   event_date = {04-12-2014 to 05-12-2014},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   DOI = {10.1109/ARFTG.2014.7013405},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ridler, N. M. and Clarke, R. G.}
}

@Article { ,
   title = {Moisture measurement setup for wood based materials},
   journal = {NCSLI Measure J. Meas. Sci.},
   year = {2014},
   month = {12},
   volume = {9},
   number = {4},
   number2 = {SIB64: METefnet: Metrology for moisture in materials},
   pages = {56-60},
   web_url = {http://www.ncsli.org/I/mj/dfiles/NCSLI_Measure_2014_December.pdf},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ojanen, M. and Sairanen, H. and Riski, K. and Kajastie, H. and Heinonen, M.}
}

@Article { RaffaeleLCCVVPPMRT2014,
   title = {Dosimetric characterization of a synthetic single crystal diamond detector in a clinical 62MeV ocular therapy proton beam},
   journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment},
   year = {2014},
   month = {12},
   volume = {767},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {310-317},
   keywords = {synthetic diamond detector, proton beam, ocular therapy},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {0168-9002},
   DOI = {10.1016/j.nima.2014.09.004},
   stag_bib_extends_levelofaccess = {NA},
   author = {Raffaele, L. and La Rosa, R.M. and Cuttone, G. and Cirrone, G.A.P. and Verona-Rinati, G. and Verona, C. and Prestopino, G. and Pompili, F. and Marinelli, M. and Romano, F. and Tuv{\`e}, C.}
}

@Article { GilabertBLMRCMB2014,
   title = {Traceability of Ground-Based Air-Temperature Measurements: A Case Study on the Meteorological Observatory of Moncalieri (Italy)},
   journal = {International Journal of Thermophysics},
   year = {2014},
   month = {11},
   day = {28},
   volume = {36},
   number = {2-3},
   number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere},
   pages = {589-601},
   keywords = {Air temperature, Calibration facility, Calibration uncertainty, Climate, change analysis, Historical temperature data series, Metrology for meteorology and climate, Traceability},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Springer Nature},
   language = {30},
   ISSN = {0195-928X, 1572-9567},
   DOI = {10.1007/s10765-014-1806-y},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gilabert, A. and Bertiglia, F. and Lopardo, G. and Merlone, A. and Roggero, G. and Cat Berro, D. and Mercalli, L. and Brunet, M.}
}

@Article { ReischlKN2014,
   title = {Nanoindentation of gold nanorods with an atomic force microscope},
   journal = {Materials Research Express},
   year = {2014},
   month = {11},
   day = {28},
   volume = {1},
   number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects},
   keywords = {AFM, nanoindentation, molecular dynamics},
   web_url = {http://iopscience.iop.org/2053-1591/1/4/045042/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   language = {English},
   DOI = {10.1088/2053-1591/1/4/045042},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Reischl, B and Kuronen, A and Nordlund, K}
}

@Article { ,
   title = {Optical characterisation of patterned thin films},
   journal = {Thin Solid Films},
   year = {2014},
   month = {11},
   day = {28},
   volume = {571},
   number = {3},
   number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films},
   pages = {601-604},
   keywords = {Spectroscopic imaging and mapping ellipsometry, Inhomogeneous and patterned thin films, SiO2, Photoresist},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0040609013019056},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Elsevier},
   address = {Amsterdam, Netherlands},
   language = {30},
   ISSN = {0040-6090},
   DOI = {10.1016/j.tsf.2013.11.052},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rosu, DR and Petrik, PP and Rattmann, GR and Schellenberger, MS and Beck, UB and Hertwig, AH}
}

@Article { RastelloDSKCPSMIKSHKTBMPTACMKV2014,
   title = {Metrology for industrial quantum communications: the MIQC project},
   journal = {Metrologia},
   year = {2014},
   month = {11},
   day = {20},
   volume = {51},
   number = {6},
   number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications},
   pages = {10},
   keywords = {Metrology, quantum cryptography, quantum communication},
   web_url = {http://iopscience.iop.org/0026-1394/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/51/6/S267},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rastello, M L and Degiovanni, I P and Sinclair, A G and K{\"u}ck, S and Chunnilall, C J and Porrovecchio, G and Smid, M and Manoocheri, F and Ikonen, E and Kubarsepp, T and Stucki, D and Hong, K S and Kim, S K and Tosi, A and Brida, G and Meda, A and Piacentini, F and Traina, P and Al Natsheh, A and Cheung, J Y and M{\"u}ller, I and Klein, R and Vaigu, A}
}

@Article { ,
   title = {Fabrication and Characterization of Fast TESs With Small Area for Single Photon Counting},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2014},
   month = {11},
   day = {20},
   volume = {25},
   number = {3},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {2101004},
   keywords = {Transition edge sensors},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6963295},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {not known},
   language = {30},
   ISSN = {1051-8223},
   DOI = {10.1109/TASC.2014.2367455},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Portesi, C and Taralli, E and Lolli, L and Rajteri, M and Monticone, E}
}

@Article { ,
   title = {Phytos: a portable goniometer for in situ spectro-directional measurements of leaves},
   journal = {Metrologia},
   year = {2014},
   month = {11},
   day = {20},
   volume = {51},
   number = {6},
   number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate},
   pages = {S309-S313},
   keywords = {vegetation, BRF-measurement, spectrogoniometer},
   web_url = {http://iopscience.iop.org/0026-1394/51/6/S309},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/51/6/S309''},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lolli, LL and Pisani, MP and Rajteri, MR and Widlowski, JLW and Bialek, AB and Greenwell, CG and Fox, NF}
}

@Article { ,
   title = {Characterization of thin film thickness},
   journal = {Metrologia},
   year = {2014},
   month = {11},
   day = {20},
   volume = {51},
   number = {6},
   number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films},
   pages = {S302-S308},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/51/6/S302/meta},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/51/6/S302},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Pourjamal, SP and M{\"a}ntynen, HM and Jaanson, PJ and Rosu, DMR and Hertwig, AH and Manoocheri, FM and Ikonen, EI}
}

@Article { ,
   title = {Design and Fabrication of Coupled NanoSQUIDs and NEMS},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2014},
   month = {11},
   day = {20},
   volume = {25},
   number = {3},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {1602604},
   keywords = {SQUIDs, nanoscale Dayem bridges, nanoSUQID, metrology},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6960081\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fxpls\%2Fabs_all.jsp\%3Farnumber\%3D6960081},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {New York},
   language = {30},
   ISSN = {1051-8223},
   DOI = {10.1109/TASC.2014.2371696},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Bechstein, S and Ruede, F and Drung, D and Storm, J.-H. and K{\"o}hn, C and Kieler, O. F. and Kohlmann, J. and Weimann, T. and Patel, T and Li, B and Cox, D and Gallop, J. C. and Hao, L. and Schurig, T}
}

@Article { SchneidmillerBCTSSZRYSBY2014,
   title = {Time-dependent wave front propagation simulation of a hard x-ray split-and-delay unit: Towards a measurement of the temporal coherence properties of x-ray free electron lasers},
   journal = {Physical Review Special Topics - Accelerators and Beams},
   year = {2014},
   month = {11},
   day = {18},
   volume = {17},
   number = {11},
   number2 = {SIB58: Angles: Angle metrology},
   keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {American Physical Society (APS)},
   language = {30},
   ISSN = {1098-4402},
   DOI = {10.1103/PhysRevSTAB.17.110705},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schneidmiller, E. and Buzmakov, A. and Chubar, O. and Tschentscher, Th. and Sinn, H. and Samoylova, L. and Zacharias, H. and Roling, S. and Yurkov, M. V. and Siewert, F. and Braun, S. and Yandayan, T.}
}

@Proceedings { ,
   title = {Contact Materials for Mass Artefacts},
   journal = {Shaping the future by engineering : 58th IWK, Ilmenau Scientific Colloquium, Technische Universit{\"a}t Ilmenau, 8 - 12 September 2014 ; proceedings     / ilmedia},
   year = {2014},
   month = {11},
   day = {17},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {25056},
   keywords = {Mass Artefact, Contact Material, Surface analysis, Wear},
   web_url = {http://www.db-thueringen.de/servlets/DerivateServlet/Derivate-30710/ilm1-2014iwk-146.pdf},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   address = {Ilmenau},
   event_place = {Ilmenau},
   event_name = {58th IWK, Ilmenau Scientific Colloquium, Technische Universit{\"a}t Ilmenau,},
   event_date = {8 - 12 September 2014},
   language = {30},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://nbn-resolving.de/urn:nbn:de:gbv:ilm1-2014iwk:3},
   author = {Rahneberg, Ilko and Fr{\"o}hlich, Thomas}
}

@Proceedings { MeinersHagenPPRWPDSM2014,
   subid = {2002},
   title = {Refractivity compensated tracking interferometer for precision engineering},
   journal = {Shaping the Future by Engineering : Proceedings ; 58th IWK, Ilmenau Scientific Colloquium},
   year = {2014},
   month = {11},
   day = {13},
   number2 = {IND53: LUMINAR: Large volume metrology in industry},
   keywords = {interferometry, refractive index compensation, laser tracker},
   web_url = {https://nbn-resolving.org/urn:nbn:de:gbv:ilm1-2014iwk-119:6},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {dbt},
   event_place = {Ilmenau, Germany},
   event_name = {58th IWK, Ilmenau Scientific Colloquium: Proceedings},
   event_date = {08-09-2014 to 12-09-2014},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://nbn-resolving.org/urn:nbn:de:gbv:ilm1-2014iwk-119:6},
   author = {Meiners-Hagen, K. and Pollinger, F. and Prellinger, G. and Rost, K. and Wendt, K. and P{\"o}schel, W. and Dontsov, D. and Schott, W. and Mandryka, V.}
}

@Article { ,
   title = {Reduced active area in transition-edge sensors for visible-NIR photon detection: a comparison of experimental data and two-fluid model},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2014},
   month = {11},
   day = {6},
   volume = {25},
   number = {3},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {2200304},
   keywords = {Transition-edge sensors, photons, photon-number resolving detectors},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6949073},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {Unknown},
   language = {30},
   ISSN = {1051-8223},
   DOI = {10.1109/TASC.2014.2367469},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Taralli, E and Lolli, L and Portesi, C and Rajteri, M and Monticone, E and Wang, T. S. and Chen, J. K. and Zhou, X}
}

@Proceedings { ,
   title = {Connection repeatability of cross-connected waveguide verification standards for millimeter-wave vector network analysis},
   journal = {Asia-Pacific Microwave Conference 2014 (APMC 2014)},
   year = {2014},
   month = {11},
   day = {4},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {TH3G-09},
   keywords = {Measurement repeatability, cross-connected waveguide, verification standards, attenuation standards, VNAs, millimeter-wave measurements.},
   web_url = {http://ieeexplore.ieee.org/document/7067875/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {The Institute of Electronics, Information and Communication Engineers (IEICE)},
   address = {Tokyo, Japan},
   event_place = {Sendai, Japan},
   event_name = {Asia-Pacific Microwave Conference 2014 (APMC 2014)},
   event_date = {04-11-2014 to 07-11-2014},
   language = {30},
   ISBN = {978-4-9023-3931-4},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7067875},
   author = {Huang, H. and Ridler, N. M. and Salter, M. J.}
}

@Article { RoggeroBCVVM2014,
   title = {QA/QC Procedures for in-Situ Calibration of a High Altitude Automatic Weather Station: The Case Study of the AWS Pyramid, 5050 m asl, Khumbu Valley, Nepal},
   journal = {Atmospheric and Climate Sciences},
   year = {2014},
   month = {11},
   volume = {04},
   number = {05},
   number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere},
   pages = {796-802},
   keywords = {Automatic Weather Station, Himalaya, Climate Monitoring, AWSs Calibration, QA/QC Procedure},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Scientific Research Publishing Inc},
   language = {30},
   ISSN = {2160-0414, 2160-0422},
   DOI = {10.4236/acs.2014.45070},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roggero, G. and Bonasoni, P. and Cristofanelli, P. and Verza, G.P and Vuillermoz, E. and Merlone, A.}
}

@Article { MaringerSKCPGCDVHRMSJDTAHM2014,
   title = {Radioactive waste management: Review on clearance levelsand acceptance criteria legislation, requirements and standards},
   journal = {Applied Radiation and Isotopes},
   year = {2014},
   month = {11},
   volume = {81},
   number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management},
   keywords = {Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal},
   web_url = {http://www.sciencedirect.com/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Environment},
   language = {English},
   ISSN = {0969-8043},
   DOI = {10.1016/j.apradiso.2013.03.046},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Maringer, F.J. and Šur{\'a}ň, J. and Kov{\'a}ř, P. and Chauvenet, B. and Peyres, V. and Garc{\'i}a-Tora{\~n}o, E. and Cozzella, M.L. and De Felice, P. and Vodenik, B. and Hult, M. and Roseng{\aa}rd, U. and Merimaa, M. and Sz{\"u}cs, L. and Jeffery, C. and Dean, J.C.J. and Tymińsk, Z. and Arnold, D. and Hincam, R. and Mirescu, G.}
}

@Article { ,
   title = {Investigating the Intrinsic Noise Limit of Dayem Bridge NanoSQUIDs},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2014},
   month = {10},
   day = {24},
   volume = {25},
   number = {3},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {1602105},
   keywords = {SQUIDs,  Noise,  Junctions,  Critical current density (superconductivity),  Nanoscale devices,  Preamplifiers,  Niobium},
   web_url = {http://ieeexplore.ieee.org/document/6936295/?reload=true\&arnumber=6936295},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {Melville},
   language = {30},
   ISSN = {1051-8223},
   DOI = {10.1109/TASC.2014.2364920},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Patel, T and Li, B and Gallop, J and Cox, D and Kirby, K and Romans, E and Chen, J and Nisbet, A and Hao, L}
}

@Article { TesaovaBGWERCTSJNMMN2014,
   title = {Comparison of micromagnetic parameters of the ferromagnetic semiconductors (Ga,Mn)(As,P) and (Ga,Mn)As},
   journal = {Physical Review B},
   year = {2014},
   month = {10},
   day = {23},
   volume = {90},
   number = {15},
   number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems},
   keywords = {Comparison of micromagnetic parameters of the ferromagnetic semiconductors (Ga,Mn)(As,P) and (Ga,Mn)As},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {American Physical Society (APS)},
   address = {1 Research Rd, Ridge, NY 11961, USA},
   language = {30},
   ISSN = {1098-0121, 1550-235X},
   DOI = {10.1103/PhysRevB.90.155203},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tesařov{\'a}, N. and Butkovičov{\'a}, D. and Gallagher, B. L. and Wadley, P. and Edmonds, K. W. and Rushforth, A. W. and Campion, R. P. and Troj{\'a}nek, F. and Schmoranzerov{\'a}, E. and Jungwirth, T. and Nov{\'a}k, V. and Motloch, P. and Mal{\'y}, P. and Němec, P.}
}

@Proceedings { ,
   title = {Use of reduced aperture waveguide as a calculable standard for the verification of millimetre-wave vector network analyzers},
   journal = {Proceedings of the 44th European Microwave Conference, Rome, Italy, 5 – 10 October 2014},
   year = {2014},
   month = {10},
   day = {5},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {750-753},
   keywords = {Measurement standards, Electromagnetic modeling, Millimeter wave measurements},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6986543},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {European Microwave Association (EuMA)},
   address = {Louvain-la-Neuve, Belgium},
   language = {30},
   ISSN = {N/A},
   DOI = {10.1109/EuMC.2014.6986543},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Salter, M. J. and Ridler, N. M.}
}

@Article { ,
   title = {Reconfigurable Waveguide for Vector Network Analyzer Verification},
   journal = {IEEE Transactions on Microwave Theory and Techniques},
   year = {2014},
   month = {10},
   day = {1},
   volume = {62},
   number = {10},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {2415 - 2422},
   keywords = {Measurement, millimeter-wave, reconfigurable, rectangular waveguide, verification, vector network anlayzer (VNA).},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6876052},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   language = {30},
   ISSN = {N/A},
   DOI = {10.1109/TMTT.2014.2344625},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Papantonis, S. and Ridler, N. M. and Wilson, A and Lucyszyn, S}
}

@Article { CoenePRERPKU2014,
   title = {Reconstruction of sub-wavelength features and nano-positioning of gratings using coherent Fourier scatterometry},
   journal = {Optics Express},
   year = {2014},
   month = {10},
   volume = {22},
   number = {20},
   number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications},
   pages = {24678},
   keywords = {sub-wavelength  nano-positioning  gratings coherent Fourier scatterometry},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {The Optical Society},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.22.024678},
   stag_bib_extends_levelofaccess = {NA},
   author = {Coene, W.M.J. and Pereira, S.F. and Roy, S. and El Gawhary, O. and Ramanandan, G.K.P. and Petrik, P. and Kumar, N. and Urbach, H.P.}
}

@Article { GattoMonticoneKTMFRODBG2014,
   title = {Beating the diffraction Abbe limit in confocal microscopy via nonclassical photon statistics},
   journal = {Physical Review Letters},
   year = {2014},
   month = {9},
   day = {30},
   volume = {113},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {143602 [1 to 5]},
   web_url = {http://journals.aps.org/prl/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   ISSN = {1079-7114},
   DOI = {10.1103/PhysRevLett.113.143602},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gatto Monticone, D and Katamadze, K and Traina, P and Moreva, E and Forneris, J and Ruo-Berchera, I and Olivero, P and Degiovanni, I. P and Brida, G and Genovese, M}
}

@Article { ,
   title = {Future development of biologically relevant dosimetry},
   journal = {British Journal of Radiology},
   year = {2014},
   month = {9},
   day = {26},
   volume = {88},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Radiation quantities, biologically relevant dosimetry, microbeam, nanodosimetry, microdosimetry, reactive species, BioQuaRT},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {0007-1285},
   DOI = {10.1259/bjr.20140392},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Palmans, H. and Rabus, H. and Belchior, A. L. and Bug, M. U. and Galer, S. and Giesen, U. and Gonon, G. and Gruel, G. and Hilgers, G. and Moro, D. and Nettelbeck, H. and Pinto, M. and Pola, A. and Pszona, S. and Schettino, G. and Sharpe, P. H. G. and Teles, P. and Villagrasa, C. and Wilkens, J. J.}
}

@Article { LafontRHCDCRBDSP2014,
   title = {Anomalous dissipation mechanism and Hall quantization limit in polycrystalline graphene grown by chemical vapor deposition},
   journal = {Physical Review B},
   year = {2014},
   month = {9},
   day = {18},
   volume = {Phys. Rev. B 90, 115422},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   language = {English},
   DOI = {10.1103/PhysRevB.90.115422},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lafont, F. and Ribeiro-Palau, R. and Han, Z. and Cresti, A. and Delvall{\'e}e, A. and Cummings, A. W. and Roche, S. and Bouchiat, V. and Ducourtieux, S. and Schopfer, F. and Poirier, W.}
}

@Article { ChoiRDYKSPLRNGECLSELS2014,
   title = {Field trial of a quantum secured 10 Gb/s DWDM transmission system over a single installed fiber},
   journal = {Optics Express},
   year = {2014},
   month = {9},
   day = {15},
   volume = {22},
   number = {19},
   number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications},
   pages = {23121-23128},
   web_url = {http://www.opticsinfobase.org/oe/home.cfm},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.22.023121},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Choi, Iris and Rong Zhou, Yu and Dynes, James F. and Yuan, Zhiliang and Klar, Andreas and Sharpe, Andrew and Plews, Alan and Lucamarini, Marco and Radig, Christian and Neubert, J{\"o}rg and Griesser, Helmut and Eiselt, Michael and Chunnilall, Christopher and Lepert, Guillaume and Sinclair, Alastair and Elbers, J{\"o}rg-Peter and Lord, Andrew and Shields, Andrew}
}

@Article { ,
   title = {VAMAS interlaboratory study for desorption electrospray ionisation mass spectrometry (DESI MS) intensity repeatability and constancy},
   journal = {Analytical Chemistry},
   year = {2014},
   month = {9},
   day = {14},
   volume = {86},
   number = {19},
   number2 = {IND15: SurfChem: Traceable quantitative surface chemical analysis for industrial applications},
   pages = {9603–9611},
   web_url = {http://www.euramet.org/get/repository/submit-a-publication/?tx_bib_pi1\%5Beditor\%5D\%5BnumAuthors\%5D=5},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {ACS Publications},
   address = {Washington DC},
   language = {30},
   ISSN = {0003-2700},
   DOI = {10.1021/ac502075t},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Gurdak, E. and Green, F.M. and Rakowska, P. D. and Seah, M.P. and Salter, T. L. and Gilmore, I.}
}

@Article { ,
   title = {Absolute calibration of a charge-coupled device camera with twin beams},
   journal = {Applied Physics Letters},
   year = {2014},
   month = {9},
   day = {12},
   volume = {105},
   number = {10},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {101113},
   keywords = {Charge-Coupled Device (CCD), calibration, mesoscopic regime, spontaneous parametric down conversion},
   web_url = {http://scitation.aip.org/content/aip/journal/apl},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {AIP},
   address = {New York},
   language = {30},
   ISSN = {0003-6951},
   DOI = {10.1063/1.4895665},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Meda, A. and Ruo-Berchera, I. and Degiovanni, I.P. and Brida, G. and Rastello, M.L. and Genovese, M.}
}

@Article { ,
   title = {Roundtrip matrix method for calculating the leaky resonant modes of open nanophotonic structures},
   journal = {Journal of the Optical Society of America A},
   year = {2014},
   month = {9},
   day = {10},
   volume = {31},
   number = {10},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   pages = {2142-2151},
   keywords = {Mathematical methods in physics;  Numerical approximation and analysis; Computational electromagnetic methods;  Photonic crystals;  Microcavities;  Optical resonators},
   web_url = {https://www.osapublishing.org/josaa/home.cfm},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   publisher = {OSA Publishing},
   address = {Washington},
   language = {30},
   ISSN = {1084-7529},
   DOI = {10.1364/JOSAA.31.002142},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2015-9-10},
   author = {Rosenkrantz de Lasson, J. and Tr{\o}st Kristensen, P. and M{\o}rk, J. and Gregersen, N.}
}

@Article { ,
   title = {LSMO thin films with high metal–insulator transition temperature on buffered SOI substrates for uncooled microbolometers},
   journal = {Applied Surface Science},
   year = {2014},
   month = {9},
   day = {1},
   volume = {302},
   number = {n/a},
   number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security},
   pages = {30-33},
   keywords = {LSMO thin films, BTO/CeO2/YSZ buffered SOI substrate, Pulsed laser deposition, TCR coefficienta},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Elsevier},
   address = {n/a},
   language = {30},
   ISSN = {0169-4332},
   DOI = {10.1016/j.apsusc.2014.05.051},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Chromik, Š. and Štrb{\'i}k, V. and Dobročka, E. and Roch, T. and Rosov{\'a}, A. and Špankov{\'a}, M. and Lalinsk{\'y}, T. and Vanko, G. and Lobotka, P. and Ralbovsk{\'y}, M. and Choleva, P.}
}

@Proceedings { Rudtsch2014,
   title = {THERMOMETRY FIXED POINTS BASED ON BINARY EUTECTIC ALLOYS},
   year = {2014},
   month = {9},
   number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures},
   keywords = {thermometry fixed-points, binary eutectic alloys, gallium-tin},
   web_url = {http://www.db-thueringen.de/servlets/DerivateServlet/Derivate-30964/ilm1-2014iwk-162.pdf},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   event_place = {Ilmenau, Germany},
   event_name = {58th ILMENAU SCIENTIFIC COLLOQUIUM},
   event_date = {8-10 September 2014},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rudtsch, S.}
}

@Proceedings { ,
   title = {Smart Grid Metrology to Support Reliable Electricity Supply},
   journal = {n/a},
   year = {2014},
   month = {8},
   day = {24},
   volume = {n/a},
   number = {n/a},
   number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality},
   pages = {680 – 681},
   keywords = {smart grid, metrology, synchrophasor, revenue metering, power quality, grid modelling, electrical grids},
   web_url = {http://ieeexplore.ieee.org/application/enterprise/entconfirmation.jsp?arnumber=6898568\&icp=false},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {n/a},
   address = {n/a},
   event_place = {Rio de Janeiro, Brasil},
   event_name = {CPEM Conference on precision and electromagnetic measurements},
   event_date = {24-29 August 2014},
   language = {30},
   ISBN = {978-1-4799-5205-2},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898568},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rietveld, Gert and Braun, Jean-Pierre and Wright, Paul and Clarkson, Paul and Zisky, Norbert}
}

@Article { ,
   title = {Ultrastable laser with average fractional frequency drift rate below 5 \(\times\) 10−19/s},
   journal = {Optics Letters},
   year = {2014},
   month = {8},
   day = {22},
   volume = {39},
   number = {17},
   number2 = {IND14: Frequency: New generation of frequency standards for industry},
   pages = {5102 - 5105},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {30},
   ISSN = {0146-9592},
   DOI = {10.1364/OL.39.005102},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Hagemann, C. and Grebing, C. and Lisdat, C. and Falke, St. and Legero, T. and Sterr, U. and Riehle, F. and Martin, M. J. and Ye, J.}
}

@Proceedings { SchererGJMPR2014,
   title = {Introducing Joint Research Project «Quantum Ampere» for the realisation of the new SI ampere},
   journal = {Nur online: EPJ Web of Conferences 77, 00004 (2014)},
   year = {2014},
   month = {8},
   day = {19},
   volume = {77},
   number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere},
   web_url = {http://epjwoc.epj.org/articles/epjconf/abs/2014/14/epjconf_icm2014_00004/epjconf_icm2014_00004.html},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   event_place = {Paris, France},
   event_name = {16th International Congress of Metrology},
   event_date = {7-10 October 2013},
   language = {English},
   DOI = {10.1051/epjconf/20147700004},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Scherer, H. and Giblin, S. P. and Jehl, X. and Manninen, A. and Piquemal, F. and Ritchie, D. A.}
}

@Article { ,
   title = {Biologically Weighted Quantities in Radiotherapy: an EMRP Joint Research Project},
   journal = {EPJ Web of Conferences},
   year = {2014},
   month = {8},
   day = {19},
   volume = {77},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Radiation units, dose, microbeam, nanodosimetry, microdosimetry},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {2100-014X},
   DOI = {10.1051/epjconf/20147700021},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rabus, H. and Palmans, H. and Hilgers, G. and Sharpe, P. and Pinto, M. and Villagrasa, C. and Nettelbeck, H. and Moro, D. and Pola, A. and Pszona, S. and Teles, P.}
}

@Article { ,
   title = {Nanodosimetric characterization of ion beams},
   journal = {European Physics Journal D},
   year = {2014},
   month = {8},
   day = {11},
   volume = {68},
   number = {217},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Nanodosimetry, track structure, biological effectiveness, radiation quantities},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1434-6060},
   DOI = {10.1140/epjd/e2014-50015-9},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Bug, Marion U. and Hilgers, Gerhard and Yong Bae, Woon and Rabus, Hans}
}

@Article { ,
   title = {Surface Analytical Study of Poly(acrylic acid)-Grafted Microparticles (Beads): Characterization, Chemical Derivatization, and Quantification of Surface Carboxyl Groups},
   journal = {The Journal of Physical Chemistry C},
   year = {2014},
   month = {8},
   day = {8},
   volume = {118},
   number = {35},
   number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices},
   web_url = {http://pubs.acs.org/doi/abs/10.1021/jp505519g},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   language = {30},
   ISSN = {1932-7447},
   DOI = {10.1021/jp505519g},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Dietrich, P.M. and Hennig, A. and Holzweber, M. and Thiele, T. and Borcherding, H. and Lippitz, A. and Schedler, U. and Resch-Genger, U. and Unger, W. E. S.}
}

@Article { ,
   title = {Spatially resolved triboemission imaging},
   journal = {Tribology Letters},
   year = {2014},
   month = {8},
   day = {1},
   volume = {55},
   number = {2},
   number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces},
   pages = {245-252},
   keywords = {Triboemission, Aluminium, Unlubricated wear, Wear mechanisms},
   web_url = {http://link.springer.com/article/10.1007\%2Fs11249-014-0352-x},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Springer},
   address = {Verlag},
   language = {30},
   ISSN = {1573-2711},
   DOI = {10.1007/s11249-014-0352-x},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Le Rouzic, JLR and Reddyhoff, TR}
}

@Proceedings { RodriguezPLKKKHGCBABSUWW2014,
   title = {The EMRP project Metrology for III–V materials based high efficiency multi-junction solar cells},
   journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)},
   year = {2014},
   month = {8},
   number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells},
   keywords = {Nanoscale electrical measurement Multijunction solar cells standards high conversion efficiency III-V materials characterization},
   misc2 = {EMRP A169: Call 2013 Energy II},
   publisher = {IEEE},
   event_place = {Rio de Janeiro},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {25-08-2014 to 29-08-2014},
   language = {30},
   ISBN = {978-1-4799-2478-3},
   ISSN = {no ISSN},
   DOI = {10.1109/CPEM.2014.6898387},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rodriguez, T. G. and Pollakowski, B. and Lackner, D. and Krupka, J. and Kienberger, F. and Kern, R. and Hoffmann, J. and Gambacorti, N. and Cuenat, A. and Baumgartner, H. and Almuneau, G. and Bounouh, A. and Sametoglu, F. and Usydus, L. and Winter, S. and Witt, F.}
}

@Article { KaiserRDYWGFCOSDSWBLLTMWY2014,
   title = {Interlaboratory assessment of nitrous oxide isotopomer analysis by isotope ratio mass spectrometry and laser spectroscopy: current status and perspectives},
   journal = {Rapid Communications in Mass Spectrometry},
   year = {2014},
   month = {8},
   volume = {28},
   number = {18},
   number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases},
   pages = {1995-2007},
   keywords = {mass spectroscopy, laser spectroscopy},
   misc2 = {EMRP A169: Call 2013 Environment II},
   publisher = {Wiley-Blackwell},
   language = {30},
   ISSN = {0951-4198},
   DOI = {10.1002/rcm.6982},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kaiser, J. and Ridley, A.R. and Doucett, R.R. and Yarnes, C.T. and Well, R. and Giesemann, A. and Forbes, M. and Casciotti, K.L. and Ostrom, N.E. and Szwec, L. and Dyckmans, J. and Steiker, A.E. and Wissel, H. and Br{\"u}ggemann, N. and Liang, M.C. and Lin, C.T. and Toyoda, S. and Mohn, J. and Wolf, B. and Yoshida, N.}
}

@Article { ,
   title = {Experimentally validated finite element model of electrocaloric multilayer ceramic structures},
   journal = {Journal of Applied Physics},
   year = {2014},
   month = {7},
   day = {28},
   volume = {116},
   number2 = {NEW09: METCO: Metrology of electro-thermal coupling for new functional materials technology},
   pages = {044511},
   keywords = {Electric fields, Dielectric properties, Temperature measurement, Finite element methods, Dielectrics},
   web_url = {http://scitation.aip.org/content/aip/journal/jap/116/4/10.1063/1.4891298},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {American Institute of Physics (AIP)},
   address = {Maryland},
   language = {30},
   ISSN = {0021-8979},
   DOI = {10.1063/1.4891298},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Smith, NAS and Rokosz, MR and Correia, TC}
}

@Article { CalamantePhDFIKKORSSv2014,
   title = {MR System Operator: Recommended Minimum Requirements for Performing MRI in Human Subjects in a Research Setting},
   journal = {JOURNAL OF MAGNETIC RESONANCE IMAGING},
   year = {2014},
   month = {7},
   day = {23},
   volume = {early view},
   number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI},
   keywords = {MR safety; research; human; education; training; guidelines},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   language = {english},
   ISSN = {1522-2586},
   DOI = {10.1002/jmri.24717},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calamante, PhD, Fernando and Faulkner Jr., BS, RT, William H. and Ittermann, PhD, Bernd and Kanal, MD, Emanuel and Kimbrell, BSRT, Vera and Owman, RT, Titti and Reeder, MD, PhD, Scott B. and Sawyer, BS, RT, Anne M. and Shellock, PhD, Frank G. and van den Brink, PhD on behalf of the ISMRM Safety Committee, Johan S.}
}

@Article { LafontRKMCCCZPJSP2014,
   title = {Quantum Hall resistance standard based on graphene grown by chemical vapor deposition on silicon carbide},
   journal = {Cornell University Library},
   year = {2014},
   month = {7},
   day = {14},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   web_url = {http://arxiv.org/abs/1407.3615v1},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lafont, F. and Ribeiro-Palau, R. and Kazazis, D. and Michon, A. and Couturaud, O. and Consejo, C. and Chassagne, T. and Zielinski, M. and Portail, M. and Jouault, B. and Schopfer, F. and Poirier, W.}
}

@Article { ,
   title = {Evaluating and Expressing Uncertainty in High-frequency Electromagnetic Measurements: A Selective Review},
   journal = {Metrologia},
   year = {2014},
   month = {7},
   day = {11},
   volume = {51},
   number = {4},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {S191-S198},
   keywords = {complex-valued quantities, electromagnetic measurement, microwave S-parameters, uncertainty of measurement},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/51/4/S191},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP Publishing},
   address = {Bristol, United Kingdom},
   language = {30},
   DOI = {10.1088/0026-1394/51/4/S191},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2015-7-11},
   author = {Ridler, N. M. and Salter, M. J.}
}

@Article { ,
   title = {Probing label-free intracellular quantification of free peptide by MALDI-ToF mass spectrometry},
   journal = {Methods},
   year = {2014},
   month = {7},
   day = {1},
   volume = {68},
   number = {2},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {331-337},
   keywords = {Cell penetrating peptides
Gene therapy
Mass spectrometry
Transfection},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1046202314001121},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Elsevier Inc.},
   address = {Amsterdam},
   language = {30},
   DOI = {10.1016/j.ymeth.2014.03.012},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rakowska, Paulina and Ryadnov, Maxim and Lamarre, Baptiste}
}

@Article { ,
   title = {Stable isotope imaging of biological samples with high resolution secondary ion mass spectrometry and complementary techniques},
   journal = {Methods},
   year = {2014},
   month = {7},
   day = {1},
   volume = {68},
   number = {2},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {317-324},
   keywords = {Stable isotope; NanoSIMS; Atomic force microscopy; Backscattered electron imaging; Correlative analysis},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1046202314000425},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Elsevier Inc.},
   address = {Amsterdam},
   language = {30},
   DOI = {10.1016/j.ymeth.2014.02.012},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Jiang, H. and Favaro, E. and Goulbourne, C.N. and Rakowska, P.D. and Hughes, G.M. and Ryadnov, M.G. and Fong, L.G. and Young, S.G. and Ferguson, D.J.P. and Harris, A.L. and Grovenor, C.R.M.}
}

@Article { ,
   title = {State of the Art Raman Techniques for Biological Applications},
   journal = {Methods},
   year = {2014},
   month = {7},
   day = {1},
   volume = {68},
   number = {2},
   number2 = {NEW02: Raman: Metrology for Raman Spectroscopy},
   pages = {338-347},
   note = {Level of access: Yes 
It was confirmed by a later email (12/09/2016)},
   keywords = {Raman spectroscopy, quantification, nonlinear optics, biomedical},
   web_url = {http://www.sciencedirect.com/science/article/pii/S1046202314000905},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Elsevier},
   address = {Amsterdam},
   language = {30},
   ISSN = {1046-2023},
   DOI = {10.1016/j.ymeth.2014.02.035},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No option selected},
   author = {Rae, A and Stosch, R and Klapetek, P and Hight Walker, A.R and Roy, D}
}

@Article { GraesslRHDWORKSLFPN2014,
   title = {Modular 32-Channel Transceiver Coil Array for Cardiac MRI at 7.0T},
   journal = {Magnetic Resonance in Medicine},
   year = {2014},
   month = {7},
   volume = {72},
   number = {1},
   number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI},
   pages = {276 to 290},
   keywords = {ultrahigh-field MRI; cardiovascular MRI; transceiver array; parallel imaging},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   ISSN = {1522-2594},
   DOI = {10.1002/mrm.24903},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Graessl, Andreas and Renz, Wolfgang and Hezel, Fabian and Dieringer, Matthias A and Winter, Lukas and Oezerdem, Celal and Rieger, Jan and Kellman, Peter and Santoro, Davide and Lindel, Tomasz D and Frauenrath, Tobias and Pfeiffer, Harald and Niendorf, Thoralf}
}

@Proceedings { ,
   title = {Towards a shock tubemethod for the dynamic calibration of pressure sensors},
   year = {2014},
   month = {7},
   number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities},
   pages = {1-17},
   keywords = {dynamic measurement, pressure sensor calibration, shock tube},
   web_url = {http://rsta.royalsocietypublishing.org/content/372/2023/20130299},
   misc2 = {EMRP A169: Call 2010 Industry},
   event_place = {Cambridge, UK},
   event_name = {Philosophical Transactions A of the Royal Society},
   event_date = {09-09-2014 to 11-09-2014},
   language = {30},
   DOI = {10.1098/rsta.2013.0299},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Downes, S. and Knott, A. and Robinson, I.}
}

@Article { ,
   title = {Traceability of mass in air to mass in vacuum: results on the correlation between the change in mass and the surface chemical state},
   journal = {Metrologia},
   year = {2014},
   month = {6},
   day = {25},
   volume = {51},
   number = {5},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {376-386},
   keywords = {mass, kilogram, XPS, traceability, vacuum, hydrogen plasma, sorption},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/51/5/376},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/51/5/376},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Fuchs, Peter and Marti, Kilian and Russi, Stefan}
}

@Article { ,
   title = {UV/ozone cleaning of mass standards: results on the correlation between mass and surface chemical state},
   journal = {Metrologia},
   year = {2014},
   month = {6},
   day = {25},
   volume = {51},
   number = {5},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {387},
   keywords = {mass standards, XPS, UV/ozone, surface chemistry},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/51/5/387},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/51/5/387},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Fuchs, Peter and Marti, Kilian and Grgic, Goran and Russi, Stefan}
}

@Article { ,
   title = {Differential elastic electron scattering cross sections of pyrimidine in the energy range between 20 eV and 1 keV},
   journal = {Physical Review A},
   year = {2014},
   month = {6},
   day = {24},
   volume = {89},
   number = {062716},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {DNA, elastic electron scattering cross sections, pyrimidine},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1050-2947},
   DOI = {10.1103/PhysRevA.89.062716},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Baek, W. Y. and Bug, M. U. and Rabus, H.}
}

@Proceedings { ,
   title = {A Method for De-Embedding Cable Flexure Errors in S-parameter Measurements},
   journal = {Microwave Measurement Conference (ARFTG), 2014},
   year = {2014},
   month = {6},
   day = {6},
   volume = {n/a},
   number = {83rd ARFTG proceedings},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-5},
   keywords = {Index Terms — S-parameters, cable errors, VNA, PNA, cable flexure, impedance, de-embedding, measurement techniques, RF.},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {n/a},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1109/ARFTG.2014.6899529},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mubarak, F.A. and Rietveld, G. and Spirito, M.}
}

@Proceedings { ,
   title = {Using Electromagnetic Modeling to Evaluate Uncertainty in a Millimeter-wave Cross-guide Verification Standard},
   journal = {83rd ARFTG Microwave Measurement Conference (ARFTG), 2014},
   year = {2014},
   month = {6},
   day = {6},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {N/A},
   keywords = {Uncertainty, Traceability, Cross-guide, Transmission loss measurements, Verification standard, Electromagnetic modeling,  Millimeter-wave measurements.},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6899523},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   event_place = {Tampa, Florida, USA},
   event_name = {83rd ARFTG Microwave Measurement Conference (ARFTG)},
   event_date = {06-06-2014 to 06-06-2014},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   DOI = {10.1109/ARFTG.2014.6899523},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Huang, H. and Ridler, N. M. and Salter, M. J.}
}

@Proceedings { ,
   title = {Further Investigations into Connection Repeatability of Waveguide Devices at Frequencies from 750 GHz to 1.1 THz},
   journal = {83rd ARFTG Microwave Measurement Conference (ARFTG)},
   year = {2014},
   month = {6},
   day = {6},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {N/A},
   keywords = {Measurement repeatability, Measurement standards, VNA calibration, Submillimeter-wave measurements, Measurement uncertainty},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6899521},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   event_place = {Tampa, Florida, USA},
   event_name = {83rd ARFTG Microwave Measurement Conference (ARFTG)},
   event_date = {06-06-2014 to 06-06-2014},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   DOI = {10.1109/ARFTG.2014.6899521},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ridler, N. M. and Clarke, R. G.}
}

@Article { ,
   title = {The Ion Counter and the StarTrack Counter: consistent nanodosimetry of track structure for carbon ions},
   journal = {INFN-LNL Report},
   year = {2014},
   month = {6},
   day = {1},
   volume = {241},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   pages = {134-165},
   keywords = {Ion beam dosimetry, nanodosimetry, track structure},
   web_url = {www.lnl.infn.it/\verb=~=annrep/read_ar/2014/contributions/pdfs/164_E_57_D052.pdf},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1828-8561},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Conte, V. and Moro, D. and Colautti, P. and Grosswendt, B. and Hilgers, G. and Rabus, H.}
}

@Article { ,
   title = {Where is the drug gone? Measuring intracellular delivery and localization.},
   journal = {Methods},
   year = {2014},
   month = {6},
   volume = {68},
   number = {2},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {281-282},
   web_url = {http://www.researchgate.net/publication/263086268_Where_is_the_drug_gone_Measuring_intracellular_delivery_and_localization},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {Elsevier Inc.},
   address = {Amsterdam},
   language = {30},
   DOI = {10.1016/j.ymeth.2014.06.001},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ryadnov, Maxim G.}
}

@Article { ,
   title = {Cryocooler operation of Josephson arrays for ac voltage standards},
   journal = {JOURNAL OF PhysIcs  CONFERENCE. SerIES},
   year = {2014},
   month = {5},
   day = {7},
   volume = {2014 J. Phys.: Conf. Ser. 507 042040.},
   number = {517},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {4-6},
   keywords = {Cryocoole, Josephson arrays, AC, Quantum Voltage standards},
   web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/507/4/042040/meta},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IOP},
   address = {Bristol BS1 6HG},
   language = {30},
   ISSN = {1742-6596-507-4-042040},
   DOI = {10.1088/1742-6596/507/4/042040},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {SOSSO, A and DELEO, N and FRETTO, M and Monticone, E and RONCAGLIONE, L and ROCCI, R and LACQUANITI, V}
}

@Proceedings { ,
   title = {ILITS Experiment: First Results1},
   journal = {HIL Annual Report 2013},
   year = {2014},
   month = {5},
   day = {1},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Ion beam dosimetry, nanodosimetry, track structure},
   web_url = {www.slcj.uw.edu.pl/en/39.html},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1895-6726},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Hilgers, G. and Helms, W. and Lambertsen, B. and Pausewang, A. and Rabus, H. and Bantsar, A. and Pszona, S. and Szeflinski, Z.}
}

@Article { ,
   title = {ILITS Experiment: First Results},
   journal = {INFN-LNL Report},
   year = {2014},
   month = {5},
   day = {1},
   volume = {240},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Ion beam dosimetry, nanodosimetry, track structure},
   web_url = {www.lnl.infn.it/\verb=~=annrep/read_ar/2013/contributions/pdfs/129_D_92_D087.pdf},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1828-8561},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Hilgers, G. and Moro, D. and Pausewang, A. and Helms, W. and Lambertsen, B. and Rabus, H. and Colautti, P. and Conte, V.}
}

@Article { ,
   title = {ILITS Experiment: Track Structure of Carbon Ions},
   journal = {INFN-LNL Report},
   year = {2014},
   month = {5},
   day = {1},
   volume = {241},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Ion beam dosimetry, nanodosimetry, track structure},
   web_url = {www.lnl.infn.it/\verb=~=annrep/read_ar/2014/contributions/pdfs/132_D_56_D051.pdf},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1828-8561},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Hilgers, G. and Moro, D. and Pausewang, A. and Helms, W. and Lambertsen, B. and Rabus, H. and Colautti, P. and Conte, V.}
}

@Article { PiacentiniMTHDBGRGR2014,
   title = {Measurement facility for the evaluation of the backscattering in fiber: Realization of an OTDR operating at single photon level},
   journal = {International Journal of Quantum Information},
   year = {2014},
   month = {4},
   day = {30},
   volume = {12},
   number = {02},
   number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications},
   pages = {1461014 [1 to 8]},
   keywords = {OTDR; single photon detector; quantum information},
   web_url = {http://www.worldscientific.com/worldscinet/ijqi},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {0219-7499},
   DOI = {10.1142/S0219749914610140},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Piacentini, Fabrizio and Meda, Alice and Traina, Paolo and Hong, Kee Suk and Degiovanni, Ivo Pietro and Brida, Giorgio and Gramegna, Marco and Ruo Berchera, Ivano and Genovese, Marco and Rastello, Maria Luisa}
}

@Article { WainPR2014,
   title = {High-Resolution Electrochemical and Topographical Imaging Using Batch-Fabricated Cantilever Probes},
   journal = {Analytical Chemistry},
   year = {2014},
   month = {4},
   day = {28},
   volume = {86},
   number2 = {IND15: SurfChem: Traceable quantitative surface chemical analysis for industrial applications},
   keywords = {SECM, AFM, Scanning Probe Microscopy, Topography, 
Graphene, Graphite, Electroactivity},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   DOI = {10.1021/ac500946v},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wain, A. J. and Pollard, A. J. and Richter, C.}
}

@Article { ,
   title = {Do we (need to) care about canopy radiation schemes in DGVMs?},
   journal = {Biogeosciences},
   year = {2014},
   month = {4},
   day = {8},
   volume = {11},
   number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate},
   pages = {1873-1897},
   web_url = {http://www.biogeosciences.net/11/1873/2014/bg-11-1873-2014.pdf},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {European Geosciences Union (EGU)},
   address = {Munich},
   language = {30},
   ISSN = {1726-4170},
   DOI = {10.5194/bg-11-1873-2014},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Loew, AL and van Bodegom, PMB and Widlowski, JLW and Otto, JO and Quaife, TQ and Pinty, BP and Raddatz, TR}
}

@Article { ,
   title = {Epitaxial LSMO thin films with correlation of electrical and magneticproperties above 400 K},
   journal = {Applied Surface Science},
   year = {2014},
   month = {4},
   day = {6},
   volume = {312},
   number = {n/a},
   number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security},
   pages = {212-215},
   keywords = {Epitaxial LSMO films, Metal–insulator transition, Coincidence of electrical and magnetic properties},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Elsevier},
   address = {n/a},
   language = {30},
   ISSN = {0169-4332},
   DOI = {10.1016/j.apsusc.2014.04.045},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Štrb{\'i}k, V. and Reiffers, M. and Dobročka, E. and Šolt{\'y}s, J. and Špankov{\'a}, M. and Chromik, Š.}
}

@Article { LopaevaROBDG2014,
   title = {A detailed description of the experimental realization of a quantum illumination protocol},
   journal = {Physica Scripta},
   year = {2014},
   month = {4},
   day = {2},
   volume = {2014},
   number = {T160},
   number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies},
   keywords = {quantum illumination, entanglement, quantum correlations, quantum enhanced measurements},
   web_url = {http://iopscience.iop.org/1402-4896/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   language = {English},
   ISSN = {0031-8949},
   DOI = {10.1088/0031-8949/2014/T160/014026},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lopaeva, E D and Ruo Berchera, I and Olivares, S and Brida, G and Degiovanni, I P and Genovese, M}
}

@Article { ,
   title = {Recent advances in vacuum sciences and applications},
   journal = {Journal of Physics D: Applied Physics},
   year = {2014},
   month = {3},
   day = {27},
   volume = {47},
   number = {15},
   number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices},
   pages = {24},
   keywords = {vacuum, surface, plasma, interface, nanoscience},
   web_url = {http://iopscience.iop.org/article/10.1088/0022-3727/47/15/153001},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0022-3727},
   DOI = {10.1088/0022-3727/47/15/153001},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2015-3-27},
   author = {Mozetič, M and Ostrikov, K and Ruzic, D.N and Curreli, D and Cvelbar, U and Tagliaferro, A and Conde, O. and Silvestre, A.J and Giapintzakis, J. and Buljan, M. and Radić, N. and Dražić, G. and Bernstorff, S. and Biederman, H. and Kyli{\'a}n, O. and Hanuš, J. and Miloševič, S. and Galtayries, A. and Dietrich, P. and Unger, W. and Sedlarik, V. and Stana-Kleinschek, K. and Drmota-Petrič, A. and Pireaux, J.J and Rogers, J.,.W and Anderle, M.}
}

@Article { HuKLSRRKBNS2014,
   title = {Magnetothermoelectric figure of merit of Co/Cu multilayers},
   journal = {APPLIED PHYSICS LETTERS},
   year = {2014},
   month = {3},
   day = {5},
   volume = {104},
   number = {092411},
   number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems},
   web_url = {http://scitation.aip.org/content/aip/journal/apl/104/9/10.1063/1.4867700},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 Open excellence call},
   DOI = {10.1063/1.4867700},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hu, X. K. and Krzysteczko, P. and Liebing, N. and Serrano-Guisan, S. and Rott, K. and Reiss, G. and Kimling, J. and B{\"o}hnert, T. and Nielsch, K. and Schumacher, H. W.}
}

@Proceedings { ,
   title = {ATOMIC FORCE MICROSCOPY STUDY ON THE EFFECT OF LOW-PRESSURE HYDROGEN PLASMA CLEANING ON STAINLESS STEEL WEIGHTS},
   journal = {Proceedings of the Joint IMEKO International TC3, TC5 and TC22 Conference 2014.},
   year = {2014},
   month = {2},
   day = {3},
   volume = {TC3},
   number = {2014},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {4},
   keywords = {AFM, hydrogen plasma cleaning, stainless steel weight, surface contamination},
   web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-004.pdf},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IMEKO},
   address = {Budapest},
   event_place = {Cape Town, SOUTH AFRICA},
   event_name = {Joint IMEKO International TC3, TC5 and TC22 Conferences},
   event_date = {February 3 - 5, 2014},
   language = {30},
   ISBN = {NA},
   ISSN = {NA},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {H{\"o}gstr{\"o}m, Richard and Riski, Kari and Ojanen, Maija and Heinonen, Martti}
}

@Article { ,
   title = {Nanoscale optical spectroscopy: an emerging tool for the characterization of graphene and related 2-D materials},
   journal = {journal of Materials NanoScience},
   year = {2014},
   month = {2},
   day = {1},
   volume = {1},
   number = {1},
   number2 = {NEW02: Raman: Metrology for Raman Spectroscopy},
   pages = {39-49},
   keywords = {Raman spectroscopy, tip-enhanced Raman spectroscopy (TERS), photoluminescence, defects, contamination, 2-D materials},
   web_url = {http://www.pubs.iscience.in/journal/index.php/jmns/article/view/195},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Intergrated Science},
   address = {New Delhi},
   language = {30},
   ISSN = {2394-0867},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-1},
   author = {Pollard, A.J. and Kumar, N. and Rae, A. and Mignuzzi, S. and Su, W. and Roy, D.}
}

@Article { ,
   title = {An Environmental Wind Tunnel Facility for Testing Meteorological Sensor Systems},
   journal = {JOURNAL OF ATMOSPHERIC AND OCEANIC TECHNOLOGY},
   year = {2014},
   month = {2},
   volume = {31},
   number = {2},
   number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere},
   pages = {447-457},
   keywords = {Atmosphere-land interaction, Atmospheric circulation, Boundary layer, Wind, Planetary atmospheres, Instrumentation/sensors},
   misc2 = {EMRP A169: Call 2010 Environment},
   language = {30},
   ISSN = {0739-0572},
   DOI = {10.1175/JTECH-D-13-00141.1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {HOLSTEIN-RATHLOU, GC. and Merrison, J. and IVERSEN, J. J. and JAKOBSEN, A. B. and NICOLAJSEN, R. and N{\O}RNBERG, P. and RASMUSSEN, K. and Merlone, A. and Lopardo, G. and HUDSON, T. and BANFIELD, D. and PORTYANKINA, G.}
}

@Article { ,
   title = {Color representation and interpretation of special effect coatings},
   journal = {Journal of the Optical Society of America A},
   year = {2014},
   month = {1},
   day = {31},
   volume = {31},
   number = {2},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {436-447},
   keywords = {(330.1710) Color, measurement; (330.1720) Color vision; (290.1483) BSDF, BRDF, and BTDF.},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {OSA},
   address = {Washington, DC, USA},
   language = {30},
   ISSN = {1084-7529 (print), 1520-8532 (online)},
   DOI = {10.1364/JOSAA.31.000436},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ferrero, A and Perales, E and Rabal, A M and Campos, J and Mart{\'i}nez-Verd{\'u}, F M and Chorro, E and Pons, A}
}

@Article { D039AgostinoBGOKR2014,
   title = {Use of Instrumental Neutron Activation Analysis to investigate the distribution of trace elements among subsamples of solid materials},
   journal = {Metrologia},
   year = {2014},
   month = {1},
   day = {16},
   volume = {51},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   pages = {48-53},
   keywords = {Instrumental Neutron Activation Analysis, homogeneity, rhodium, uncertainty},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {English},
   DOI = {10.1088/0026-1394/51/1/48},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {D'Agostino, Giancarlo and Bergamaschi, Luigi and Giordani, Laura and Oddone, Massimo and Kipphardt, Heinrich and Richter, Silke}
}

@Article { ,
   title = {Tip-enhanced Raman Spectroscopy – 1 An Interlaboratory Reproducibility and Comparison Study},
   journal = {Journal of Raman Spectroscopy},
   year = {2014},
   month = {1},
   day = {9},
   volume = {45},
   number = {1},
   number2 = {NEW02: Raman: Metrology for Raman Spectroscopy},
   pages = {22-31},
   keywords = {tip-enhanced Raman spectroscopy, interlaboratory comparison study, thiophenol self- assembled monolayer, spectra interpretation, metrology},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/jrs.4423/abstract},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Wiley Online},
   address = {Hoboken},
   language = {30},
   ISSN = {0377-0486},
   DOI = {10.1002/jrs.4423},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2016-1-1},
   author = {Blum, C. and Opilik, L. and Atkin, J.M. and Braun, K. and Kammer, S.B and Kravtsov, V. and Kumar, N. and Lemeshko, S. and Li, J.F and Luszcz, K. and Makeki, T. and Meixner, A.J. and Minne, S. and Raschke, M.B. and Ren, B. and Rogalski, J. and Roy, D. and Stephanidis, B. and Wang, X. and Zhang, D. and Zhong, J.H. and Zenobi, R.}
}

@Article { ,
   title = {Approximation of Electrical and Magneto Transport Properties of LSMO Thin Films},
   journal = {Acta Physica Polonica A},
   year = {2014},
   month = {1},
   day = {1},
   volume = {126},
   number = {1},
   number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security},
   pages = {210-211},
   keywords = {n/a},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Polish Academy of Sciences},
   address = {n/a},
   language = {30},
   ISSN = {0587-4246},
   DOI = {10.12693/APhysPolA.126.210},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Štrb{\'i}k, V. and Reiffers, M. and Chromik, Š. and Špankov{\'a}, M.}
}

@Article { KaltenbachNGPRKKJRG2014,
   title = {Gravimetric preparation and characterization of primary reference solutions of molybdenum and rhodium},
   journal = {Analytical and Bioanalytical Chemistry},
   year = {2014},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   keywords = {Digestion. Rhodium. Molybdenum. Reference solution. Metrological traceability. ICP OES. MC-ICP-MS},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {English},
   DOI = {10.1007/s00216-014-8395-2},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kaltenbach, A. and Noordmann, J. and G{\"o}rlitz, V. and Pape, C. and Richter, S. and Kipphardt, H. and Kopp, G. and J{\"a}hrling, R. and Rienitz, O. and G{\"u}ttler, B.}
}

@Proceedings { KummeTRBGA2014,
   title = {Force traceability within the meganewton range},
   journal = {Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque},
   year = {2014},
   number2 = {SIB63: Force: Force traceability within the meganewton range},
   pages = {2},
   keywords = {Force, Build-up Systems, Mega Newton},
   web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-027.pdf},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Cape Town, Republic of South Africa},
   event_name = {IMEKO 22nd TC3, 15th TC5 and 3rd TC22 International Conferences},
   event_date = {3 to 5 February},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kumme, R. and Tegtmeier, F. and R{\"o}ske, D. and Barthel, A. and Germak, A. and Averlant, P.}
}

@Article { PantazisR2014,
   title = {A hybrid continuum-particle solver for unsteady rarefied gas flows},
   journal = {Vacuum, Special Issue on Vacuum Gas Dynamics, 2014},
   year = {2014},
   number2 = {IND12: Vacuum: Vacuum metrology for production environments},
   keywords = {Hybrid solver, Unsteady flows, Orifice, Shock tube, DSMC, OpenFOAM},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0042207X14002188},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   DOI = {10.1016/j.vacuum.2014.06.022},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pantazis, S. and Rusche, H.}
}

@Article { SannaCRBM2014,
   title = {Evaluation of EPI forecasting model for grapevine infection with inclusion of uncertainty in input value and traceable calibration},
   journal = {Italian Journal of Agrometeorology},
   year = {2014},
   volume = {12},
   number = {3},
   number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere},
   pages = {33 to 44},
   keywords = {Metrology, meteorology, downy mildew, forecasting models, measurement uncertainty, EPI},
   web_url = {http://www.patroneditore.com/Agromet/2014/3/6517/evaluation_of_epi_forecasting_model_for_grapevine_infection_with_inclusion_of_uncertainty_in_input_value_and_traceable_calibration.html},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Environment},
   ISSN = {2038-5625},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sanna, F and Cossu, Q.A and Roggero, G and Bellagarda, S and Merlone, A}
}

@Proceedings { TrincheraSPLMFRRS2014,
   title = {Wideband digital modular system for dynamic characterization of PJVS},
   journal = {CPEM 2014 Digest},
   year = {2014},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {114 to 115},
   keywords = {Digital-analog conversion, signal synthesis, sampling methods, Josephson junctions},
   web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Rio de Janeiro, Brazil},
   event_name = {29th Conference on Precision Electromagnetic Measurements},
   event_date = {24 - 29 August 2014},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898285},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Trinchera, B and Sosso, A and Pogliano, U and Lacquaniti, V and Monticone, E and Fretto, M and Rocci, R and Roncaglione Tet, L and Serazio, D}
}

@Proceedings { SossoTMFRRSL2014,
   title = {Operation of SNIS arrays in a cryocooler},
   journal = {CPEM 2014 Digest},
   year = {2014},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {658  to 659},
   keywords = {PJAVS, Voltage standards, Josephson junctions, cryocoolers},
   web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Rio de Janeiro, Brazil},
   event_name = {29th Conference on Precision Electromagnetic Measurements},
   event_date = {24  to 29 August 2014},
   language = {English},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898557},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sosso, A and Trinchera, B and Monticone, E and Fretto, M and Rocci, R and Roncaglione, L and Serazio, D and Lacquaniti, V}
}

@Proceedings { BergstenETR2014,
   title = {An active filter for Delta-Sigma modulated Josephson waveforms},
   journal = {CPEM 2014 Digest},
   year = {2014},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {518 to 519},
   keywords = {Active filters, low pass filters, analog circuits, harmonic distortion, Josephson voltage standards},
   web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Rio de Janeiro, Brazil},
   event_name = {29th Conference on Precision Electromagnetic Measurements},
   event_date = {24 to 29 August 2014},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898487},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bergsten, Tobias and Eklund, Gunnar and Tarasso, Valter and Rydler, Karl-Erik}
}

@Proceedings { EklundBTR2014,
   title = {Progress towards an Impedance Bridge using two Programmable Josephson Voltage Standards},
   journal = {CPEM 2014 Digest},
   year = {2014},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {224 - 225},
   keywords = {Josephson voltage standard, Josephson array,voltage measurement, impedance bridge.},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898340},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Rio de Janeiro, Brazil},
   event_name = {29th Conference on Precision Electromagnetic Measurements},
   event_date = {24 - 29 August 2014},
   language = {English},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898340},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Eklund, Gunnar and Bergsten, Tobias and Tarasso, Valter and Rydler, Karl-Erik}
}

@Proceedings { ClaperaRJSVB2014,
   title = {A quantum device driven by an on-chip CMOS ring oscillator},
   journal = {Low Temperature Electronics (WOLTE), 2014 11th International Workshop on, IEEE},
   year = {2014},
   number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere},
   pages = {73 to 76},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6881029\&pageNumber\%3D42493\%26rowsPerPage\%3D75},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   event_place = {Grenoble},
   event_name = {11th International Workshop On Low Temperatures Electronics},
   event_date = {7-9 July 2014},
   language = {English},
   DOI = {10.1109/WOLTE.2014.6881029},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Clapera, P and Ray, S and Jehl, X and Sanquer, M and Valentian, A and Barraud, S}
}

@Proceedings { Roske2014,
   title = {Uncertainty Calculations Using Free CAS Software Maxima},
   journal = {Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque},
   year = {2014},
   number2 = {SIB63: Force: Force traceability within the meganewton range},
   pages = {6},
   keywords = {Force, Build-up Systems, Mega Newton.},
   web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-016.pdf},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Cape Town, Republic of South Africa},
   event_name = {IMEKO 22nd TC3, 15th TC5 and 3rd TC22 International Conferences},
   event_date = {3 to 5 February, 2014},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"o}ske, D}
}

@Article { MejutoCGPRP2014,
   title = {Preparation and characterisation of a 226Ra spiked slag as reference material for radioactive control of steelworks},
   journal = {Applied Radiation and Isotopes},
   year = {2014},
   volume = {94},
   number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry},
   pages = {166-174},
   keywords = {Reference materials; steel slag; radioactivity measurements; scrap; steelworks.},
   web_url = {http://www.sciencedirect.com/science/article/pii/S096980431400308x},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   DOI = {10.1016/j.apradiso.2014.08.007},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mejuto, M. and Crespo, M. T. and Garc{\'i}a-Tora{\~n}o, E. and Peyres, V. and Roteta, M. and P{\'e}rez del Villar, L.}
}

@Article { PlotnikovPRKH2014,
   title = {Determination of Major Non-Metallic Impurities in Magnesium by Glow Discharge Mass Spectrometry with a Fast Flow Source Using Sintered and Pressed Powder Samples},
   journal = {Analytical and Bioanalytical Chemistry},
   year = {2014},
   number = {406},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   pages = {7463-7471},
   keywords = {Glow discharge mass spectrometry, Magnesium matrix, nonmetallic impurities, fast flow source, electrical parameters, calibration samples.},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {English},
   DOI = {10.1007/s00216-014-8185-x},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Plotnikov, A. and Pfeifer, J. and Richter, S. and Kipphardt, H. and Hoffmann, V.}
}

@Proceedings { PalafoxRKOCGZNELGFKR2014,
   title = {AIM QuTE: Automated Impedance Metrology extending the Quantum Toolbox for Electricity},
   journal = {Digest},
   year = {2014},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2013/01/metrology_metr2013_11001/metrology_metr2013_11001.html},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Paris, France},
   event_name = {16th International Congress of Metrology},
   event_date = {7-10 October 2013},
   language = {English},
   DOI = {10.1051/metrology/201311001},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Palafox, L. and Raso, F. and Kucera, J. and Overney, F. and Callegaro, L. and Gournay, P. and Ziołek, A. and Nissil{\"a}, J. and Eklund, G. and Lippert, T. and G{\"u}lmez, Y. and Fleischmann, P. and Kampik, M. and Rybski, R.}
}

@Proceedings { NissilaOKKMCOCCDTPOKPR2014,
   title = {A precise two-channel digitally synthesized AC voltage source for impedance metrology},
   journal = {CPEM 2014 Digest},
   year = {2014},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {768 - 769},
   keywords = {Digital signal source, digital-to-analog converter, impedance ridge, standard},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898612},
   misc = {A169},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   event_place = {Rio de Janeiro, Brazil},
   event_name = {29th Conference on Precision Electromagnetic Measurements},
   event_date = {24 - 29 August 2014},
   language = {English},
   ISSN = {0589-1485},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nissil{\"a}, J. and Ojasalo, K. and Kampik, M. and Kaasalainen, J. and Maisi, V. and Casserly, M. and Overney, F. and Christensen, A. and Callegaro, L. and D'Elia, V. and Tran, N. T. M. and Pourdanesh, F. and Ortolano, M. and Kim, D. B. and Penttil{\"a}, J. and Roschier, L.}
}

@Proceedings { ,
   title = {Modeling of an adiabatic tunable-barrier electron pump},
   journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR},
   year = {2014},
   number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere},
   pages = {446-447},
   keywords = {Electron Pump, Simulation, Coulomb Blockade, Si-CMOS, Charge Pumping},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   event_place = {Rio de Janeiro},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {24-29 August 2014},
   language = {30},
   ISSN = {978-1-4799-2478-3},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ray, S. J. and Clapera, P. and Jehl, X. and Charron, T. and Djordjevic, S. and Devoille, L. and Potanina, E. and Barinovs, G. and Kashcheyevs, V.}
}

@Proceedings { ,
   title = {Characterization of hybrid metal/semiconductor electron pumps for quantum metrology},
   journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR},
   year = {2014},
   number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere},
   pages = {442-443},
   keywords = {Electron pumps, Cryogenic current comparator, Quantum metrology},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   event_place = {Rio de Janeiro},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {24-29 August 2014},
   language = {30},
   ISBN = {978-1-4799-2478-3},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Charron, T. and Devoille, L. and Djordjevic, S. and S{\'e}ron, O. and Piquemal, F. and Clapera, P. and Ray, S. J. and Jehl, X. and Wacquez, R. and Vinet, M.}
}

@Proceedings { ,
   title = {A femto ampere current amplifier based on a 30 000:1 cryogenic current comparator},
   journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR},
   year = {2014},
   number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere},
   pages = {296-297},
   keywords = {Cryogenic Current Comparator (CCC), low current metrology, small-current measurement, single electron tunneling},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   event_place = {Rio de Janeiro},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {24-29 August 2014},
   language = {30},
   ISBN = {978-1-4799-2478-3},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rengnez, F. and S{\'e}ron, O. and Devoille, L. and Placko, D. and Piquemal, F.}
}

@Proceedings { ,
   title = {A magnetic current sensor with SQUID readout},
   journal = {-},
   year = {2014},
   volume = {-},
   number = {-},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {-},
   keywords = {-},
   web_url = {-},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Luca Callegaro},
   address = {INRIM , Torino, Italy},
   event_place = {Benevento, Italy},
   event_name = {20th IMEKO TC4 International Symposium and 18th International Workshop on ADC Modelling and Testing},
   event_date = {2014-09- 15-17},
   language = {30},
   ISBN = {-},
   ISSN = {-},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Callegaro, Luca and Trinchera, Bruno and Roncaglione Tet, Luca}
}

@Article { ,
   title = {Evaluation of the measurement system for determination of frequency characteristics of functional blocks used in AC impedance bridges},
   journal = {PRZEGLĄD ELEKTROTECHNICZNY},
   year = {2014},
   volume = {R 90},
   number = {11/2014},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {45 - 47},
   keywords = {measurement system, voltage ratio measurement, calibration},
   web_url = {-},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Ryszard RYBSKI},
   address = {UZG,  Zielona G{\'o}ra},
   language = {30},
   ISSN = {0033-2097},
   DOI = {10.12915/pe.2014.11.14},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {RYBSKI, Ryszard and KACZMAREK, Janusz and KOZIOL, Miroslaw and Kampik, Marian and DUDEK, Edyta and ZIOLEK, Adam}
}

@Proceedings { ,
   title = {A measurement system for determination of frequency characteristics of functional blocks used in AC impedance bridges},
   journal = {Proc. of X Scientific Conference ''Measurement Systems in Research and Industry SP'2014''},
   year = {2014},
   volume = {-},
   number = {-},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {107 - 110},
   keywords = {measurement system, voltage ratio measurement, calibration},
   web_url = {-},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Ryszard RYBSKI},
   address = {UZG, Zielona G{\'o}ra},
   event_place = {Lagow Lubuski, Poland},
   event_name = {X Scientific Conference ''Measurement Systems in Research and Industry SP'2014”},
   event_date = {2014-06 -1-4},
   language = {30},
   ISBN = {978-83-7842-127-6},
   ISSN = {-},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {RYBSKI, Ryszard and KACZMAREK, Janusz and KOZIOL, Miroslaw and Kampik, Marian and ZIOLEK, Adam}
}

@Proceedings { ,
   title = {A precise buffer for impedance metrology},
   journal = {Mat. Konferencji Naukowo-Technicznej Podstawowe Problemy Metrologii PPM'14, Prace Komisji Metrologii Oddziału PAN w Katowicach},
   year = {2014},
   volume = {19},
   number = {-},
   number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity},
   pages = {13-16},
   keywords = {measurement system, voltage ratio measurement, calibration},
   web_url = {-},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Marian Kampik},
   address = {SUT, Gliwice, Poland},
   event_place = {Koscielisko, Poland},
   event_name = {Podstawowe Problemy Metrologii (Problems and Progress in Metrology), PPM'14},
   event_date = {2014-06- 15-18},
   language = {30},
   ISBN = {978-83-930505-9-8},
   ISSN = {-},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Kampik, Marian and TOKARSKI, Janusz and BARWINEK, Wojciech and RYBSKI, Ryszard and KACZMAREK, Janusz and KOZIOŁ, Mirosław}
}

@Article { ,
   title = {Preparations for the Forthcoming Redefinition of the Kilogram.},
   journal = {Measurement and Control},
   year = {2014},
   volume = {47},
   number = {10},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {308-314},
   web_url = {http://mac.sagepub.com/content/47/10/308.abstract},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {NPL Management Ltd},
   address = {Teddington},
   language = {30},
   DOI = {10.1177/0020294014555518},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2018-12-31},
   author = {Davidson, S and Robinson, I}
}

@Article { ,
   title = {Chirped Frequency Transfer: A Tool for Synchronization and Time Transfer},
   journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control},
   year = {2014},
   volume = {61},
   number = {6, June 2014},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {920 - 929},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   DOI = {10.1109/TUFFC.2014.2988},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Raupach, S. and Grosche, G.}
}

@Article { ,
   title = {Optical frequency transfer via a 660 km underground fiber link using a remote Brillouin amplifier},
   journal = {Optics Express},
   year = {2014},
   volume = {22},
   number = {22},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   web_url = {http://arxiv.org/abs/1407.4907},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   DOI = {10.1364/OE.22.026537},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Raupach, S. M. F. and Koczwara, A. and Grosche, G.}
}

@Proceedings { ,
   title = {Performance verification of a dual sensor stage},
   journal = {Proceedings of the 14th euspen International Conference – Dubrovnik – June 2014},
   year = {2014},
   volume = {I},
   number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom},
   pages = {P4.38, 309V1},
   keywords = {nanopositioning, nanometrology, optical interferometry},
   web_url = {http://www.euspen.eu/Portals/0/Content/2000-2013/Resources/Proceedings/2014\%20Dubrovnik\%20Contents\%20Pages.pdf},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {EUSPEN},
   address = {Bedford},
   event_place = {Dubrovnik, Croatia},
   event_name = {14th international conference of the european society for precision engineering and nanotechnology},
   event_date = {June 2-6, 2014},
   language = {30},
   ISBN = {978-0-9566790-3-1},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Yacoot, A. and Mountford, J. and Tedaldi, M. and Reid, B. and Levy, S.}
}

@Proceedings { ,
   title = {Dissipative quantum Hall effect in polycrystalline CVD graphene},
   journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)},
   year = {2014},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {42-43},
   keywords = {Backscatter,C,CVD graphene,Conductivity,Grain boundaries,Graphene,Hall bar,Hall effect,Landau level filling factor,Quantization (signal),Quantum Hall effect,Resistance,SiO2-Si,backscatter,carriers backscattering,chemical vapor deposition,chemical vapour deposition,counter propagating edge state,dissipative quantum Hall effect,electric resistance measurement,electrical conductivity measurement,grain boundaries,graphene,line defect,longitudinal conductivity measurement,numerical simulation,polycrystalline CVD graphene,quantum Hall effect,resistance metrology,resistance standards,short-circuit current,short-circuit currents,structural characterizations,wrinkles},
   web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898249},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   language = {30},
   ISBN = {978-1-4799-2479-0},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898249},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Lafont, F. and Ribeiro-Palau, R. and Cresti, A. and Han, Z. and Cummings, A.W. and Roche, S. and Bouchiat, V. and Ducourtieux, S. and Schopfer, F. and Poirier, W.}
}

@Proceedings { ,
   title = {A Low-Frequency Current Comparator For Precision Resistance Measurements},
   journal = {A Low-Frequency Current Comparator For Precision Resistance Measurements},
   year = {2014},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {760-761},
   keywords = {Resistance measurement, CCC, low frequency, measurement uncertainty, sensitivity, current comparator. Current measurement,Electrical resistance measurement, Resistance, Resistors, Standards, Windings, current comparators, electric resistance measurement, frequency 0.1 Hz to 1 Hz, frequency-dependent sensitivity, graphene-based quantum Hall resistance standard, liquid helium, low-frequency current comparator, measurement uncertainty, precision AC resistance bridge, precision resistance measurement, resistance 1 kohm to 100 ohm, resistor, resistors, sensitivity, temperature 293 K to 298 K},
   web_url = {http://ieeexplore.ieee.org/articleDetails.jsp?arnumber=6898608},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Rio de Janeiro},
   event_name = {CPEM 2014},
   event_date = {24-29 August 2014},
   language = {30},
   ISBN = {978-1-4799-2479-0},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898608},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Satrapinski, A. and P{\"o}ntynen, H. and G{\"o}tz, M. and Pesel, E. and Fletcher, N. and Goebel, R. and Rolland, B.}
}

@Proceedings { ,
   title = {Breakdown of the quantum Hall effect in epitaxial graphene},
   journal = {Breakdown of the quantum Hall effect in epitaxial graphene},
   year = {2014},
   number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene},
   pages = {40-41},
   keywords = {Current measurement,Electric breakdown,Electrical resistance measurement,Graphene,Hall effect,Hall effect devices,Resistance,SiC-C,Silicon carbide,carrier density,current density,electric breakdown,graphene,magnetic field,magnetic fields,measurement standards,phase space,polymer gated epitaxial graphene,polymers,quantum Hall effect,quantum Hall effect breakdown,quantum resistance standard,silicon compounds,wide band gap semiconductors},
   web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898248},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   event_place = {Rio de Janeiro},
   event_name = {CPEM2014},
   event_date = {24-29 Aug. 2014},
   language = {30},
   ISBN = {978-1-4799-2479-0},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898248},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Janssen, T.J.B.M. and Rozhko, S. and Tzalenchuk, A. and Alexander-Webber, J.A. and Nicholas, R.J.}
}

@Proceedings { ,
   title = {Stability tests of electronic calibration units},
   journal = {CPEM 2014 Digest},
   year = {2014},
   volume = {2014},
   number = {2014},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {16-17},
   keywords = {Measurement technique, calibration, stability analysis, temperature dependence, scattering parameters, network analysis, electronic calibration},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {n/a},
   event_place = {Rio de Janeiro, Brazil},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {25-08-2014 to 29-08-2014},
   language = {30},
   ISBN = {978-1-4799-5205-2},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898236},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Zeier, M and Hoffmann, J and Huerlimann, P and Ruefenacht, J and Wollensack, M and Judaschke, R and Kuhlmann, K}
}

@Article { ,
   title = {Modelling Elastic Wave Propagation Using the k-Wave MATLAB Toolbox},
   journal = {IEEE International Ultrasonics Symposium},
   year = {2014},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {146-149},
   keywords = {Ultrasound, modelling, bone, elastic},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {IEEE},
   language = {30},
   DOI = {10.1109/ULTSYM.2014.0037},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Treeby, BE and Jaros, J and Rohrbach, D and Cox, BT}
}

@Proceedings { ,
   title = {REALIZATION OF SINUSOIDAL FORCES AT CEM},
   year = {2014},
   number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities},
   keywords = {dynamic force
sinusoidal excitation
laser vobrometer
harmonic distortion
rocking motion},
   web_url = {www.imeko.org/publications/tc22-2014/IMEKO-TC3-TC22-2014-001.pdf},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {International Measurement Conferderation},
   address = {Budapest},
   event_place = {Cape Town, Republic of South Africa},
   event_name = {Joint IMEKO Conference TC3, TC5 \& TC22},
   event_date = {03-05, February, 2014},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Medina, M. N. and Robles, J. L and de Vicente, J.}
}

@Proceedings { ,
   title = {DETERMINATION OF PRESSURE TRANSDUCER SENSITIVITY TO HIGH FREQUENCY VIBRATION},
   year = {2014},
   number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities},
   keywords = {laser vibrometry, pressure, transducer, acceleration, sensitivity, shock tube},
   web_url = {www.imeko.org/publications/tc22-2014/IMEKO-TC3-TC22-2014-002.pdf},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {International Measurement Conferderation},
   address = {Budapest},
   event_place = {Cape Town, Republic of South Africa},
   event_name = {Joint IMEKO Conference TC3, TC5 \& TC22},
   event_date = {03-02-2014 to 05-02-2014},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Downes, S. and Knott, A. and Robinson, I.}
}

@Article { ,
   title = {Metrological Issues in Molecular Radiotherapy},
   journal = {EPJ Web of Conferences},
   year = {2014},
   volume = {77},
   number = {00022},
   number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy},
   pages = {7},
   keywords = {There are no keywords in the paper},
   web_url = {http://www.epj-conferences.org/articles/epjconf/pdf/2014/14/epjconf_icm2014_00022.pdf},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {EDP Sciences},
   address = {17, Avenue du Hoggar Parc d'Activit{\'e} de Courtabœuf BP 112 91944 Les Ulis Cedex A France},
   language = {30},
   ISSN = {Not available},
   DOI = {10.1051/epjconf/20147700022},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {D'Arienzo, Marco and Capogni, Marco and Smyth, V. and Cox, Mauric and Johansson, Lena and Solc, Jaroslav and Bobin, Christophe and Rabus, Hans and Joulaeizadeh, Leila}
}

@Article { ,
   title = {Characterization of Semiconductor Materials using Synchrotron Radiation-based Near-Field Infrared Microscopy and nano-FTIR Spectroscopy},
   journal = {Optics Express},
   year = {2014},
   volume = {22},
   number = {15},
   number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices},
   pages = {17948-17958},
   keywords = {Instrumentation, measurement, and metrology, Near-field microscopy, Optics at surfaces, Spectroscopy, Thin films, optical properties},
   web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-22-15-17948},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Optical Society of America (OSA)},
   address = {Washington},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.22.017948},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Hermann, PH and Hoehl, AH and Ulrich, GU and Fleischmann, CF and Hermelink, AH and K{\"a}stner, BK and Patoka, PP and Hornemann, AH and Beckhoff, BB and R{\"u}hl, ER and Ulm, GU}
}

@Proceedings { ,
   title = {Spectrum analysis of asynchronously sampled signals by means of an ANN method},
   journal = {CPEM 2014 Conference Digest},
   year = {2014},
   volume = {1},
   number = {Special issue CPEM 2014},
   number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements},
   pages = {422-423},
   keywords = {ANN, digital measurements, non-synchronous sampling, sampling methods, sine fitting, spectral analysis.},
   web_url = {http://ieeexplore.ieee.org/document/6898439/},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE Transactions on Instrumentation and Measurement},
   address = {Kentucky, USA},
   event_place = {Rio de Janeiro (Brazil)},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {25-08-2014 to 29-08-2014},
   language = {30},
   ISBN = {978-1-4799-5205-2},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2014.6898439},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Salinas, J.R. and D{\'i}az de Aguilar, J. and Garc{\'i}a-Lagos, F. and Joya, J. and Sandoval, F. and Romero, M.L.}
}

@Article { ,
   title = {Enhancing the sensitivity of mid-IR quantum cascade laser-based cavity-enhanced absorption spectroscopy using RF current perturbation},
   journal = {Optics Letters},
   year = {2014},
   volume = {39},
   number = {24},
   number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments},
   pages = {6811-6814},
   keywords = {Semiconductor lasers, quantum cascade; Spectroscopy, infrared},
   web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-39-24-6811},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Optical Society of America},
   address = {Washington DC},
   language = {30},
   ISSN = {0146-9592},
   DOI = {10.1364/OL.39.006811},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Manfred, KM and Kirkbride, JMR and Ciaffoni, L and Peverall, R and Ritchie, GAD}
}

@Article { NichollsCRR2014,
   title = {Wear Coatings For High Load Applications},
   journal = {Procedia CIRP},
   year = {2014},
   volume = {22},
   number = {2014},
   number2 = {IND61: Metrosion: Metrology to enable high temperature erosion testing},
   pages = {277-280},
   keywords = {Weardiamond-like carbontitanium diboridenitrides},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {Elsevier BV},
   language = {30},
   ISSN = {2212-8271},
   DOI = {10.1016/j.procir.2014.07.005},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nicholls, J.R. and Craig, M. and Rose, T. and Rao, J.}
}

@Article { ,
   title = {Prospects of the emerging Raman scattering tools for surface and nanoanalysis},
   journal = {Mapan},
   year = {2013},
   month = {12},
   day = {21},
   volume = {28},
   number = {4},
   number2 = {NEW02: Raman: Metrology for Raman Spectroscopy},
   pages = {285-297},
   note = {Vicky has confirmed by email the Level of Access as Yes},
   web_url = {http://link.springer.com/article/10.1007/s12647-013-0092-7},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Springer Nature},
   address = {Delhi India},
   language = {30},
   ISSN = {0974-9853},
   DOI = {10.1007/s12647-013-0092-7},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No option selected},
   author = {Roy, D and Rae, A}
}

@Article { ,
   title = {Proximity effect bilayer nano superconducting quantum interference devices for millikelvin magnetometry},
   journal = {Journal of Applied physics},
   year = {2013},
   month = {12},
   day = {18},
   volume = {114},
   number = {n/a},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {233907},
   keywords = {SQUIDS, nanotechnology, electrical, measurements},
   web_url = {http://scitation.aip.org/content/aip/journal/jap/114/23/10.1063/1.4843856},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {AIP},
   address = {Melville},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1063/1.4843856},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2014-12-18},
   author = {Blois, A and Rozhko, S and Hao, L and Gallop, J and Romans, E}
}

@Article { ,
   title = {Proton-impact ionisation cross sections for nanodosimetric track structure simulations},
   journal = {Radiation Protection Dosimetry},
   year = {2013},
   month = {12},
   day = {8},
   volume = {161},
   number = {1-4},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Interaction cross sections, nanodosimetry, Monte Carlo simulation, track structure},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   event_place = {Aix-en-Provence},
   event_name = {12th Neutron and Ion Dosimetry Symposium},
   event_date = {3.6.-7.6.2013},
   language = {30},
   ISSN = {0144-8420},
   DOI = {10.1093/rpd/nct317},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Bug, M. U. and Gargioni, E. and Baek, W. Y. and Hilgers, G. and Nettelbeck, H. and Rabus, H.}
}

@Proceedings { ,
   title = {TRUTHS (Traceable Radiometry Underpinning Terrestrial-and-Helio-Studies): A Mission to Achieve ''Climate Quality'' Data},
   journal = {ESA Living Planet Symposium 2013, Edinburgh, UK 9-13 September 2013},
   year = {2013},
   month = {12},
   volume = {2013},
   number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate},
   pages = {254},
   keywords = {Climate variability, Global climate models, Land cover change, Solar variability, Instruments and techniques},
   web_url = {https://ftp.space.dtu.dk/pub/Ioana/papers/s254_5fox.pdf},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {ESA Communications},
   event_place = {Edinburgh, UK},
   event_name = {ESA Living Planet Symposium 2013},
   event_date = {09-09-2013 to 11-09-2013},
   language = {30},
   ISBN = {978-92-9221-286-5},
   ISSN = {1609-042X},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Fox, NF and Green, PG and Brindley, HB and Russell, JR and Smith, DS and Lobb, DL and Cutter, MC and Barnes, AB}
}

@Proceedings { ,
   title = {Characterizing Cable Flexure Effects in S-parameter Measurements},
   journal = {Microwave Measurement Conference, 2013 82nd ARFTG},
   year = {2013},
   month = {11},
   day = {18},
   volume = {n/a},
   number = {82nd ARFTG proceedings},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {1-7},
   keywords = {VNA, PNA, S-parameters, cable effects, cable flexure, impedance, de-embedding, measurement, measurement techniques.},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {IEEE},
   address = {n/a},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1109/ARFTG-2.2013.6737336},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Mubarak, F.A. and Rietveld, G. and Hoogenboom, D. and Spirito, M.}
}

@Proceedings { ,
   title = {A New Technique for Vector Network Analyzer Calibration Verification Using a Single Reconfigurable Device},
   journal = {82nd ARFTG Microwave Measurement Conference, 18-21 Nov. 2013},
   year = {2013},
   month = {11},
   day = {18},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {N/A},
   keywords = {Waveguide, measurement, verification device, VNA, millimeter-wave, terahertz, reconfigurable/tunable.},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6737352},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   event_place = {Columbus, Ohio, USA},
   event_name = {82nd ARFTG Microwave Measurement Conference},
   event_date = {18-11-2013 to 21-11-2013},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   DOI = {10.1109/ARFTG-2.2013.6737352},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Papantonis, S. and Ridler, N. M. and Lucyszyn, S.}
}

@Proceedings { ,
   title = {Investigating Connection Repeatability of Waveguide Devices at Frequencies from 750 GHz to 1.1 THz},
   journal = {82nd ARFTG Microwave Measurement Conference},
   year = {2013},
   month = {11},
   day = {18},
   volume = {N/A},
   number = {N/A},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {N/A},
   keywords = {Measurement repeatability, Measurement standards, VNA calibration, Submillimeter-wave measurements, Measurement uncertainty},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6737350},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   event_place = {Columbus, Ohio, USA},
   event_name = {82nd ARFTG Microwave Measurement Conference},
   event_date = {18-11-2013 to 21-11-2013},
   language = {30},
   ISBN = {N/A},
   ISSN = {N/A},
   DOI = {10.1109/ARFTG-2.2013.6737350},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ridler, N. M. and Clarke, R. G.}
}

@Article { ,
   title = {Total electron scattering cross sections of pyrimidine},
   journal = {Physical Review A},
   year = {2013},
   month = {11},
   day = {14},
   volume = {88},
   number = {032702},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Electron scattering cross sections, DNA constituents},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1050-2947},
   DOI = {10.1103/PhysRevA.88.032702},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Baek, W. Y. and Arndt, A. and Bug, M. U. and Rabus, H. and Wang, M.}
}

@Article { ,
   title = {Comparison of measured and Monte-Carlo simulated track structure parameters in nanometric volumes},
   journal = {Radiation Protection Dosimetry},
   year = {2013},
   month = {11},
   day = {13},
   volume = {161},
   number = {1-4},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Nanodosimetry, Monte Carlo simulation, track structure},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   event_place = {Aix-en-Provence},
   event_name = {12th Neutron and Ion Dosimetry Symposium},
   event_date = {3.6.-7.6.2013},
   language = {30},
   ISSN = {0144-8420},
   DOI = {10.1093/rpd/nct265},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Hilgers, G. and Bug, M. U. and Gargioni, E. and Rabus, H.}
}

@Article { ,
   title = {Biofunctional Peptide Design},
   journal = {Amino Acids, Peptides and Proteins},
   year = {2013},
   month = {11},
   day = {12},
   volume = {38},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {79-121},
   web_url = {http://pubs.rsc.org/en/content/chapter/bk9781849735858-00079/978-1-84973-585-8\#!divabstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {The Royal Society of Chemistry},
   address = {London},
   language = {30},
   ISSN = {978-1-84973-585-8},
   DOI = {10.1039/9781849737081-00079},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ryadnov, Maxim}
}

@Article { ,
   title = {Peptidome Analysis: Tools and Technologies},
   journal = {Amino Acids, Peptides and Proteins},
   year = {2013},
   month = {11},
   day = {12},
   volume = {38},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {172-201},
   web_url = {http://pubs.rsc.org/en/content/chapter/bk9781849735858-00172/978-1-84973-585-8\#!divabstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {The Royal Society of Chemistry},
   address = {London},
   language = {30},
   DOI = {10.1039/9781849737081-00172},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rakowska, Paulina D. and Ryadnov, Maxim}
}

@Article { ,
   title = {Developing Traceability for S-parameter Measurements at Millimeter and Submillimeter Wavelengths},
   journal = {IEEE Microwave Magazine},
   year = {2013},
   month = {11},
   day = {1},
   volume = {14},
   number = {7},
   number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits},
   pages = {67 - 74},
   keywords = {millimeter-wave measurements, submillimeter-wave measurements, measurement traceability, S-parameter measurements},
   web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6668984},
   misc2 = {EMRP A169: Call 2012 SI Broader scope (II)},
   publisher = {Institute of Electrical and Electronics Engineers (IEEE)},
   address = {New York, USA},
   language = {30},
   ISSN = {1527-3342},
   DOI = {10.1109/MMM.2013.2280311},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Ridler, N. and Clarke, R. and Salter, M. and Wilson, A.}
}

@Article { OlschewskiEFGHKMPPRSK2013,
   title = {The in-flight blackbody calibration system for the GLORIA interferometer on board an airborne research platform},
   journal = {Atmospheric Measurement Techniques (AMT)},
   year = {2013},
   month = {11},
   volume = {6},
   number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate},
   web_url = {http://www.atmos-meas-tech.net/6/3067/2013/amt-6-3067-2013.html},
   misc2 = {EMRP A169: Call 2010 Environment},
   language = {English},
   DOI = {10.5194/amt-6-3067-2013},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Olschewski, F. and Ebersoldt, A. and Friedl-Vallon, F. and Gutschwager, B. and Hollandt, J. and Kleinert, A. and Monte, C. and Piesch, C. and Preusse, P. and Rolf, C. and Steffens, P. and Koppmann, R.}
}

@Proceedings { StuckiBCCMR2013,
   title = {Towards a high-speed quantum random number generator},
   journal = {Proc. SPIE 8899, Emerging Technologies in Security and Defence; and Quantum Security II; and Unmanned Sensor Systems X},
   year = {2013},
   month = {10},
   day = {29},
   volume = {8899},
   number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications},
   pages = {6},
   web_url = {http://spie.org},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   event_place = {Dresden, Germany},
   event_name = {Emerging Technologies in Security and Defence; and Quantum Security II; and Unmanned Sensor Systems X},
   event_date = {September 23, 2013},
   language = {English},
   DOI = {10.1117/12.2029287},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Stucki, Damien and Burri, Samuel and Charbon, Edoardo and Chunnilall, Christopher and Meneghetti, Alessio and Regazzoni, Francesco}
}

@Article { ,
   title = {Ionization cross section data of nitrogen, methane, and propane for light ions and electrons and their suitability for use in track structure simulations},
   journal = {Physical Review E},
   year = {2013},
   month = {10},
   day = {29},
   volume = {88},
   number = {043308},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Ionization cross sections, charge transfer cross sections, interaction cross sections, protons, alpha particles, PTRA, nanodosimetry, Monte Carlo simulation, track structure, benchmark},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1539-3755},
   DOI = {10.1103/PhysRevE.88.043308},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Bug, M. U. and Gargioni, E. and Nettelbeck, H. and Baek, W. Y. and Hilgers, G. and Rosenfeld, A. B. and Rabus, H.}
}

@Article { ,
   title = {A high resolution set up devoted to the measurement of the Bidirectional Reflectance Distribution Function around the specular peak, at LNE-CNAM.},
   journal = {Proceedings of the 16th International Congress of Metrology},
   year = {2013},
   month = {10},
   day = {7},
   volume = {2013},
   number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry},
   pages = {14008},
   keywords = {BRDF, goniospectrophotometer, gloss, specular, peak},
   misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)},
   publisher = {EDP Sciences},
   address = {Paris},
   language = {30},
   DOI = {10.1051/metrology/201314008},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No option selected},
   author = {Ouarets, S. and Leroux, L. and Bernard, R. and Razet, A. and Obein, G.}
}

@Proceedings { PiacentiniGMDGBPPKTLRPMBG2013,
   title = {Some recent progresses in quantum tomography realised at INRIM},
   journal = {Proc. SPIE 8875, Quantum Communications and Quantum Imaging XI},
   year = {2013},
   month = {9},
   day = {26},
   volume = {8875},
   number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications},
   pages = {13},
   web_url = {http://spie.org},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   event_place = {San Diego, California, United States},
   event_name = {Quantum Communications and Quantum Imaging XI},
   event_date = {August 25, 2013},
   language = {English},
   DOI = {10.1117/12.2023067},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Piacentini, F and Goldschmidt, E. A and Mingolla, Maria G and Degiovanni, I. P and Gramegna, M and Berchera, I. R and Polyakov, S. V and Peters, S and K{\"u}ck, S and Taralli, E and Lolli, L and Rajteri, M and Paris, M. G. A and Migdall, A and Brida, G and Genovese, M}
}

@Article { RichterFPPJ2013,
   title = {Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   journal = {GIT Labor-Fachzeitschrift},
   year = {2013},
   month = {9},
   day = {20},
   volume = {9},
   number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)},
   pages = {586-588},
   web_url = {http://www.git-labor.de/forschung/chemie-physik/tributylzinn-gesamtwasserproben},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Environment},
   language = {German},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Richter, Janine and Fettig, Ina and Piechotta, Christian and Philipp, Rosemarie and Jakubowski, Norbert}
}

@Article { LittletonKFR2013,
   title = {Spectral Interferometric Implementation with Passive Polarisation Optics of Coherent Anti-Stokes Raman Scattering},
   journal = {Physical Review Letters},
   year = {2013},
   month = {9},
   day = {5},
   volume = {111},
   number = {0031-9007},
   number2 = {NEW02: Raman: Metrology for Raman Spectroscopy},
   keywords = {coherent anti-Stokes Raman scattering, non-resonant background, hyperspectral imaging, vibrational imaging},
   web_url = {http://journals.aps.org/prl/abstract/10.1103/PhysRevLett.111.103902},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {Englisch},
   DOI = {10.1103/PhysRevLett.111.103902},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Littleton, B. and Kavanagh, T. and Festy, F. and Richards, D.}
}

@Article { ,
   title = {High precision THz radiometry},
   journal = {Infrared, Millimeter, and Terahertz Waves (IRMMW-THz), 2013, 38th International Conference on},
   year = {2013},
   month = {9},
   day = {1},
   number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security},
   pages = {2},
   keywords = {THz detector, THz calibration, traceability to SI, radiometry},
   web_url = {http://www.theconference2013.com},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {Mainz},
   language = {30},
   DOI = {10.1109/IRMMW-THz.2013.6665713},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   stag_bib_extends_persistent_identifier = {INSPEC Accession Number: 13915711},
   author = {Steiger, Andreas and Ralf, Muller}
}

@Article { ,
   title = {Universal ear simulator: Specifications and artificial ear canal design},
   journal = {InterNoise 2013},
   year = {2013},
   month = {9},
   volume = {5},
   number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound},
   pages = {3882-3889},
   keywords = {Acoustic coupler, Artificial ear, Calibration},
   web_url = {https://www.researchgate.net/publication/273759290_Universal_ear_simulator_Specifications_and_artificial_ear_canal_design},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   language = {30},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lavergne, T and Rodrigues, D and Neimanns, V and Sandermann Olsen, E and Barham, R}
}

@Article { ,
   title = {Comparative measurements on atomic layer deposited Al2O3 thin films using ex situ table top and mapping ellipsometry, as well as X-ray and VUV reflectometry},
   journal = {Thin Solid Films},
   year = {2013},
   month = {8},
   day = {31},
   volume = {541},
   number = {Current Trends in Optical and X-Ray Metrology of Advanced Materials for Nanoscale Devices III},
   number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films},
   pages = {131-135},
   keywords = {Spectroscopic ellipsometry, X-ray reflectometry, VUV reflectometry, Atomic layer deposition, Ultra-thin layer},
   web_url = {http://www.sciencedirect.com/science/article/pii/S0040609013000175},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Elsevier},
   address = {Amsterdam, Netherlands},
   language = {30},
   ISSN = {0040-6090},
   DOI = {10.1016/j.tsf.2012.12.091},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Petrik, PP and Gumprecht, TG and Nutsch, AN and Roeder, GR and Lemberger, ML and Juhasz, GJ and Polgar, OP and Major, CM and Kozma, PK and Janosov, MJ and Fodor, BF and Agocs, EA and Fried, MF}
}

@Article { ZuccoRW2013,
   title = {Laser-induced fluorescence as a tool to verify the reproducibility of iodine-based laser standards: a study of 96 iodine cells},
   journal = {Metrologia},
   year = {2013},
   month = {7},
   day = {30},
   volume = {50},
   number = {4},
   number2 = {IND14: Frequency: New generation of frequency standards for industry},
   keywords = {time and frequency, lasers, standards and calibration},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   DOI = {10.1088/0026-1394/50/4/402},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zucco, M and Robertsson, L and Wallerand, JP}
}

@Article { ,
   title = {High intrinsic energy resolution photon number resolving detectors},
   journal = {Applied Physics Letters},
   year = {2013},
   month = {7},
   day = {23},
   volume = {103},
   number = {n/a},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {041107-1-4},
   keywords = {n/a},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Applied Physics Letters},
   address = {Melville},
   language = {30},
   ISSN = {n/a},
   DOI = {10.1063/1.4815922},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2015-1-1},
   author = {Lolli, L and Tarali, E and Portesi, C and Monticone, E and Rajtei, M}
}

@Article { BertrandCCRLTSPRV2013,
   title = {Conversion from dose-to-graphite to dose-to-water in an 80 MeV/A carbon ion beam},
   journal = {Physics in Medicine and Biology},
   year = {2013},
   month = {7},
   day = {23},
   volume = {58},
   number = {16},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {5363-5380},
   keywords = {carbon ion beam, graphite to water dose conversion},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/0031-9155/58/16/5363},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bertrand, D and Cuttone, G and Cirrone, P and Romano, F and Lee, N and Thomas, R and Shipley, D and Palmans, H and Rossomme, S and Vynckier, S}
}

@Proceedings { ,
   title = {Thin-film microsusceptometer with integrated nanoloop},
   journal = {IEEE 14th International  Proceedings of Superconductive Electronics Conference},
   year = {2013},
   month = {7},
   day = {20},
   volume = {n/a},
   number = {n/a},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {1-3},
   keywords = {thin film, microsusceptometers, nanoloops},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6604262\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fiel7\%2F6598362\%2F6604250\%2F06604262.pdf\%3Farnumber\%3D6604262},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {New York},
   event_place = {Cambridge, MA},
   event_name = {IEEE 14th International  Proceedings of Superconductive Electronics Conference},
   event_date = {7-11 July 2013},
   language = {30},
   ISBN = {978-1-4673-6369-3},
   ISSN = {n/a},
   DOI = {10.1109/ISEC.2013.6604262},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Drung, D and Storm, J. H. and Ruede, F and Kirste, A and Regin, M and Schurig, T and Repoll{\'e}s, A. M. and Ses{\'e}, J and Luis, F}
}

@Article { GoldschmidtPRPPKBDMG2013,
   title = {Mode reconstruction of a light field by multi-photon statistics},
   journal = {Physical Review A},
   year = {2013},
   month = {7},
   day = {15},
   volume = {88},
   number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications},
   pages = {013822 [1-5]},
   web_url = {http://journals.aps.org/pra/abstract/10.1103/PhysRevA.88.013822},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {1050-2947},
   DOI = {10.1103/PhysRevA.88.013822},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Goldschmidt, E. and Piacentini, F. and Ruo Berchera, I. and Polyakov, S. and Peters, S. and Kueck, S. and Brida, G. and Degiovanni, I. and Migdall, A. and Genovese, M.}
}

@Article { ,
   title = {Anti-antimicrobial Peptides: Folding mediated host-defense antagonists},
   journal = {Journal of Biological Chemistry},
   year = {2013},
   month = {7},
   day = {12},
   volume = {288},
   number = {28},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {20162-20172},
   keywords = {Antimicrobial Peptides, Membrane Biophysics Microscopy, Molecular Dynamics, Nuclear Magnetic Resonance, Protein Design, Protein Folding},
   web_url = {http://www.jbc.org/content/288/28/20162.short\#corresp-1},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {ASBMB},
   address = {Maryland},
   language = {30},
   DOI = {10.1074/jbc.M113.459560},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ryan, Lloyd and Lamarre, Baptiste and Diu, Ting and Ravi, Jascindra and Judge, Peter J. and Temple, Adam and Carr, Matthew and Cerasoli, Eleonora and Su, Bo and Jenkinson, Howard F. and Martyna, Glenn and Crain, Sason and Watts, Anthony and Ryadnov, Maxim G.}
}

@Proceedings { ,
   title = {Full characterization of optical Transition-Edge Sensor by impedance spectroscopy measurements in a bandwidth extending to 1 MHz},
   journal = {IEEE},
   year = {2013},
   month = {7},
   day = {7},
   volume = {n/a},
   number = {n/a},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {1-4},
   keywords = {transition edge sensors, quantum metrology, single photon detectors},
   web_url = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=6604291\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fxpls\%2Fabs_all.jsp\%3Farnumber\%3D6604291},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {New York},
   event_place = {Cambridge, Masachussetts},
   event_name = {IEEE 14th International Superconductive Electronics Conference},
   event_date = {07-07-2013 to 11-07-2013},
   language = {30},
   ISBN = {978-1-4673-6369-3},
   ISSN = {n/a},
   DOI = {10.1109/ISEC.2013.6604291},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Lolli, L and Taralli, E and Monticone, E and Rajteri, M and Callegaro, L and Numata, T and Fukuda, D}
}

@Article { ,
   title = {CALIBRATION OF ULTRASOUND BACKSCATTER TEMPERATURE IMAGING FOR HIGH-INTENSITY FOCUSED ULTRASOUND TREATMENT PLANNING},
   journal = {Ultrasound in Medicine and Biology},
   year = {2013},
   month = {7},
   day = {3},
   volume = {39},
   number = {9},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {1596-612},
   keywords = {High-intensity focused ultrasound, Ultrasound thermometry, Diagnostic ultrasound, Liver, Perfusion},
   web_url = {http://www.ncbi.nlm.nih.gov/pubmed/23830100},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {ELSEVIER},
   address = {Amsterdam},
   language = {30},
   ISSN = {N/A},
   DOI = {10.1016/j.ultrasmedbio.2013.04.001},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Civale, J and Rivens, I and Ter Haar, G and Morris, H and Coussios, C and Friend, P and Bamber, J}
}

@Article { RajkumarMCSTK2013,
   title = {3-D Mapping of Sensitivity of Graphene Hall Devices to Local Magnetic and Electrical Fields},
   journal = {IEEE Transactions on Magnetics},
   year = {2013},
   month = {7},
   volume = {49},
   number = {7},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   keywords = {Epitaxial graphene, Hall sensor, numerical modeling},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6559189},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {0018-9464},
   DOI = {10.1109/TMAG.2013.2243708},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rajkumar, R.K and Manzin, A and Cox, D.C and Silva, S.R.P and Tzalenchuk, A and Kazakova, O}
}

@Article { LopardoBCRM2013,
   title = {Comparative analysis of the influence of solar radiationscreen ageing on temperature measurements by means of weather stations},
   journal = {INTERNATIONAL JOURNAL OF CLIMATOLOGY},
   year = {2013},
   month = {6},
   day = {26},
   number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere},
   keywords = {radiation screen; ageing;    weather station;air temperature;
solar radiation; traceability;
meteorological thermometer calibration},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/joc.3765/abstract},
   misc2 = {EMRP A169: Call 2010 Environment},
   ISSN = {Online ISSN: 1097-0088},
   DOI = {10.1002/joc.3765},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lopardo, G. and Bertiglia, F. and Curci, S. and Roggero, G. and Merlone, A.}
}

@Article { BouchendiraCCRMZDD2013,
   title = {High-speed multi-THz-range mode-hop-free tunable mid-IR laser spectrometer},
   journal = {Optics Letters},
   year = {2013},
   month = {5},
   day = {30},
   volume = {38},
   number = {11},
   number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring},
   pages = {1972-1974},
   keywords = {optical parametric oscillator, extended-cavity diode laser, high-resolution Doppler spectroscopy},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {The Optical Society},
   address = {2010 Massachusetts Ave, NW Washington, DC 20036-1023, USA},
   language = {30},
   ISSN = {0146-9592, 1539-4794},
   DOI = {10.1364/OL.38.001972},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bouchendira, Rym and Cadoret, Malo and Courtois, J{\'e}r{\'e}mie and Ricciardi, Iolanda and Mosca, Simona and Zondy, Jean-Jacques and De Natale, Paolo and De Rosa, Maurizio}
}

@Article { ,
   title = {Nanoscale imaging reveals laterally expanding antimicrobial pores in lipid bilayers},
   journal = {PNAS},
   year = {2013},
   month = {5},
   day = {28},
   volume = {110},
   number = {22},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {8918-8923},
   keywords = {innate host defense
de novo protein design
nanometrology
antibiotics
nanoscopy},
   web_url = {http://www.pnas.org/content/110/22/8918.abstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   language = {30},
   DOI = {10.1073/pnas.1222824110},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Rakowska, Paulina and Jiang, Haibo and Ray, Santanu and Pyne, Alice and Lamarre, Baptiste and Carr, Matthew and Judge, Peter and Ravi, Jascindra and Gerling, Ulla I. M. and Koksch, Beate and Martyna, Glenn J. and Hoogenboom, Bart W. and Watts, Anthony and Crain, Jason and Grovenor, Chris R. M. and Ryadnov, Maxim G.}
}

@Proceedings { PiacentiniTDTSRGGPMGBDG2013,
   title = {An extremely low-noise heralded single-photon source without temporal post-selection},
   journal = {SPIE 8773, Photon Counting Applications IV; and Quantum Optics and Quantum Information Transfer and Processing},
   year = {2013},
   month = {5},
   day = {6},
   volume = {8773},
   number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications},
   pages = {6},
   web_url = {http://spie.org},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   event_place = {Prague, Czech Republic},
   event_name = {Photon Counting Applications IV; and Quantum Optics and Quantum Information Transfer and Processing},
   event_date = {April 15, 2013},
   language = {English},
   DOI = {10.1117/12.2017378},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Piacentini, F and Traina, P and Della Frera, A and Tosi, A and Scarcella, C and Ruggeri, A and Gulinatti, A and Ghioni, M and Polyakov, S. V and Migdall, A and Giudice, A and Brida, G and Degiovanni, I. P and Genovese, M}
}

@Article { RossommeDMBLSAAPTK2013,
   title = {Fluence correction factors for graphite calorimetry in a low-energy clinical proton beam: I. Analytical and Monte Carlo simulations},
   journal = {Physics in Medicine and Biology},
   year = {2013},
   month = {4},
   day = {30},
   volume = {58},
   number = {10},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {3481-3499},
   keywords = {graphite calorimetry, monte carlo, fluence correction, proton beam},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {IOP Publishing},
   language = {30},
   ISSN = {0031-9155, 1361-6560},
   DOI = {10.1088/0031-9155/58/10/3481},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rossomme, S and Dobrovodsk{\'y}, J and Martinkovič, J and Bassler, N and L{\"u}hr, A and Shipley, D and Andreo, P and Al-Sulaiti, L and Palmans, H and Thomas, R A S and Kacperek, A}
}

@Article { MierRCV2013,
   subid = {2691},
   title = {Magnetic and electric antennas calibration for partial discharge charge estimation in gas-insulated substations},
   journal = {International Journal of Electrical Power and Energy Systems},
   year = {2013},
   month = {4},
   day = {22},
   volume = {141},
   number = {October 20},
   number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission},
   keywords = {Partial discharges, Calibration, PD sensors, Gas-insulated substations, Charge},
   tags = {SEG},
   web_url = {https://authors.elsevier.com/sd/article/S0142-0615(22)00256-3},
   misc2 = {EMPIR 2019: Energy},
   publisher = {Elsevier},
   language = {30},
   ISSN = {0142-0615},
   DOI = {10.1016/j.ijepes.2022.108226},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mier, C. and Rodrigo Mor, A. and Castro, L. and Vaessen, P.}
}

@Article { ,
   title = {An experimental system for the study of ultrasound exposure of isolated blood vessels},
   journal = {PHYSICS IN MEDICINE AND BIOLOGY},
   year = {2013},
   month = {3},
   day = {12},
   volume = {58},
   number = {7},
   number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy},
   pages = {2281-2304},
   keywords = {Ultrasound, HIFU, blood vessels},
   web_url = {http://www.ncbi.nlm.nih.gov/pubmed/23478592},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {IOP publishing},
   address = {Bristol},
   language = {30},
   ISSN = {N/A},
   DOI = {10.1088/0031-9155/58/7/2281},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Tokarczyk, A and Rivens, I and Van Bavel, E and Symonds-Tayler, R and Ter Haar, G}
}

@Article { ,
   title = {Subhertz-linewidth infrared frequency source with a long-term instability below 5\(\times\)10\verb=^=-15},
   journal = {Applied Physics B},
   year = {2013},
   month = {3},
   day = {1},
   volume = {110},
   number = {4},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {465-470},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {Print: 0946-2171, Online: 1432-0649},
   DOI = {10.1007/s00340-012-5280-6},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Raupach, S. M. F. and Legero, T. and Grebing, C. and Hagemann, Ch. and Kessler, T. and Koczwara, A. and Lipphardt, B. and Misera, M. and Schnatz, H. and Grosche, G. and Sterr, U.}
}

@Article { ,
   title = {Providing 10\verb=^=-16 short-term stability of a 1.5 \(\mu\)m laser to optical clocks},
   journal = {IEEE TIM (Transactions on Instrumentation and Measurement)},
   year = {2013},
   month = {2},
   day = {21},
   volume = {62},
   number = {6},
   number2 = {IND14: Frequency: New generation of frequency standards for industry},
   pages = {1556 - 1562},
   keywords = {Atomic clocks, femtosecond frequency combs, frequency control, laser stability, optical phase-locked loops, stability transfer, transfer oscillator},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {30},
   ISSN = {0018-9456},
   DOI = {10.1109/TIM.2013.2242597},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Hagemann, C and Grebing, C and Kessler, T and Falke, St. and Lisdat, C and Schnatz, H and Riehle, F and Sterr, U}
}

@Article { ,
   title = {Comparison of arc evaporated Mo-based coatings versus Cr1N1 and ta-C coatings by reciprocating wear test},
   journal = {Wear},
   year = {2013},
   month = {2},
   day = {15},
   volume = {298–299},
   number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials},
   pages = {14–22},
   keywords = {Arc evaporation, Tribology, Reciprocating wear test, Scuffing},
   web_url = {https://www.researchgate.net/publication/256913828_Comparison_of_arc_evaporated_Mo-based_coatings_versus_Cr1N1_and_ta-C_coatings_by_reciprocating_wear_test},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Elsevier},
   address = {Amsterdam, Netherlands},
   language = {30},
   ISSN = {0043-1648},
   DOI = {10.1016/j.wear.2012.11.085},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Seibert, FS and D{\"o}beli, MD and Fopp-Spori, DMFS and Glaentz, KG and Rudigier, HR and Schwarzer, NS and Widrig, BW and Ramm, JR}
}

@Article { ,
   title = {The use of Raman spectroscopy to characterize the carbon materials found in Amazonian anthosoils},
   journal = {Journal of Raman Spectroscopy},
   year = {2013},
   month = {2},
   day = {1},
   volume = {44},
   number = {2},
   number2 = {NEW02: Raman: Metrology for Raman Spectroscopy},
   pages = {283–289},
   keywords = {soil science; Terra Preta de {\'I}ndio; carbon},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/jrs.4191/abstract},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {Wiley},
   address = {Hobeken},
   language = {30},
   ISSN = {0377-0486},
   DOI = {10.1002/jrs.4191},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on  2014-2-28},
   author = {Ribeiro-Soares, j. and Can\c{c}ado, L.G and Falc{\~a}ob, N.P.S and Martins Ferreirac;, E.H and Achetec, C.A and Jorio, A}
}

@Article { ,
   title = {Chemical speciation at buried interfaces in high-temperature processed polycrystalline silicon thin-film solar cells on ZnO},
   journal = {Journal of Applied Physics},
   year = {2013},
   month = {1},
   day = {31},
   volume = {113},
   number = {4},
   number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films},
   pages = {1-8},
   keywords = {polycrystalline, Thin film, Solar Cells, High-temperature},
   web_url = {http://scitation.aip.org/content/aip/journal/jap/113/4/10.1063/1.4789599},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {AIP Publishing},
   address = {New york},
   language = {30},
   ISSN = {0021-8979},
   DOI = {10.1063/1.4789599},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Becker, CHB and Pagels, MP and Zach{\"a}us, CZ and Pollakowski, BP and Beckhoff, BB and Kanngie{\ss}er, BK and Rech, BR}
}

@Article { ,
   title = {Removal of mercury contamination on primary mass standards by hydrogen plasma and thermal desorption},
   journal = {Metrologia},
   year = {2013},
   month = {1},
   day = {28},
   volume = {50},
   number = {1},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {73-82},
   keywords = {XPS, mercury contamination, hydrogen plasma, thermal desorption},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/50/1/73?fromSearchPage=true},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/50/1/73},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Fuchs, Peter and Marti, Kilian and Russi, Stefan}
}

@Article { ,
   title = {Cleaning of mass standards II: a comparison of new techniques applied to new and old materials},
   journal = {Metrologia},
   year = {2013},
   month = {1},
   day = {28},
   volume = {50},
   number = {1},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {83-92},
   keywords = {UV/ozone, hydrogen plasma, mass standards, XPS, QCM},
   web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/50/1/83?fromSearchPage=true},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP Publishing},
   address = {Bristol},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/50/1/83},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Marti, Kilian and Fuchs, Peter and Russi, Stefan}
}

@Article { ,
   title = {Coupled NanoSQUIDs and Nano-Electromechanical Systems (NEMS) Resonators},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2013},
   month = {1},
   day = {3},
   volume = {23},
   number = {3},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {1800304},
   keywords = {NanoSQUIDs, nanomagnetism, NEMS mechanical resonators, single particle detection.},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6401168},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {New York},
   language = {30},
   ISSN = {1051-8223},
   DOI = {10.1109/TASC.2012.2233536},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Cox, D. C. and Hao, L and Gallop, J. C. and Chen, J and Rozhko, S and Blois, A and Romans, E. J.}
}

@Article { LiebingSKRRLOS2013,
   title = {Tunneling magneto thermocurrent in CoFeB/MgO/CoFeB based magnetic tunnel junctions},
   journal = {Applied Physics Letters},
   year = {2013},
   volume = {102},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   DOI = {10.1063/1.4811737},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Liebing, N. and Serrano-Guisan, S. and Krzysteczko, P. and Rott, K. and Reiss, G. and Langer, J. and Ocker, B. and Schumacher, H.}
}

@Proceedings { PorrovecchioSGRPNE2013,
   title = {New detection systems for UV solar reference scanning spectroradiometers},
   journal = {AIP Conference Proceedings},
   year = {2013},
   volume = {1531},
   number = {837},
   number2 = {ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation},
   keywords = {Solar radiation, UV scanning spectroradiometers.},
   web_url = {http://proceedings.aip.org/resource/2/apcpcs/1531/1/837_1?bypassSSO=1},
   misc2 = {EMRP A169: Call 2010 Environment},
   event_place = {Berlin, Germany},
   event_name = {International Radiation Symposium 2012: Radiation Processes in the Atmosphere and Ocean},
   event_date = {6 - 10 August 2012},
   ISSN = {0094-243X},
   DOI = {10.1063/1.4804900},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Porrovecchio, G. and Smid, M. and Gr{\"o}bner, J. and Rajteri, M. and Portesi, C. and Nield, K. and Egli, L.}
}

@Proceedings { IacomussiRR2013,
   title = {A comparison between different light sources induced glare on perceived contrast},
   journal = {Proceedings of the 27th Session of the CIE},
   year = {2013},
   number2 = {ENG05: Lighting: Metrology for Solid State Lighting},
   keywords = {Subjective experiment, contrast threshold, disability glare, LED},
   misc2 = {EMRP A169: Call 2009 Energy},
   event_place = {Sun City, South Africa},
   event_name = {27th Session of the CIE},
   event_date = {9 - 16 July 2011},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Iacomussi, P. and Rossi, G. and Rossi, L.}
}

@Article { BaumannEJCCRT2013,
   title = {Design of the new METAS watt balance experiment Mark II},
   journal = {Metrologia},
   year = {2013},
   volume = {50},
   number = {3},
   number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies},
   keywords = {Kilogram, Planck constant, International System of Units SI, watt balance},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {English},
   DOI = {10.1088/0026-1394/50/3/235},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Baumann, H. and Eichenberger, A. and Jeckelmann, B. and Cosandier, F. and Clavel, R. and Reber, D. and Tommasini, D.}
}

@Article { JehlVCCRRSDDWV2013,
   title = {Hybrid Metal-Semiconductor Electron Pump for Quantum Metrology},
   journal = {Physical Review X},
   year = {2013},
   volume = {3},
   number = {021012},
   number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere},
   pages = {021012-1 - 021012-7},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {English},
   ISSN = {1098-0121},
   DOI = {10.1103/PhysRevX.3.021012},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jehl, X. and Voisin, B. and Charron, T. and Clapera, P. and Ray, S. and Roche, B. and Sanquer, M. and Djordjevic, S. and Devoille, L. and Wacquez, R. and Vinet, M.}
}

@Article { GutschwagerTMARFH2013,
   title = {Comparison of the radiation temperature scales of the PTB and the NPL in the temperature range from −57 \(^{\circ}\)C to 50 \(^{\circ}\)C},
   journal = {Measurement Science and Technology},
   year = {2013},
   volume = {24},
   number = {6},
   number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate},
   pages = {065002 (9pp)},
   keywords = {radiation thermometry, infrared, radiometer, blackbody, low temperature,},
   web_url = {http://m.iopscience.iop.org/0957-0233/24/6/065002/pdf/0957-0233_24_6_065002.pdf},
   misc2 = {EMRP A169: Call 2010 Environment},
   language = {English},
   ISSN = {0957-0233/13/065002+09$33.00},
   DOI = {10.1088/0957-0233/24/6/065002},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Gutschwager, B. and Theocharous, E. and Monte, C. and Adibekyan, A. and Reiniger, M. and Fox, N. and Hollandt, J.}
}

@Proceedings { KoppmannOSRPEFKPHGM2012,
   title = {An In-flight Blackbody Calibration Source for the GLORIA Interferometer Onboard an Airborne Research Platform},
   journal = {AIP Conference Proceedings},
   year = {2013},
   volume = {1531},
   number = {322},
   number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate},
   keywords = {GLORIA, Remote sensing, Blackbody, Calibration, Infrared, Limb sounder, Thermoelectric cooler, ITS-90},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {AIP},
   event_place = {Berlin, Germany},
   event_name = {Radiation Processes in the Atmosphere and Ocean (IRS2012)},
   event_date = {6 - 10 August 2012},
   language = {English},
   DOI = {10.1063/1.4804774},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koppmann, R. and Olschewski, F. and Steffens, P. and Rolf, C. and Preusse, P. and Ebersoldt, A. and Friedl-Vallon, F. and Kleinert, A. and Piesch, C. and Hollandt, J. and Gutschwager, B. and Monte, C.}
}

@Article { JursicR2013,
   title = {Thermal stability of beta-PtO2 investigated by simultaneous thermal analysis and its influence on platinum resistance thermometry},
   journal = {International Journal of Thermophysics},
   year = {2013},
   number2 = {ENG06: Powerplants: Metrology for Improved Power Plant Efficiency},
   misc2 = {EMRP A169: Call 2009 Energy},
   language = {English},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jursic, I. and Rudtsch, S.}
}

@Proceedings { SannaRDM2013,
   title = {Metrology for Meteorology in Agricultural Sites},
   journal = {Italian Journal of Agrometeorology},
   year = {2013},
   number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere},
   keywords = {Metrology, meteorology, downy mildew, forecasting models, weather station},
   web_url = {http://www.patroneditore.com/volumi/1707/atti_del_xvi_convegno_nazionale_di_agrometeorologia.html},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Environment},
   event_place = {Florence, Italy},
   event_name = {XVI AIAM Conference 2013 - Agrometeorology for Food and Environmental Security},
   event_date = {4th to 6th of June 2013},
   ISBN = {9788855532358},
   ISSN = {2038-5625},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sanna, F and Roggero, G and Deboli, R and Merlone, A}
}

@Article { KumarERPU2013,
   title = {Phase retrieval between overlapping orders in coherentFourier scatterometry using scanning},
   journal = {Journal of the European Optical Society Rapid Publications},
   year = {2013},
   volume = {8},
   number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices},
   keywords = {Fourier scatterometry},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {30},
   DOI = {10.2971/jeos.2013.13048},
   extern = {1},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kumar, N. and El Gawhary, O. and Roy, S. and Pereira, S. and Urbach, H.}
}

@Article { RoyKPU2013,
   title = {Interferometric coherent Fourier scatterometry: a method for obtaining high sensitivity in the optical inverse-grating problem},
   journal = {Journal of Optics},
   year = {2013},
   volume = {15},
   number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices},
   keywords = {Fourier scatterometry},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   DOI = {10.1088/2040-8978/15/7/075707},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Roy, S. and Kumar, N. and Pereira, S. and Urbach, H.}
}

@Article { NabaeiRMKT2013,
   title = {Optimization of Hall bar response to localized magnetic and electric fields},
   journal = {Journal of Applied Physics},
   year = {2013},
   volume = {113},
   number = {6},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   keywords = {Hall sensors, Scanning probe microscopy, Numerical models},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {0021-8979 (print)  1089-7550 (online)},
   DOI = {10.1063/1.4790508},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nabaei, V. and Rajkumar, R. K. and Manzin, A. and Kazakova, O. and Tzalenchuk, A.}
}

@Article { RichterSSK2013,
   title = {Known purity - the fundament of element determination by atomic spectrometry},
   journal = {JAAS},
   year = {2013},
   volume = {28},
   number = {10},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   pages = {1540-1543},
   keywords = {EMRP, Primary standards, traceability, challenging elements},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {English},
   DOI = {10.1039/c3ja90045b},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Richter, S. and Sargent, M. and Schiel, D. and Kipphardt, H.}
}

@Article { ZhouRMK2013,
   title = {Determination of the total purity of a high-purity silver material to be used as a primary standard for element determination},
   journal = {Accred Qual Assur},
   year = {2013},
   volume = {18},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   pages = {341-349},
   keywords = {Silver, purity, total purity, primary standard, element determination.},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {English},
   DOI = {10.1007/s00769-013-0988-5},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhou, T. and Richter, S. and Matschat, R. and Kipphardt, H.}
}

@Article { OliveiraPPRe2013,
   title = {A METROLOGIA DAS RADIA\c{C}{\~O}ES IONIZANTES NA INDUSTRIA METALURGICA},
   journal = {Medi\c{c}{\~o}es e Ensaios, Maio 2013},
   year = {2013},
   number = {5},
   number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry},
   web_url = {http://www.spmet.pt},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {Portuguese},
   ISSN = {2182-5424},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Oliveira, Carlos and Portugal, Luis and Paiva, Isabel and Reis, M{\'a}rio and e Rom{\~a}o Trindade, Carlos Cruz}
}

@Inbook { ,
   title = {Preface From the book: Amino Acids, Peptides and Proteins : Volume 38},
   year = {2013},
   volume = {38},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {5-6},
   web_url = {http://pubs.rsc.org/en/content/ebook/9781849735858\#!divbookcontent},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {RSC Publishing},
   address = {Cambridge},
   booktitle = {Amino Acids, Peptides and Proteins},
   language = {30},
   DOI = {10.1039/9781849737081-FP005},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Farkas, Etelka and Ryadnov, Maxim}
}

@Proceedings { ,
   title = {Characterization of Thin ZnO Films by Vacuum Ultra-Violet Reflectometry},
   journal = {Materials Research Society Proceedings},
   year = {2013},
   volume = {1494},
   number = {Symposium F - Oxide Semiconductors and Thin Films},
   number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films},
   pages = {65-70},
   keywords = {Zink oxide, vacuum ultra-violet reflectometry, spectroscopic ellipsometry, atomic layer deposition},
   web_url = {http://journals.cambridge.org/action/displayAbstract?fromPage=online\&aid=8800651\&fileId=S1946427412016776},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Cambridge Journals Online},
   address = {Cambridge},
   event_place = {Boston, Massachusetts},
   event_name = {2012 MRS Fall Meeting},
   event_date = {25-11-2012 to 30-11-2012},
   language = {30},
   ISSN = {1946-4274},
   DOI = {10.1557/opl.2012.1677 },
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Gumprecht, TG and Petrik, PP and Roeder, GR and Schellenberger, MS and Pfitzner, LP and Pollakowski, BP and Beckhoff, BB}
}

@Article { ,
   title = {Investigation of Material Effects With Micro-Sized SQUID Sensors},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2012},
   month = {12},
   day = {20},
   volume = {23},
   number = {3},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {1602004},
   keywords = {SQUID sensors, gradiometer, microSQUIDs, susceptometers},
   web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6389719\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fiel5\%2F77\%2F6366258\%2F06389719.pdf\%3Farnumber\%3D6389719},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {New York},
   language = {30},
   ISSN = {1051-8223},
   DOI = {10.1109/TASC.2012.2235505},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Bechstein, S and Kirste, A and Drung, D and Regin, M and Kazakova, O and Gallop, J and Hao, L and Cox, D and Schurig, T}
}

@Article { ,
   title = {Study of Low-Frequency Noise Performance of Nanobridge-Based SQUIDs in External Magnetic Fields},
   journal = {IEEE Transactions on Applied Superconductivity},
   year = {2012},
   month = {12},
   day = {11},
   volume = {23},
   number = {3},
   number2 = {NEW08: MetNEMS: Metrology with/for NEMS},
   pages = {1601004},
   keywords = {Magnetic field sensitivity, nanoscale superconducting quantum interference device (SQUID).},
   web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6378430},
   misc2 = {EMRP A169: Call 2011 Metrology for New Technologies},
   publisher = {IEEE},
   address = {New York},
   language = {30},
   ISSN = {1051-8223},
   DOI = {10.1109/TASC.2012.2233537},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Rozhko, S and Hino, T and Cox, D. C. and Hao, L and Gallop, J. C. and Romans, E. J. and Blois, A}
}

@Article { ,
   title = {Cleaning of mass standards: a comparison of new and old techniques},
   journal = {METROLOGIA},
   year = {2012},
   month = {12},
   volume = {49},
   number = {6},
   number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram},
   pages = {628-634},
   keywords = {LONG-TERM STABILITY; PHASE OXYGEN-ATOMS; PT(111) SURFACE; HIGH COVERAGES; OXIDATION; KILOGRAM; OZONE; ADSORPTION; PROTOTYPES; CONSTANT},
   web_url = {http://apps.webofknowledge.com/full_record.do?product=UA\&search_mode=GeneralSearch\&qid=1\&SID=S2qSJjgY3H9s2qO4QQi\&page=1\&doc=1},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   publisher = {IOP PUBLISHING LTD,},
   address = {BRISTOL, ENGLAND},
   language = {30},
   ISSN = {0026-1394},
   DOI = {10.1088/0026-1394/49/6/628},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Marti, KM and Fuchs, PF and Russi, SR}
}

@Article { ,
   title = {Reference measurement procedures for the iron saturation in human transferrin based on IDMS and Raman scattering},
   journal = {Metallomics},
   year = {2012},
   month = {11},
   day = {2},
   volume = {4},
   number = {12/2012},
   number2 = {HLT05: Metallomics: Metrology for metalloproteins},
   pages = {1239 - 1244},
   keywords = {iron saturation in human transferrin, molecular properties, isotope dilution, HPLC ICP-MS},
   web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2012/MT/c2mt20183f\#!divAbstract},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {RSC Publ.},
   address = {Cambridge, United Kingdom},
   language = {30},
   ISSN = {1756-5901 (print) ;  1756-591X (online)},
   DOI = {10.1039/c2mt20183f},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Frank, Claudia and Rienitz, Olaf and Jaehrling, Reinhard and Schiel, Detlef and Zakel, Sabine}
}

@Inbook { DeWerdRS2012,
   title = {Uncertainties associated with brachytherapy source calibrations and dose calculations.},
   year = {2012},
   month = {11},
   number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields},
   pages = {213-223},
   keywords = {Uncertainties, Brachytherapy, Dosimetry, Primary Standards},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   chapter = {15},
   booktitle = {Comprehensive brachytherapy : physical and clinical aspects ; (Imaging in medical diagnosis and therapy): (2013), Boca Raton, FL : CRC Press},
   language = {English},
   ISBN = {978-143-984-498-4 (print);  978-1-43-984-499-1  (online)},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {DeWerd, Larry A and Rivard, Mark J and Selbach, Hans-Joachim}
}

@Article { ,
   title = {Modeling of line roughness and its impact on the diffraction intensities and the reconstructed critical dimensions in scatterometry},
   journal = {APPLIED OPTICS},
   year = {2012},
   month = {10},
   day = {18},
   volume = {51},
   number = {30},
   number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices},
   pages = {7384 - 7394},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {30},
   DOI = {10.1364/AO.51.007384},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Gross, H. and Henn, M.-A. and Heidenreich, S. and Rathsfeld, A. and B{\"a}r, M.}
}

@Article { ,
   title = {Prescriptive peptide design},
   journal = {Amino Acids, Peptides and Proteins},
   year = {2012},
   month = {10},
   day = {10},
   volume = {37},
   number = {10.10.2012},
   number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease},
   pages = {190-237},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   publisher = {RSC Publishing},
   address = {Cambridge},
   language = {30},
   ISSN = {978-1-84973-406-6},
   DOI = {10.1039/9781849734677-00190},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Ryadnov, Maxim}
}

@Article { ,
   title = {Simultaneous remote transfer of accurate timing and optical frequency over a public fiber network},
   journal = {Applied Physics B},
   year = {2012},
   month = {10},
   day = {4},
   volume = {Lasers and Optics 110},
   number = {1 (2013) 3-6},
   number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks},
   web_url = {http://arxiv.org/abs/1209.4715},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   DOI = {10.1007/s00340-012-5241-0},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Lopez, O. and Kanj, A. and Pottie, P.-E. and Rovera, D. and Achkar, J. and Chardonnet, C. and Amy-Klein, A. and Santarelli, G.}
}

@Proceedings { RodriguezHigueroR2012,
   title = {C{\'a}lculo de Matrices de Covarianza en la Adquisici{\'o}n de Trazas de Osciloscopios Digitales (DSO y RTDO)},
   journal = {Proceedings of the XXVII National Symposium URSI 2012},
   year = {2012},
   month = {9},
   number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications},
   keywords = {Covariance matrix, DSO, RTDO, Cholesky decomposition, Jitter, Noise, FFT, Monte Carlo},
   web_url = {http://ursi.usc.es/articulos_modernos/2012_Elche/PDF-\%20Articulos\%20Autores/ursi2012elche_submission_27.pdf},
   misc2 = {EMRP A169: Call 2010 Industry},
   event_place = {Elche (Alicante), Spain},
   event_name = {XXVII Simposium Nacional de la Uni{\'o}n Cient{\'i}fica Internacional de Radio URSI 2012},
   event_date = {12 - 14 September 2012},
   language = {Spanish},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rodriguez Higuero, M. and Rodrigo G{\'o}mez, I.}
}

@Article { RicciardiDMMRDDZ2012,
   title = {A narrow-linewidth optical parametric oscillator for mid-infrared high-resolution spectroscopy},
   journal = {Molecular Physics},
   year = {2012},
   month = {9},
   volume = {110},
   number = {17},
   number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring},
   pages = {2103-2109},
   keywords = {optical parametric oscillator, frequency stabilization, sub-Doppler spectroscopy},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {Informa UK Limited},
   address = {New York, USA},
   language = {30},
   ISSN = {0026-8976, 1362-3028},
   DOI = {10.1080/00268976.2012.699640},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ricciardi, I. and De Tommasi, E. and Maddaloni, P. and Mosca, S. and Rocco, A. and De Rosa, M. and De Natale, P. and Zondy, J.-J.}
}

@Article { FrankRSS2012,
   title = {Improving species-specific IDMS: the advantages of triple IDMS},
   journal = {Analytical and Bioanalytical Chemistry},
   year = {2012},
   month = {8},
   day = {15},
   volume = {405},
   number = {6},
   number2 = {HLT05: Metallomics: Metrology for metalloproteins},
   pages = {1913 to 1919},
   keywords = {Transferrin. Species-specific IDMS. Triple IDMS. Human serum.},
   web_url = {http://link.springer.com/article/10.1007/s00216-012-6315-x},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   ISSN = {1618-2642},
   DOI = {10.1007/s00216-012-6315-x},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Frank, Claudia and Rienitz, Olaf and Swart, Claudia and Schiel, Detlef}
}

@Article { MaineultDGRR,
   title = {Spin Waves and Collisional Frequency Shifts of a Trapped-Atom Clock},
   journal = {Physical Review Letters},
   year = {2012},
   month = {7},
   day = {13},
   volume = {109},
   number = {2},
   number2 = {IND14: Frequency: New generation of frequency standards for industry},
   keywords = {collisional frequency shift},
   web_url = {http://link.aps.org/doi/10.1103/PhysRevLett.109.020407},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {30},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Maineult, Wilfried and Deutsch, Christian and Gibble, Kurt and Reichel, Jakob and Rosenbusch, Peter}
}

@Article { ,
   title = {Spin Waves and Collisional Frequency Shifts in a Trapped-Atom ClockSpin Waves and Collisional Frequency Shifts in a Trapped-Atom Clock},
   journal = {Spin Waves and Collisional Frequency Shifts in a Trapped-Atom Clock},
   year = {2012},
   month = {7},
   day = {13},
   volume = {109},
   number = {2},
   number2 = {IND14: Frequency: New generation of frequency standards for industry},
   web_url = {http://journals.aps.org/prl/abstract/10.1103/PhysRevLett.109.020407},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {30},
   ISSN = {0031-9007},
   DOI = {10.1103/PhysRevLett.109.020407},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Maineult, W and Deutsch, C and Gibble, K and Reichel, J and Rosenbusch, P}
}

@Article { DeTommasiRMZMRDD2012,
   title = {Frequency-comb-referenced singly-resonant OPO for sub-Doppler spectroscopy},
   journal = {Optics Express},
   year = {2012},
   month = {4},
   volume = {20},
   number = {8},
   number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring},
   pages = {9178-9186},
   keywords = {optical parametric oscillator, frequency stabilization, absolute frequency},
   misc2 = {EMRP A169: Call 2010 Environment},
   publisher = {The Optical Society},
   address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States},
   language = {30},
   ISSN = {1094-4087},
   DOI = {10.1364/OE.20.009178},
   stag_bib_extends_levelofaccess = {NA},
   author = {De Tommasi, E. and Ricciardi, I. and Maddaloni, P. and Zondy, J.-J. and Mosca, S. and Rocco, A. and De Rosa, M. and De Natale, P.}
}

@Article { ,
   title = {Development of Infrared Microscopy for Measuring Asperity Contact Temperatures},
   journal = {Journal of Tribology},
   year = {2012},
   month = {3},
   day = {18},
   volume = {135},
   number = {2},
   number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces},
   pages = {1-9},
   keywords = {Temperature , Resolution (Optics) , Disks , Calibration , Radiation (Physics)},
   web_url = {http://tribology.asmedigitalcollection.asme.org/article.aspx?articleid=1671789},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {American Society of Mechanical Engineers (ASME)},
   language = {30},
   ISSN = {0742-4787},
   DOI = {10.1115/1.4023148},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Le Rouzic, JLR and Reddyhoff, TR}
}

@Article { LiebingSRRLOS2012,
   title = {Determination of spin-dependent Seebeck coefficients of CoFeB/MgO/CoFeB magnetic tunnel junction nanopillars},
   journal = {Journal of Applied Physics},
   year = {2012},
   month = {3},
   volume = {111},
   number = {7},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   DOI = {10.1063/1.3679769},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Liebing, N. and Serrano-Guisan, S. and Rott, K. and Reiss, G. and Langer, J. and Ocker, B. and Schumacher, H.}
}

@Proceedings { HoutzagerRHEv2012,
   title = {Selection and characterization of resistors for a HVDC reference divider},
   journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2012},
   year = {2012},
   day = {1},
   number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current},
   keywords = {HVDC, resistors, metrology, voltage coefficient, temperature coefficient, high-voltage techniques, resistance measurement},
   misc2 = {EMRP A169: Call 2009 Energy},
   publisher = {IEEE},
   event_place = {Washington DC, USA},
   event_name = {CPEM 2012},
   event_date = {01 - 06 July 2012},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Houtzager, E. and Rietveldt, G. and H{\"a}llstr{\"o}m, J. and Elg, A.-P. and van der Beek, J. H. N.}
}

@Article { HauswaldtRJFSLM2012,
   title = {Uncertainty of standard addition experiments: a novel approach to include the uncertainty associated with the standard in the model equation},
   journal = {Accreditation and Quality Assurance},
   year = {2012},
   volume = {17},
   number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry},
   pages = {129-138},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   DOI = {10.1007/s00769-011-0827-5},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hauswaldt, A.-L. and Rienitz, O. and J{\"a}hrling, R. and Fischer, N. and Schiel, D. and Labarraque, G, and Magnusson, B.}
}

@Proceedings { ZhaoR2012,
   title = {The Influence of Source Impedance in Electrical Characterization of Solid State Lighting Sources},
   journal = {Proceedings of CPEM 2012: Conference on Precision Electromagnetic Measurements},
   year = {2012},
   number2 = {ENG05: Lighting: Metrology for Solid State Lighting},
   web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6250921},
   misc2 = {EMRP A169: Call 2009 Energy},
   event_place = {Washington, DC, USA},
   event_name = {CPEM 2012: Conference on Precision Electromagnetic Measurements},
   event_date = {1 - 6 July 2012},
   language = {English},
   ISSN = {0589-1485},
   DOI = {10.1109/CPEM.2012.6250921},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhao, D. and Rietveld, G.}
}

@Proceedings { RossiZIR2012,
   title = {Pupil Size under Different Lighting Sources},
   journal = {Proceedings of CIE 2012 'Lighting Quality and Energy Efficiency'},
   year = {2012},
   number2 = {ENG05: Lighting: Metrology for Solid State Lighting},
   keywords = {Pupil size, pupillometry, photobiological effects of light, LED},
   misc2 = {EMRP A169: Call 2009 Energy},
   event_place = {Hangzhou, China},
   event_name = {CIE 2012: 'Lighting Quality and Energy Efficiency},
   event_date = {19 - 21 September 2012},
   language = {English},
   ISBN = {978-3-902842-42-8},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rossi, L. and Zegna, L. and Iacomussi, P. and Rossi, G.}
}

@Proceedings { RenouxNS2012,
   title = {Contribution to the assessment and improvement of Colour RenderingMetrics for artificial light sources},
   journal = {Proceedings of CIE 2012 'Lighting Quality and Energy Efficiency'},
   year = {2012},
   number2 = {ENG05: Lighting: Metrology for Solid State Lighting},
   keywords = {Colour Rendering, LED lighting, colour quality index, colour metric, colorimetry},
   misc2 = {EMRP A169: Call 2009 Energy},
   event_place = {Hangzhou, China},
   event_name = {CIE 2012: 'Lighting Quality and Energy Efficiency},
   event_date = {19 - 21 September 2012},
   language = {English},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Renoux, D. and Nonne, J. and Sabol, D.}
}

@Proceedings { OlschewskiRSKPEMGHPFK2012,
   title = {In-flight blackbody calibration sources for the GLORIA interferometer},
   journal = {Proceedings of SPIE 8511 - Infrared Remote Sensing and Instrumentation XX, 85110I},
   year = {2012},
   number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate},
   keywords = {GLORIA, remote sensing, blackbody, calibration, infrared, limb sounder, thermoelectric cooler, ITS-90},
   web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1387106},
   misc2 = {EMRP A169: Call 2010 Environment},
   event_place = {San Diego, CA, United States},
   event_name = {SPIE 8511 Infrared Remote Sensing and Instrumentation XX},
   event_date = {12 - 16 August 2012},
   language = {English},
   DOI = {10.1117/12.928194},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Olschewski, F. and Rolf, C. and Steffens, P. and Kleinert, A. and Piesch, C. and Ebersoldt, A. and Monte, C. and Gutschwager, B. and Hollandt, J. and Preusse, P. and Friedl-Vallon, F. and Koppmann, R.}
}

@Article { LopezBRVSS2012,
   title = {LED near-field goniophotometer at PTB},
   journal = {Metrologia},
   year = {2012},
   volume = {49},
   number = {2},
   number2 = {ENG05: Lighting: Metrology for Solid State Lighting},
   web_url = {http://iopscience.iop.org/0026-1394/49/2/S141},
   misc2 = {EMRP A169: Call 2009 Energy},
   language = {English},
   ISSN = {ISSN 0026-1394},
   DOI = {10.1088/0026-1394/49/2/S141},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {L{\'o}pez, M. and Bredemeier, K. and Rohrbeck, N. and V{\'e}ron, C. and Schmidt, F. and Sperling, A.}
}

@Article { VillamarinFPCRHVC2012,
   title = {Distribuci{\'o}n angular de la intensidad radiante espectral de LEDs blancos de alta luminosidad -  Angular and spectral radiant intensity distribution of high brightness white LEDS},
   journal = {Optica Pura y Aplicada},
   year = {2012},
   volume = {45},
   number = {2},
   number2 = {ENG05: Lighting: Metrology for Solid State Lighting},
   pages = {131-136},
   keywords = {LEDs, Gonio‐Spectro‐Photometer, Luminous Intensity, LED Angular Distribution, LED Emission, Spectral Distribution, High Brightness, White LEDs},
   web_url = {http://www.scopus.com/inward/record.url?eid=2-s2.0-84871420576\&partnerID=65\&md5=a928625cebaaaba8080da7225160b9ff},
   misc2 = {EMRP A169: Call 2009 Energy},
   language = {Spanish},
   ISSN = {2171-8814},
   DOI = {10.7149/OPA.45.2.131},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Villamarin, A. and Ferrero, A. and Pons, A. and Campos, J. and Rabal, A. and Hernanz, M. and Vel{\'a}squez, J. and Corrons, A.}
}

@Article { ZibordiRAMKIR2012,
   title = {In situ determination of the remote sensing reflectance: an inter-comparison},
   journal = {Ocean Science},
   year = {2012},
   volume = {8},
   number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate},
   pages = {567-586},
   misc2 = {EMRP A169: Call 2010 Environment},
   language = {English},
   DOI = {10.5194/os-8-567-2012},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zibordi, G. and Ruddick, K. and Ansko, I. and Moore, G. and Kratzer, S. and Icely, J. and Reinart, A.}
}

@Proceedings { FluggeBJMPRSSSVV2012,
   title = {The EMRP Project ''Thermal design and dimensional drift''},
   year = {2012},
   number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   event_place = {Stockholm, Sweden},
   event_name = {Proceedings of the 12th euspen International Conference},
   event_date = {June 2012},
   ISBN = {978-0-9566790-0-0},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Fl{\"u}gge, J. and Beckert, E. and Jennett, N. and Maxwell, T. and Petit, D. and Rudtsch, S. and Salgado, J. and Schalles, M. and Sch{\"o}del, R. and Voigt, D. and Voigt, M.}
}

@Article { ZikmundR2012,
   title = {Uncertainty analysis of calibration of the 3D coil system},
   journal = {Journal of Electrical Engineering},
   year = {2012},
   volume = {63},
   number = {7},
   number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics},
   pages = {90-93},
   keywords = {calibration,uncertainty},
   web_url = {http://iris.elf.stuba.sk/JEEEC/data/pdf/7s_112-4.pdf},
   misc2 = {EMRP A169: Call 2010 Industry},
   language = {English},
   ISSN = {ISSN 1335-3632},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zikmund, A. and Ripka, P.}
}

@Proceedings { GraesslRHFPHKMN,
   title = {Design, Evaluation and Application of a Modular 32 Channel Transmit/Receive Surface Coil Array for Cardiac MRI at 7T},
   journal = {Proc. Intl. Soc. Mag. Reson. Med.},
   year = {2012},
   volume = {20},
   number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI},
   web_url = {http://www.ismrm.org/12/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   event_place = {Melbourne, Australia},
   event_name = {ISMRM 20th Annual Meeting and Exhibition},
   event_date = {5-11 May 2012},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Graessl, Andreas and Renz, Wolfgang and Hezel, Fabian and Frauenrath, Tobias and Pfeiffer, Harald and Hoffmann, Werner and Kellmann, Peter and Martin, Conrad and Niendorf, Thorals}
}

@Proceedings { WinterOHWSMLRMSIN,
   title = {Design and Evaluation of an Eight Channel TX/RX Hybrid Applicator for Imaging and Targeted RF-Heating at 7.0 T},
   journal = {Proc. Intl. Soc. Mag. Reson. Med.},
   year = {2012},
   volume = {20},
   number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI},
   web_url = {http://www.ismrm.org/12/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   event_place = {Melbourne, Australia},
   event_name = {ISMRM 20th Annual Meeting and Exhibition},
   event_date = {5-11 May 2012},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Winter, Lukas and {\"O}zerdem, Celal and Hoffmann, Werner and Waiczies, Helmar and Santoro, Davide and M{\"u}ller, Alexander and Lindel, Tomasz and Renz, Wolfgang and Martin, Conrad and Seifert, Frank and Ittermann, Bernd and Niendorf, Thoralf}
}

@Proceedings { DawidLindelGWDSFRAFSNI,
   title = {Cardiac CINE MRI at 7 T using a transmit array},
   journal = {Proc. Intl. Soc. Mag. Reson. Med.},
   year = {2012},
   volume = {20},
   number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI},
   web_url = {http://www.ismrm.org/12/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   event_place = {Melbourne, Australia},
   event_name = {ISMRM 20th Annual Meeting and Exhibition},
   event_date = {5-11 May 2012},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Dawid Lindel, Tomasz and Greiser, Andreas and Waxmann, Patrick and Dietterle, Martin and Seifert, Frank and Fontius, Ulrich and Renz, Wolfgang and Alexander Dieringer, Matthias and Frauenrath, Tobias and Schulz-Menger, Jeanette and Niendorf, Thoralf and Ittermann, Bernd}
}

@Article { KipphardtSSGFDBMBRV2012,
   title = {Primary Standards for Challenging Elements - Joint Research Project EMRP-SIB09},
   journal = {Metrologie Revue},
   year = {2012},
   volume = {59},
   number = {3/4},
   number2 = {SIB09: ELEMENTS: Primary standards for challenging elements},
   keywords = {Primary standard, elemental calibration solutions, metrology in chemistry, traceability.},
   web_url = {http://www.inm.ro/pdf/2012-3-4-03-etaloane-primare.pdf},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kipphardt, H. and Schiel, D. and Sargent, M. and Goenaga-Infante, H. and Fisicaro, P. and D’Agostino, G. and Bergamasch, L. and M{\'a}ri{\'a}ssy, M. and Buzoianu, M. and Richter, S. and Vogl, J.}
}

@Proceedings { KuehneWRSI,
   title = {Reliable FDTD simulation convergence detection and acceleration},
   journal = {Proc. Intl. Soc. Mag. Reson. Med.},
   year = {2012},
   volume = {20},
   number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI},
   web_url = {http://www.ismrm.org/12/},
   misc = {A169},
   misc2 = {EMRP A169: Call 2011 Metrology for Health},
   event_place = {Melbourne, Australia},
   event_name = {ISMRM 20th Annual Meeting and Exhibition},
   event_date = {5-11 May 2012},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kuehne, Andre and Waiczies, Helmar and Rudorf, Enrico and Seifert, Frank and Ittermann, Bernd}
}

@Article { DEUTSCHRLMRSFPLRR2012,
   title = {Effet favorable des interactions atomiques sur le temps de coh{\'e}rence des horloges {\`a} atomes pi{\'e}g{\'e}s},
   journal = {REVUE FRAN\c{C}AISE DE M{\'E}TROLOGIE},
   year = {2012},
   number = {29},
   number2 = {IND14: Frequency: New generation of frequency standards for industry},
   keywords = {FREQUENCY METROLOGY, COLD ATOMS, TRAPPED ATOMS, ATOM CHIPS, COLD COLLISIONS, IDENTITAL SPIN ROTATION EFFECT},
   web_url = {http://www.metrologie-francaise.fr/publications/revue_francaise_metrologie/2012-01/RFM29-1204-deutsch.pdf},
   misc = {A169},
   misc2 = {EMRP A169: Call 2010 Industry},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {DEUTSCH, Christian and RAMIREZ-MARTINEZ, Fernando and LACRO{\^U}TE, Cl{\'e}ment and MAINEULT, Wilfried and REINHARD, Friedemann and SCHNEIDER, Tobias and FUCHS, Jean-No{\"e}l and PI{\'E}CHON, Fr{\'e}d{\'e}ric and LALO{\"E}, Franck and REICHEL, Jakob and ROSENBUSCH, Peter}
}

@Article { ,
   title = {Investigation of the Ice-Water Vapour Equilibrium along the Sublimation Line},
   journal = {Int. J. Thermophysics},
   year = {2012},
   volume = {33},
   number = {8-9},
   number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere},
   pages = {1363-1437},
   keywords = {ce–water vapor equilibrium, Ice sublimation curve, Saturation vapor pressure, Static measurements method, Water properties},
   misc2 = {EMRP A169: Call 2010 Environment},
   language = {30},
   ISSN = {0195-928X},
   DOI = {10.1007/s10765-011-1128-2},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Fernicola, V. and Rosso, L. and Banfo, M. and Giovannini, M.}
}

@Article { ,
   title = {ILITS Experiment at TANDEM-ALPI accelerator},
   journal = {LNL Annual Report 2012, INFN-LNL-Report},
   year = {2012},
   volume = {239},
   number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy},
   keywords = {Ion beam dosimetry, nanodosimetry, track structure},
   web_url = {www.lnl.infn.it/\verb=~=annrep/read_ar/2012/contributions/pdfs/178_D_51_D025.pdf},
   misc2 = {EMRP A169: Call 2011 SI Broader Scope},
   language = {30},
   ISSN = {1828-8561},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Moro, D. and Colautti, P. and Conte, V. and Hilgers, G. and Pausewang, A. and Helms, W. and Lambertsen, B. and Rabus, H.}
}

@Proceedings { ,
   title = {Dynamic Bridge Standard for Strain Gauge Bridge Amplifier Calibration},
   journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2012},
   year = {2012},
   number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities},
   pages = {568-569},
   keywords = {Dynamic bridge standard system, strain gauge bride amplifiers, electrical measurements of mechanical quantities},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {IEEE},
   event_place = {Washington DC, USA},
   event_name = {Conference on Precision Electromagnetic Measurements},
   event_date = {01-07-2012 to 06-07-2012},
   language = {30},
   ISBN = {978-1-4673-0441-2},
   ISSN = {ISSN 978-1-4673-0439-9},
   DOI = {10.1109/CPEM.2012.6251056},
   extern = {1},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.},
   author = {Beug, M. F. and Moser, H. and Ramm, G.}
}

@Article { ,
   title = {An Investigation of Scratch Testing of Silicone Elastomer Coatings with a Thickness Gradient},
   journal = {Journal of Applied Polymer Science},
   year = {2011},
   month = {11},
   day = {3},
   volume = {124},
   number = {4},
   number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials},
   pages = {2978–2986},
   keywords = {adhesion, coatings, elastomers, silicones, failure},
   web_url = {http://onlinelibrary.wiley.com/doi/10.1002/app.35325/full},
   misc2 = {EMRP A169: Call 2010 Industry},
   publisher = {Wiley},
   address = {London},
   language = {30},
   ISSN = {0021-8995},
   DOI = {10.1002/app.35325},
   extern = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.},
   author = {Kohl, JGK and Randall, NXR and Schwarzer, NS and Ngo, TTN and Shockley, JMS and Nair, RPN}
}

@Article { LiebingSRRLOS2011,
   title = {Tunneling magnetothermopower in magnetic tunnel junction nanopillars},
   journal = {Physical Review Letters},
   year = {2011},
   month = {10},
   volume = {107},
   number = {177201},
   number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   language = {English},
   DOI = {10.1103/PhysRevLett.107.177201},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Liebing, N. and Serrano-Guisan, S. and Rott, K. and Reiss, G. and Langer, J. and Ocker, B. and Schumacher, H. W.}
}

@Article { PramannRSGV2011,
   title = {Novel concept for the mass spectrometric determination of absolute isotopic abundances with improved measurement uncertainty: Part 3—Molar mass of silicon highly enriched in 28Si},
   journal = {International Journal of Mass Spectrometry},
   year = {2011},
   month = {8},
   day = {1},
   volume = {305},
   number = {1},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   keywords = {Molar mass, Silicon, MC-ICP-MS, Isotope dilution mass spectrometry, Measurement uncertainty, Avogadro constant},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pramann, A. and Rienitz, O. and Schiel, D. and Guettler, B. and Valkiers, S.}
}

@Article { SerranoGuisanSWLCSRS2011,
   title = {Inductive determination of the optimum tunnel barrier thickness in magnetic tunneling junction stacks for spin torque memory applications},
   journal = {Journal of Applied Physics},
   year = {2011},
   month = {7},
   day = {28},
   volume = {110},
   number = {2},
   number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics},
   pages = {023906},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   language = {English},
   DOI = {10.1063/1.3610948},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Serrano-Guisan, S. and Skowronski, W. and Wrona, J. and Liebing, N. and Czapkiewicz, M. and Stobiecki, T. and Reiss, G. and Schumacher, H. W.}
}

@Article { ZhaoRT2011,
   title = {A Multistep Approach for Accurate Permittivity Measurements of Liquids Using a Transmission Line Method},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2011},
   month = {7},
   volume = {60},
   number = {7},
   number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive},
   pages = {2267-2274},
   keywords = {Curve fitting , mean square parameter methods , permittivity measurement , scattering parameter , specific absorption rate (SAR) , transmission line theory , vector network analyzer (VNA)},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhao, Dongsheng and Rietveld, Gert and Teunisse, George M.}
}

@Article { RietveldZKHKdL2011,
   title = {Characterization of a Wideband Digitizer for Power Measurements uo to 1 MHz},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2011},
   month = {7},
   volume = {60},
   number = {7},
   number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques},
   pages = {2195-2201},
   keywords = {Digital filters, Digital–analog conversion, digitizer, frequency response, phase measurement, power measurement, wideband power},
   tags = {SEG},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, Gert and Zhao, Dongsheng and Kramer, Charlotte and Houtzager, Ernest and Kristensen, Orla and de Leffe, Cyrille and Lippert, Torsten}
}

@Article { RietveldvH2011,
   title = {DC Characterization of AC Current Shunts for Wideband Power Applications},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2011},
   month = {7},
   volume = {60},
   number = {7},
   number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques},
   pages = {2191-2194},
   keywords = {Current shunts , current , environmental factors , measurement standards , power coefficient , power measurements , stability , temperature coefficient},
   tags = {SEG},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, Gert and van der Beek, J.H.N. and Houtzager, Ernest}
}

@Article { BoscoGLPRTVN2011,
   title = {Phase Comparison of High-Current Shunts uo to 100 kHz},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2011},
   month = {7},
   volume = {60},
   number = {7},
   number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques},
   pages = {2359-2365},
   tags = {SEG},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bosco, Gian Carlo and Garcocz, Martin and Lind, Kare and Pogliano, Umberto and Rietveld, Gert and Tarasso, Valter and Voljc, Bostjan and Novakova Zachovalova, Vera}
}

@Article { LolliBDGMPPRRTT2011,
   title = {Ti/Au TES as superconducting detector for quantum technologies},
   year = {2011},
   month = {6},
   volume = {9},
   number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards},
   pages = {405-413},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lolli, L. and Brida, G. and Degiovanni, I. P. and Gramegna, M. and Monticone, E. and Piacentini, F. and Portesi, C. and Rajteri, M. and Ruo Berchera, I. and Taralli, E. and Traina, P.}
}

@Article { AndrieuxZCRZ2011,
   title = {500 GHz mode-hop-free idler tuning range with a frequency-stabilized singly resonant optical parametric oscillator},
   journal = {Optics Letters},
   year = {2011},
   month = {4},
   day = {1},
   volume = {36},
   number = {7},
   number2 = {T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection},
   pages = {1212-1214},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Andrieux, E. and Zanon, Thomas and Cadoret, Malo and Rihan, Abdallah and Zondy, Jean-Jacques}
}

@Article { AndreasABBBBBFFFKKKMNPPRSVWZ2011,
   title = {Counting the atoms in a 28Si crystal for a new kilogram definition},
   journal = {Metrologia},
   year = {2011},
   month = {3},
   day = {22},
   volume = {48},
   number = {2},
   number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram},
   keywords = {Avogadro constant, kilogram redefinition, silicon, XRCD method},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1088/0026-1394/48/2/S01},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Andreas, B. and Azuma, Y. and Bartl, G. and Becker, P. and Bettin, H. and Borys, M. and Busch, I. and Fuchs, P. and Fujii, K. and Fujimoto, H. and Kessler, E. and Krumrey, M. and Kuetgens, U. and Mizushima, N. and Nicolaus, A. and Picard, A. and Pramann, A. and Rienitz, O. and Schiel, D. and Valkiers, S. and Waseda, A. and Zakel, S.}
}

@Article { PramannRSSGV2011,
   title = {Molar mass of silicon highly enriched in 28Si determined by IDMS},
   journal = {Metrologia},
   year = {2011},
   month = {3},
   day = {22},
   volume = {48},
   number = {2},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   keywords = {Molar mass, Silicon, Isotope dilution mass spectrometry},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1088/0026-1394/48/2/S03},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pramann, A. and Rienitz, O. and Schiel, D. and Schlote, J. and Guettler, B. and Valkiers, S.}
}

@Article { BulskaDMPRSV2011,
   title = {The isotopic composition of enriched Si: a data analysis},
   journal = {Metrologia},
   year = {2011},
   month = {3},
   day = {22},
   volume = {48},
   number = {2},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   keywords = {Molar mass, Silicon, isotopic composition, gas mass spectrometry, MC-ICP-MS},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1088/0026-1394/48/2/S05},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bulska, E. and Drozdov, M. N. and Mana, G. and Pramann, A. and Rienitz, O. and Sennikov, P. and Valkiers, S.}
}

@Article { HaoAGCRKJDS2011,
   title = {Detection of single magnetic nanobead with a nano-superconducting quantum interference device},
   journal = {Applied Physics Letters},
   year = {2011},
   month = {2},
   day = {28},
   volume = {98},
   number = {9},
   number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics},
   note = {No pdf received},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   language = {English},
   DOI = {10.1063/1.3561743},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hao, L. and Assmann, C. and Gallop, J. C. and Cox, D. and Ruede, F. and Kazakova, O. and Josephs-Franks, P. and Drung, D. and Schurig, Th.}
}

@Proceedings { McCarthyBER2011,
   title = {NPL freeform artefact for verification of non-contact measuring systems},
   journal = {SPIE Proceedings of 23rd Annual Symposium of Electronic Imaging},
   year = {2011},
   month = {2},
   volume = {7864},
   number = {78640K},
   number2 = {T3.J2.2: NIMTech: Metrology for New Industrial Measurement Technologies},
   web_url = {http://spiedigitallibrary.org/proceedings/resource/2/psisdg/7864/1/78640K_1?isAuthorized=no},
   misc2 = {iMERA-Plus: Call 2007 Length},
   event_place = {San Francisco, CA, USA},
   event_name = {SPIE 23rd Annual Symposium of Electronic Imaging},
   event_date = {23  - 27 January  2011},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {McCarthy, M. and Brown, S. and Evenden, A. and Robinson, A.}
}

@Article { AndreasABBBBBGFFFKKKKMMMMNPPRSVW2011,
   title = {Determination of the Avogadro Constant by Counting the Atoms in a 28Si Crystal},
   journal = {Physical Review Letters},
   year = {2011},
   month = {1},
   day = {21},
   volume = {106},
   number = {3},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   keywords = {Avogadro constant, kilogram redefinition, silicon, XRCD method},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Andreas, B. and Azuma, Y. and Bartl, G. and Becker, P. and Bettin, H. and Borys, M. and Busch, I. and Gray, M. and Fuchs, P. and Fujii, K. and Fujimoto, H. and Kessler, E. and Krumrey, M. and Kuetgens, U. and Kuramoto, N. and Mana, G. and Manson, P. and Massa, E. and Mizushima, S. and Nicolaus, A. and Picard, A. and Pramann, A. and Rienitz, O. and Schiel, D. and Valkiers, S. and Waseda, A.}
}

@Article { SwartRS2011,
   title = {Alternative approach to post column online isotope dilution ICP-MS},
   journal = {Talanta},
   year = {2011},
   volume = {83},
   number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry},
   pages = {1544-1551},
   keywords = {Online double IDMS, mass flow, species analysis, species specific reference},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Swart, Claudia and Rienitz, Olaf and Schiel, Detlef}
}

@Article { ZakelWNRS2011,
   title = {Infrared spectrometric measurement of impurities in highly enriched ‘Si28’},
   journal = {Metrologia},
   year = {2011},
   volume = {48},
   number = {2},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   keywords = {Infrared spectrometric measurement, Silicon, Avogadro constant},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1088/0026-1394/48/2/S02},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zakel, S. and Wundrack, S. and Niemann, H. and Rienitz, O. and Schiel, D.}
}

@Article { PramannRSG2011,
   title = {Novel concept for the mass spectrometric determination of absolute isotopic abundances with improved measurement uncertainty: Part 2 – Development of an experimental procedure for the determination of the molar mass of silicon using MC-ICP-MS},
   journal = {International Journal of Mass Spectrometry},
   year = {2011},
   volume = {299},
   number = {2-3},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   pages = {78-86},
   keywords = {Molar mass, Silicon, MC-ICP-MS, Isotope dilution mass spectrometry, Measurement uncertainty},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pramann, A. and Rienitz, O. and Schiel, D. and Guettler, B.}
}

@Proceedings { ZhaoRTM2011,
   title = {Accurate Permittivity Measurements of Liquids using a vertical TEM cell with Variable Fluid Level},
   journal = {Proceedings of the 10th International Conference of the European Bioelectromagnetic Association, EBEA 2011},
   year = {2011},
   number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive},
   misc2 = {iMERA-Plus: Call 2007 Length},
   event_place = {Rome, Italy},
   event_name = {10th International Conference of the European Bioelectromagnetic Association, EBEA 2011},
   event_date = {21 - 24 February 2011},
   language = {English},
   ISSN = {978-88-8286-231-2},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zhao, D. and Rietveld, G. and Teunisse, G. and Mubarak, F.}
}

@Proceedings { WrightR2011,
   title = {The Next Generation of Power and Energy Measuring Techniques - the iMERA-+ ''Power and Energy Project''},
   journal = {M{\'e}trologie 2009 Conference Proceedings},
   year = {2011},
   number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   event_place = {Paris},
   event_name = {International Metrology Congress},
   event_date = {22 - 25 June 2009},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wright, P.S. and Rietveld, Gert}
}

@Article { RebaneHL2011,
   title = {Analysis of selenomethylselenocysteine and selenomethionine by LC-ESI-MS/MS with diethyl ethoxymethylenemalonate derivatization},
   journal = {Analyst},
   year = {2011},
   number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   DOI = {10.1039/C0AN01031F},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rebane, Riin and Herodes, Koit and Leito, Ivo}
}

@Proceedings { BrunaMDR2011,
   title = {A Novel Method for Voltage Event Characterization},
   journal = {Proceedings 15th International Congress of Metrology},
   year = {2011},
   number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques},
   keywords = {Wavelet, Digital Filter, Voltage Events, Matlab, Dip, Swell, Interruption},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   event_place = {Paris},
   event_name = {15th International Congress of Metrology},
   event_date = {3 - 6 October 2011},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bruna, J. and Melero, J. J. and Diaz de Aguilar, J. and Romero, M. L.}
}

@Article { JeanneretROvH2011,
   title = {High precision comparison between a programmable and a pulse-driven Josephson voltage standard},
   journal = {Metrologia},
   year = {2011},
   volume = {48},
   number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications},
   pages = {311-316},
   note = {Only available as publisher's version.},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   language = {English},
   DOI = {10.1088/0026-1394/48/5/011},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jeanneret, B. and Ruefenacht, A. and Overney, F. and van den Brom, H. and Houtzager, E.}
}

@Article { KaraboceGRS2011,
   title = {Instantaneous input electrical power measurements of HIFU transducer},
   journal = {Journal of Physics: Conference Series},
   year = {2011},
   volume = {279},
   number = {012011},
   number2 = {T2.J07: EBCT: External Beam Cancer Therapy},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Karab{\"o}ce, B. and G{\"u}lmez, Y, and Rajagapol, S. and Shaw, A.}
}

@Article { JenderkaDKRS2011,
   title = {Interlaboratory comparison of HITU power measurement capabilities},
   journal = {Journal of Physics: Conference Series},
   year = {2011},
   volume = {279},
   number = {012015},
   number2 = {T2.J07: EBCT: External Beam Cancer Therapy},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jenderka, K.-V. and Durando, G. and Karab{\"o}ce, B. and Rajagopal, S. and Shaw, A.}
}

@Article { PitreSTGRH2011,
   title = {Measurement of the Boltzmann Constant kB Using a Quasi-Spherical Acoustic Resonator},
   journal = {International Journal of Thermophysics},
   year = {2011},
   volume = {32},
   number = {9},
   number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin},
   pages = {1825-1886},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1007/s10765-011-1023-x},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pitre, L. and Sparasci, F. and Truong, D. and Guillou, A. and Risegari, L. and Himbert, M. E.}
}

@Article { NwabohDRSW2011,
   title = {Molecular Laser Spectroscopy as a Tool for Gas Analysis Applications},
   journal = {International Journal of Spectroscopy},
   year = {2011},
   number2 = {T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection},
   pages = {12 pages},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   DOI = {10.1155/2011/568913},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Nwaboh, Javis A. and Desbois, Thibault and Romanini, Daniele and Schiel, Detlef and Werhahn, Olav}
}

@Proceedings { RossiSRAI2011,
   title = {MEASURING MAN AND SOFT METROLOGY: INFLUENCE OF VISUAL AND AUDITORY DISTURBING FACTORS ON CONTRAST DETECTION},
   journal = {Proceedings of the 15th International Congress of Metrology},
   year = {2011},
   number2 = {ENG05: Lighting: Metrology for Solid State Lighting},
   misc2 = {EMRP A169: Call 2009 Energy},
   event_place = {Paris, France},
   event_name = {15th International Congress of Metrology},
   event_date = {3 - 6 October 2011},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rossi, L. and Schiavi, A. and Rossi, G. and Astolfi, A. and Iacomussi, P.}
}

@Article { CerasoliRHRBVR2010,
   title = {MiS-MALDI: Microgel-Selected on-probe detection of protein biomarkers by MALDI-ToF mass spectrometry},
   journal = {Molecular BioSystems},
   year = {2010},
   month = {8},
   day = {23},
   volume = {6},
   number = {11},
   number2 = {T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine},
   pages = {2214-2217},
   misc2 = {iMERA-Plus: Call 2007 Health},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Cerasoli, E. and Rakowska, P. D. and Horgan, A. and Ravi, J. and Bradley, M. and Vincent, B. and Ryadnov, M.}
}

@Article { RzychonZS2010,
   title = {Analysis of the Physicochemical State of C-Reactive Protein in Different Preparations Including 2 Certified Reference Materials},
   journal = {Clinical Chemistry},
   year = {2010},
   month = {7},
   day = {12},
   volume = {56},
   number = {9},
   number2 = {T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine},
   pages = {1475-1482},
   keywords = {CRP, reference material, ERM-DA470, ERM-DA470k/IFCC},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rzychon, M. and Zegers, I. and Schimmel, H.}
}

@Article { ManaRP2010,
   title = {Measurement equations for the determination of the Si molar mass by isotope dilution mass spectrometry},
   journal = {Metrologia},
   year = {2010},
   month = {6},
   day = {28},
   volume = {47},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   pages = {460-463},
   keywords = {Si molar mass; metrology, isotopic composition; isotopic abundance; atomic weight},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1088/0026-1394/47/4/012},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mana, G. and Rienitz, O. and Pramann, A.}
}

@Article { KuepferlingSPRWIKPK2010,
   title = {Two modes behavior of vortex oscillations in spin-transfer nanocontacts subject to in-plane magnetic fields},
   journal = {Applied Physics Letters},
   year = {2010},
   month = {6},
   day = {25},
   volume = {96},
   number = {25},
   number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics},
   pages = {252507},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   language = {English},
   DOI = {10.1063/1.3455883},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kuepferling, M. and Serpico, C. and Pufall, M. and Rippard, W. and Wallis, M. and Imtiaz, A. and Krivosik, P. and Pasquale, M. and Kabos, P.}
}

@Proceedings { BergmanPHWLKMRR2010,
   title = {Metrology for high voltage direct current},
   journal = {CPEM 2010},
   year = {2010},
   month = {6},
   number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current},
   keywords = {Metrology,  Voltage,  HVDC transmission,  Pollution measurement,  Propagation losses,  Loss measurement,  Power harmonic filters,  Power measurement,  Power quality,  Renewable energy resources},
   misc2 = {EMRP A169: Call 2009 Energy},
   publisher = {IEEE},
   event_place = {Daejeon, South Korea},
   event_name = {CPEM 2010},
   event_date = {13-06-2010 to 18-06-2010},
   language = {30},
   DOI = {10.1109/CPEM.2010.5543404},
   stag_bib_extends_levelofaccess = {NA},
   author = {Bergman, A. and Pogliano, U. and H{\"a}llstr{\"o}m, J. and Wright, P. and Lucas, W. and Kurrat, M. and Merev, A. and Rietveld, G. and Rickmann, J.}
}

@Article { ManaR2010,
   title = {The calibration of Si isotope ratio measurements},
   journal = {International Journal of Mass Spectrometry},
   year = {2010},
   month = {1},
   day = {25},
   volume = {291},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   pages = {55-60},
   keywords = {Si molar mass; metrology; isotopic composition; isotopic abundance,  atomic weight},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Mana, G. and Rienitz, O.}
}

@Article { PitreGSRT2010,
   title = {Progress Towards an Acoustic/Microwave Determination of the Boltzmann Constant at LNE-INM/CNAM},
   journal = {International Journal of Thermophysics},
   year = {2010},
   volume = {29},
   number = {5},
   number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin},
   pages = {1730-1739},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1007/s10765-008-0481-2},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pitre, L. and Guianvarc'ha, C. and Sparascia, F. and Richard, A. and Truong, D.}
}

@Article { JeanneretORNJ2010,
   title = {Strong Attenuation of the Transients´ Effect in Square Waves Synthesized with a Programmable Josephson Voltage Standard''},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2010},
   volume = {59},
   number = {7},
   number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications},
   pages = {1894-1899},
   keywords = {AC measurements,  Josephson devices,  Josephson voltage standard,  waveform synthesizer},
   misc2 = {iMERA-Plus: Call 2007 Length},
   language = {English},
   ISSN = {0018-9456},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jeanneret, B. and Overney, F. and Rufenacht, A. and Nissil{\"a}, J.}
}

@Proceedings { RietveldBWG2010,
   title = {Metrology for Smart Electrical Grids},
   journal = {2010 Conference on Precision Electromagnetic Measurements (CPEM)},
   year = {2010},
   number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids},
   pages = {529-530},
   misc2 = {EMRP A169: Call 2009 Energy},
   event_place = {Deajeon, Korea},
   event_name = {2010 Conference on Precision Electromagnetic Measurements (CPEM)},
   event_date = {13 - 18 June 2010},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, Gert and Braun, J. P. and Wright, P. W. and Grottker, U.}
}

@Proceedings { Rietveld2010,
   title = {Vibrating Reed Electrometer with Sub-Aa Current Resolution},
   journal = {2010 Conference on Precision Electromagnetic Measurements (CPEM)},
   year = {2010},
   number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere},
   pages = {757-758},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   event_place = {Deajeon, Korea},
   event_name = {2010 Conference on Precision Electromagnetic Measurements (CPEM)},
   event_date = {13 - 18 June 2010},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, Gert}
}

@Article { RufenachtOMJ2010,
   title = {Josephson-voltage-standard-locked sine wave synthesizer: implementation  and preliminary results},
   journal = {2010 Conference on Precision Electromagnetic Measurements digest},
   year = {2010},
   number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications},
   pages = {147-148},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {R{\"u}fenacht, A. and Overney, F. and Mortara, A. and Jeanneret, B.}
}

@Proceedings { HartigRG2010,
   title = {Large gear material standard for the traceability of gears for transmission manufacturing},
   journal = {VDI-Berichte},
   year = {2010},
   volume = {2108},
   number = {20},
   number2 = {T3.J2.2: NIMTech: Metrology for New Industrial Measurement Technologies},
   pages = {991-1004},
   misc2 = {iMERA-Plus: Call 2007 Length},
   publisher = {VDI Verlag},
   address = {D{\"u}sseldorf, Germany},
   event_place = {Garching, Germany},
   event_name = {International Conference on Gears},
   event_date = {4 -6 October 2010},
   language = {English},
   ISBN = {978-3-18-092108-2},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {H{\"a}rtig, Frank and Rost, Kerstin and Goch, Gert}
}

@Proceedings { TarassoZGLMPRV2010,
   title = {A survey of current shunts for AC power measurements},
   journal = {2010 Conference on Precision Electromagnetic Measurements (CPEM)},
   year = {2010},
   number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques},
   keywords = {power and energy, ac-dc transfer, shunts, wideband, power coefficient},
   tags = {SEG},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   event_place = {Deajeon, Korea},
   event_name = {2010 Conference on Precision Electromagnetic Measurements (CPEM)},
   event_date = {13 - 18 June 2010},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Tarasso, V. and Zachovalov{\'a}, V.N. and Garcocz, M. and Lind, K. and Mansten, T. and Pogliano, U. and Rietveld, G. and Voljc, B.}
}

@Proceedings { JiangTKSPRFJLMMCB2010,
   title = {Preliminary results of the BIPM relative gravity measurement campaign during the 8th international comparison of absolute gravimeters (2009)},
   journal = {Proceedings of TGSMM2010},
   year = {2010},
   number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram},
   keywords = {Absolute gravimetry, relative gravimetry, ICAG, RGC, BIPM, Key comparison},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   event_place = {Saint-Petersburg,  Russia},
   event_name = {IAG Sypposium on Terrestrial Gravimetry: Static and Mobile Measurements (TG-SMM2010)},
   event_date = {22 - 25 June 2010},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jiang, Z. and Tisserand, L. and Kessler-Schulz, K. U. and Schulz, H. R. and Palinkas, V. and Rothleitner, C. and Francis, O. and Jousset, P. and Lequin, D. and Merlet, S. and M{\"a}kinen, J. and Coulomb, A. and Becker, M.}
}

@Article { TaralliPLMRNB2010,
   title = {Impedance measurements on fast Transition-Edge Sensor for optical and near-infrared range},
   journal = {Superconductor Science and Technology},
   year = {2010},
   volume = {23},
   number = {105012},
   number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1088/0953-2048/23/10/105012},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Taralli, E. and Portesi, C. and Lolli, L. and Monticone, E. and Rajteri, M. and Novikov, I. and Beyer, J.}
}

@Article { BridaDGRR2010,
   title = {Detection of multimode spatial correlation in PDC and application to the absolute calibration of a CCD camera},
   journal = {Optics Express},
   year = {2010},
   volume = {18},
   number = {20572},
   number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1364/OE.18.020572},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Brida, G. and Degiovanni, I. and Genovese, M. and Rastello, M. L. and Ruo-Berchera, I.}
}

@Article { HubbardOHRFLSS2010,
   title = {Wide spectral range confocal microscope based on endlessly single-mode fiber},
   journal = {Optics Express},
   year = {2010},
   volume = {18},
   number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards},
   pages = {18811-18819},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hubbard, R. and Ovchinnikov, Yu. B. and Hayes, J. and Richardson, D. J. and Fu, Y. J. and Lin, S. D. and See, P. and Sinclair, A. G.}
}

@Article { ZwinkelsIFUR2010,
   title = {Photometry, radiometry and  “the candela”: evolution in the classical and quantum world},
   journal = {Metrologia},
   year = {2010},
   volume = {47},
   number = {5},
   number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1088/0026-1394/47/5/R01},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Zwinkels, J. C. and Ikonen, E. and Fox, N. P. and Ulm, G. and Rastello, M. L.}
}

@Proceedings { KapschR2010,
   title = {Experimental investigation of al Computed Radiography system as detector for dosimetry},
   journal = {Proceedings IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry},
   year = {2010},
   number2 = {T2.J07: EBCT: External Beam Cancer Therapy},
   pages = {451},
   misc2 = {iMERA-Plus: Call 2007 Health},
   event_place = {Vienna, Austria},
   event_name = {IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry},
   event_date = {09-12 November 2010},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Kapsch, R.-P. and Rouijaa, M.}
}

@Article { AlSualitiSTKRP2010,
   title = {Water equivalence of various materials for clinical proton dosimetry by experiment and Monte Carlo simulation},
   journal = {Nuclear Instruments and Methods},
   year = {2010},
   volume = {A 619},
   number2 = {T2.J07: EBCT: External Beam Cancer Therapy},
   pages = {344-347},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Al-Sulaiti, L. and Shipley, D. and Thomas, R. and Kacperek, A. and Regan, P. and Palmans, H.}
}

@Article { JitaruRBVF2010,
   title = {Challenges in the accurate speciation analysis of selenium in humans: first report on indicative levels of selenoproteins in a serum certified reference material for total selenium (BCR-637)},
   journal = {Accreditation and Quality Assurance},
   year = {2010},
   volume = {15},
   number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry},
   pages = {343-350},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jitaru, Petru and Roman, Marco and Barbante, C. and Vaslin-Reimann, Sophie and Fisicaro, Paola}
}

@Article { EichenbergerBJJRB2010,
   title = {Determination of the Planck constant with the METAS watt balance},
   journal = {Metrologia},
   year = {2010},
   volume = {48},
   number = {3},
   number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram},
   pages = {133-141},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Eichenberger, Ali and Baumann, H. and Jeanneret, Blaise and Jeckelmann, Beat and Richard, Philippe and Beer, Walter}
}

@Article { RienitzPS2009,
   title = {Novel concept for the mass spectrometric determination of absolute isotopic abundances with improved measurement uncertainty: Part 1 – theoretical derivation and feasibility study},
   journal = {International Journal of Mass Spectrometry},
   year = {2009},
   month = {9},
   day = {30},
   number = {289},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   pages = {47-53},
   keywords = {Isotope dilution mass spectrometry; Isotopic abundances; Measurement uncertainty; Molar mass; Silicon},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rienitz, Olaf and Pramann, Axel and Schiel, Detlef}
}

@Article { BeckerFFGMPPRV2009,
   title = {The Avogadro constant determination via enriched silicon-28},
   journal = {Measurement  Science and Technology},
   year = {2009},
   month = {8},
   day = {21},
   volume = {20},
   number = {092002},
   number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram},
   pages = {20 pages},
   keywords = {Avogadro constant determination; kilogram rede?nition; fundamental physical
constants; enriched silicon-28; mass measurements; density measurements; molar mass
measurements; lattice parameter measurements; volume measurements; crystal
characterization; x-ray, interferometry; optical interferometry},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Becker, P. and Friedrich, H. and Fujii, K. and Giardini, W. and Mana, G. and Picard, A. and Pohl, H.-J. and Riemann, H. and Valkiers, S.}
}

@Article { RodKCSF2009,
   title = {The route to single magnetic particle detection: a carbon nanotube decorated with a finite number of nanocubes},
   journal = {Nanotechnology},
   year = {2009},
   month = {8},
   day = {19},
   volume = {20},
   number = {33},
   number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics},
   note = {No pdf received},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   language = {English},
   DOI = {10.1088/0957-4484/20/33/335301},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rod, I. and Kazakova, O. and Cox, D. C. and Spasova, M. and Farle, M.}
}

@Article { Rietveldv2009,
   title = {DC and Low-Frequency Humidity Dependence of a 20pF Air-Gap Capacitor},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2009},
   month = {4},
   volume = {58},
   number = {4},
   number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere},
   pages = {967-972},
   keywords = {Air-gap capacitor, capacitance measurement, current measurement, humidity dependence, small currents},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rietveld, Gert and van den Brom, Helko E.}
}

@Article { vandenBromHVMR2009,
   title = {Influence of Sampling Voltmeter Parameters on RMS Measurements of Josephson Stepwise-Approximated Sine Waves},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2009},
   volume = {58},
   number = {10},
   number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications},
   pages = {3806-3812},
   keywords = {AC Josephson voltage standards; binary Josephson arrays; measurement standards; sampling voltmeter; voltage measurement},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   language = {English},
   ISSN = {0018-9456},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {van den Brom, H. E. and Houtzager, E. and Verhoeckx, S. and Martina, Q. E. and Rietveld, G.}
}

@Article { JeanneretOCMR2009,
   title = {Josephson-Voltage-Standard-Locked Sine Wave Synthesizer: Margin Evaluation and Stability},
   journal = {IEEE Transactions on Instrumentation and Measurement},
   year = {2009},
   volume = {58},
   number = {4},
   number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications},
   pages = {791-796},
   keywords = {AC measurements; Josephson devices; Josephson voltage standard; waveform synthesizer},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   language = {English},
   ISSN = {0018-9456},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jeanneret, B. and Overney, F. and Callegaro, L. and Mortara, A. and Rufenacht, A.}
}

@Proceedings { JeanneretORN2009,
   title = {Transition shape effect in the transients generated by a programmable Josephson voltage standard},
   journal = {2010 Conference on Precision Electromagnetic Measurements digest},
   year = {2009},
   number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications},
   pages = {54-55},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   event_place = {Daejeon, Korea},
   event_name = {2010 Conference on Precision Electromagnetic Measurements (CPEM)},
   event_date = {13-18 June, 2010},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jeanneret, B. and Overney, F. and R{\"u}fenacht, A. and Nissil{\"a}, J.}
}

@Proceedings { MeleroBDR2009,
   title = {Power and Energy Project. the New Generation of Power Quality Measurement Systems},
   journal = {Proceedings 4th National Congress of Metrology},
   year = {2009},
   number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques},
   keywords = {Electrical Metrology, Power Quality, Energy Efficiency, Transducers, Measurement Algorithms},
   misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism},
   event_place = {Santander, Spain},
   event_name = {4th National Congress of Metrology},
   event_date = {June 2009},
   language = {Spanish},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Melero, J. J. and Bruna, J. and Diaz de Aguilar, J. and Romero, M. L.}
}

@Article { RajteriTPMB2009,
   title = {Photon-number discriminating superconducting transition-edge sensors},
   journal = {Metrologia},
   year = {2009},
   volume = {46},
   number = {4},
   number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards},
   keywords = {Superconductivity, Instrumentation and measurement, Optics, quantum optics and lasers},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1088/0026-1394/46/4/S28},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rajteri, M. and Taralli, E. and Portesi, C. and Monticone, E. and Beyer, J.}
}

@Article { JitaruRCFB2009,
   title = {Speciation analysis of selenoproteins in human serum by microbore affinity-HPLC hyphenated to ICP-Sector field-MS using a high efficiency sample introduction system},
   journal = {Microchim Acta},
   year = {2009},
   volume = {166},
   number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry},
   pages = {319,327},
   keywords = {Speciation analysis - Human serum selenoproteins - Microbore affinity chromatography - Inductively coupled plasma-sector field mass spectrometry - On-line isotope dilution},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   DOI = {10.1007/s00604-009-0208-5},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jitaru, Petru and Roman, Marco and Cozzi, Giulio and Fisicaro, Paola and Barbante, C.}
}

@Article { WrightBGTPJHAJNR20100,
   title = {Enhanced current quantization in high-frequency electron pumps in a perpendicular magnetic field},
   journal = {Physical Review Letters B},
   year = {2008},
   volume = {78},
   number = {233311},
   number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere},
   pages = {1-4},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   language = {English},
   DOI = {10.1103/PhysRevB.78.233311},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Wright, S. J. and Blumenthal, M. D. and Gumbs, Godfrey and Thorn, A. L. and Pepper, M. and Janssen, T. J. B. M. and Holmes, S. N. and Anderson, D. and Jones, G. A. C. and Nicoll, C. A. and Ritchie, D. A.}
}

@Proceedings { JuskoNRSP2008,
   title = {Dimensional calibration techniques for pressure for pressure balances balances to be used in the new determination of the Boltzmann constant},
   journal = {Proceedings I-CIMMEC, 1st International Congress on Mechanical Metrology},
   year = {2008},
   number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin},
   keywords = {pressure metrology, Boltzmann constant, dimensional metrology},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   event_place = {Rio de Janeiro, Brazil},
   event_name = {I-CIMMEC, 1st International Congress on Mechanical Metrology},
   event_date = {8 - 10 October 2008},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jusko, Otto and Neugebauer, Michael and Reimann, Helge and Sabuga, Wladimir and Priruenrom, Tasanee}
}

@Proceedings { JuskoNRDFG2008,
   title = {Form measurements by optical and tactile scanning},
   journal = {Proceedings Fifth International Symposium on Instrumentation Science and Technology},
   year = {2008},
   number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin},
   keywords = {form measurement, optical probe, tactile probe, scanning
CMM},
   misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology},
   event_place = {Shenyang, China},
   event_name = {5th International Symposium on Instrumentation Science and Technology},
   event_date = {15-18 September 2008},
   language = {English},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jusko, Otto and Neugebauer, Michael and Reimann, Helge and Drabarek, P. and Fleischer, M. and Gnausch, T.}
}

@Article { AlfonsoACSKKMPRSUV2008,
   title = {A new formalism for reference dosimetry of small and non-standard fields},
   journal = {Medical Physics},
   year = {2008},
   volume = {35},
   number2 = {T2.J07: EBCT: External Beam Cancer Therapy},
   pages = {5179-5186},
   misc2 = {iMERA-Plus: Call 2007 Health},
   language = {English},
   DOI = {10.1118/1.3005481},
   reviewed = {1},
   stag_bib_extends_fe_group = {59},
   stag_bib_extends_levelofaccess = {NA},
   author = {Alfonso, R. and Andreo, P. and Capote, R. and Saiful Huq, M. and Kilby, W. and Kj{\"a}ll, P. and Mackie, T. R. and Palmans, H. and Rosser, K. and Seuntjens, J. and Ullrich, W. and Vatnitsky, S.}
}

@Miscellaneous { HoogenboomBHMR,
   subid = {1330},
   title = {Dataset for publication: ''Comparison of two Reference Setups for Calibrating Power Transformer Loss Measurement Systems''},
   number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors},
   keywords = {Power transformersLoss measurementsUncertaintyLoad LossNo-load lossTrafoLoss},
   tags = {SEG},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   language = {1},
   DOI = {10.5281/zenodo.3561900},
   stag_bib_extends_levelofaccess = {NA},
   author = {Hoogenboom, D. and Badura, H. and Houtzager, E. and Mohns, E. and Rietveld, G.}
}

@Miscellaneous { KoybasiNTPRPBMSKGOIG,
   subid = {2649},
   title = {High Performance Predictable Quantum Efficient Detector Based on Induced-Junction Photodiodes Passivated with SiO2/SiNx},
   journal = {Sensors},
   volume = {21},
   number2 = {18SIB10: chipS·CALe: Self-calibrating photodiodes for the radiometric linkage to fundamental constants},
   pages = {7807},
   keywords = {Silicon Photodetector; Inversion Layer Photodiode; Induced-Junction; Surface Pas-Sivation; PECVD Silicon Nitride; Radiometry; Optical Power; Primary Standard; Predictable Quantum Efficiency (1)},
   web_url = {https://zenodo.org/record/5720711},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {MDPI},
   ISSN = {ISSN 1424-8220},
   DOI = {10.5281/Zenodo.5720711},
   stag_bib_extends_levelofaccess = {NA},
   author = {Koybasi, O. and Nordseth, {\O}. and Tran, T. and  Povoli, M. and Rajteri, M. and Pepe, C. and Bardalen, E. and Manoocheri, F. and Summanwar, A. and Korpusenko, M. and Getz, M.N. and Ohlckers, P. and Ikonen, E. and Gran, J.}
}

@Miscellaneous { RuoBercheraGBLKMTF,
   subid = {1465},
   title = {Feasibility study towards comparison of the g(2)(0) measurement in the visible range},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {single-Photon source},
   web_url = {https://zenodo.org/record/3711276\#.XniB2EBFz8c},
   misc2 = {EMPIR 2017: Fundamental},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ruo-Berchera, I. and Gramegna, M. and Brida, G. and L{\'o}pez, M. and Kirkwood, R. and Moreva, E. and Traina, P. and Forneris, J.}
}

@Miscellaneous { ChunnilallKBGRKLPRGD,
   subid = {1475},
   title = {Towards a standard procedure for the measurement of the multi-photon component in a CW telecom heralded single-photon source},
   journal = {Metrologia},
   volume = {56},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   pages = {025004},
   keywords = {single-photon sourcesquantum technologiesquantum characterization},
   web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/ab022e},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {IOP Publishing},
   ISSN = {0026-1394, 1681-7575},
   DOI = {10.1088/1681-7575/ab022e},
   stag_bib_extends_levelofaccess = {NA},
   author = {Rebufello, E. and Piacentini, F. and L{\'o}pez, M. and Kirkwood, R.A. and Ruo Berchera, I. and Gramegna, M. and Brida, G. and K{\"u}ck, S. and Chunnilall, C.J. and Genovese, M. and Degiovanni, I.P.}
}

@Miscellaneous { RuoBercheraD,
   subid = {2626},
   title = {Quantum imaging with sub-Poissonian light: challenges and perspectives in optical metrology},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {quantum imaging, quantum correlations, quantum metrology, quantum enhancedmeasurement, quantum optics},
   misc2 = {EMPIR 2017: Fundamental},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3730979},
   author = {Ruo Berchera, I. and Degiovanni, I.P.}
}

@Miscellaneous { Robinson,
   subid = {2312},
   title = {MRTDosimetry Data Repository},
   journal = {Open Science Framework (OSF)},
   volume = {NA},
   number2 = {19SIP01: PINICAL-MRT: Protocols for clinical impact in molecular radiotherapy},
   pages = {NA},
   keywords = {MRTDosimetry, Phantoms, Validation, QI},
   web_url = {https://osf.io/69nge/},
   misc2 = {EMPIR 2019: Support for Impact},
   publisher = {Center for Open Science},
   address = {.},
   ISSN = {NA},
   DOI = {10.17605/OSF.IO/69NGE},
   stag_bib_extends_levelofaccess = {NA},
   author = {Robinson, A.}
}

@Miscellaneous { SchwarzDABLSWRLL,
   subid = {1715},
   title = {Additional data for the publication ''Long term measurement of the 87Sr clock frequency at the limit of primary Cs clocks},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   keywords = {Optical clocks ; Primary frequency standards ; Absolute frequency measurement ; Clock stability},
   web_url = {https://oar.ptb.de/resources/show/10.7795/720.20201113},
   misc2 = {EMPIR 2018: SI Broader Scope},
   DOI = {10.7795/720.20201113},
   stag_bib_extends_levelofaccess = {NA},
   author = {Schwarz, R. and D{\"o}rscher, S. and Al-Masoudi, A. and Benkl{\"o}er, E. and Legero, T. and Sterr, U. and Weyers, S. and Rahm, J. and Lipphardt, B. and Lisdat, C.}
}

@Miscellaneous { LangeHRSSLTWP,
   subid = {2326},
   title = {Additional data for the publication ''Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons''},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   keywords = {Optical clocks ; Frequency measurements ; Atomic structure},
   web_url = {https://oar.ptb.de/resources/show/10.7795/720.20211028},
   misc2 = {EMPIR 2018: SI Broader Scope},
   DOI = {10.7795/720.20211028},
   stag_bib_extends_levelofaccess = {NA},
   author = {Lange, R. and Huntemann, N. and Rahm, J. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, C. and Weyers, S. and Peik, E.}
}

@Miscellaneous { MarschallHWHRKE,
   subid = {2598},
   title = {Compressed FTIR spectroscopy using low-rank matrix reconstruction},
   journal = {Opt. Express},
   volume = {28},
   number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept},
   pages = {38762-38772},
   keywords = {FTIR hyperspectral, imulation data, Python scripts},
   misc2 = {EMPIR 2018: Health},
   publisher = {BERND KAESTNER},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4595934},
   author = {Marschall, M. and Hornemann, A. and W{\"u}bbeler, G. and Hoehl, A. and Ruhl, E. and K{\"a}stner, K. and Elster, C.}
}

@Miscellaneous { GeorgievaMRHGDGLK,
   subid = {2119},
   title = {Detection of ultra-weak laser pulses by free-running single-photon detectors: modeling dead time and dark counts effects},
   number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware},
   keywords = {single-photon detector, dead time, dark counts, laser pulses, quantum communication},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4483256},
   author = {Georgieva, H. and Meda, A. and Raupach, S.M.F. and Hofer, H. and Gramegna, M. and Degiovanni, I.P. and Genovese, M. and L{\'o}pez, M. and Kueck, S.}
}

@Miscellaneous { PottieAQLCRWKKG,
   subid = {2291},
   title = {Data set from ''Combining fiber Brillouin amplification with a repeater laser station for fiber-based optical frequency dissemination over 1400 km''},
   journal = {Zenodo},
   number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks},
   pages = {4046057},
   keywords = {frequency transfer, optical fiber link, optical atomic clocks},
   web_url = {https://doi.org/10.5281/zenodo.4046057},
   misc2 = {EMPIR 2018: SI Broader Scope},
   publisher = {Zenodo},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4046057},
   author = {Pottie, P-E. and Amy-Klein, A. and Quintin, N. and Lopez, O. and Cantin, E. and Raupach, S.M.F. and Waterholter, T. and Kuhl, A. and Koke, S. and Grosche, G.}
}

@Miscellaneous { ChristinckRLHGK,
   subid = {2627},
   title = {Characterization of the angular-dependent emission of nitrogen-vacancy centers in nanodiamond},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {angular-dependent emission, NV-center, single-photon source, collection efficiency},
   misc2 = {EMPIR 2017: Fundamental},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.6349953},
   author = {Christinck, J. and Rodiek, B. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and K{\"u}ck, S.}
}

@Miscellaneous { PizzocaroSTUHNTKKRNOTCBBMCCLMRBNRZRLPPCI,
   subid = {2248},
   title = {Dataset for 'Intercontinental comparison of optical atomic clocks through very long baseline interferometry'},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   keywords = {Optical clocks, Very long baseline interferometry, VLBI, GPS},
   misc2 = {EMPIR 2018: SI Broader Scope},
   DOI = {10.5281/zenodo.5592085},
   stag_bib_extends_levelofaccess = {NA},
   author = {Pizzocaro, M. and Sekido, M. and Takefuji, K. and Ujihara, H. and Hachisu, H. and Nemitz, N. and Tsutsumi, M. and Kondo, T. and Kawai, E. and Ryuichi, N. and Namba, K. and Okamoto, Y. and Takahashi, R. and Clivati, C. and Bregolin, F. and Barbieri, P. and Mura, A. and Cantoni, E. and Cerretto, G. and Levi, F. and Maccaferri, G. and Roma, M. and Bortolotti, C. and Negusini, M. and Ricci, R. and Zacchiroli, G. and Roda, J. and Leute, J. and Petit, G. and Perini, F. and Calonico, D. and Ido, T.}
}

@Miscellaneous { HeindelSSKFHSRR,
   subid = {1460},
   title = {Deterministically fabricated spectrally-tunable quantum dot based single-photon source},
   number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards},
   keywords = {Quantum dotsingle-Photon source},
   web_url = {https://zenodo.org/record/3711290\#.XnhgX0BFz8c},
   misc2 = {EMPIR 2017: Fundamental},
   language = {30},
   stag_bib_extends_levelofaccess = {NA},
   author = {Heindel, T. and Schliwa, A. and Schmidt, R. and Kaganskiy, A. and Fischbach, S. and Helversen, M. and Schmidt, M. and Rodt, S. and Reitzenstein, S.}
}

@Miscellaneous { VidiMRHAUPPM,
   subid = {2562},
   title = {Specific heat of tungsten from 23 \(^{\circ}\)C to 3266 \(^{\circ}\)C},
   number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties},
   keywords = {Specific heat, High temperature, Tungsten},
   misc2 = {EMPIR 2017: Industry},
   publisher = {ZENODO},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6091579},
   author = {Vidi , S. and Manara, J. and Razouk, R. and Hay, B. and Anhalt, K. and Urban , D. and Pichler, P. and Pottlacher, G. and Milosevic, N.}
}

@Miscellaneous { VidiMRHAUPPM_2,
   subid = {2561},
   title = {Specific heat of molybdenum from 23 \(^{\circ}\)C to 2607 \(^{\circ}\)C},
   number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties},
   keywords = {Specific heat, High temperature, Molybdenum},
   misc2 = {EMPIR 2017: Industry},
   publisher = {ZENODO},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6091492},
   author = {Vidi , S. and Manara, J. and Razouk, R. and Hay, B. and Anhalt, K. and Urban , D. and Pichler, P. and Pottlacher, G. and Milosevic, N.}
}

@Miscellaneous { RazoukHAUM,
   subid = {2560},
   title = {Specific heat of isotropic graphite from 1000 \(^{\circ}\)C to 2800 \(^{\circ}\)C},
   number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties},
   keywords = {Specific heat, High temperature, Isotropic graphite},
   misc2 = {EMPIR 2017: Industry},
   publisher = {ZENODO},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6091274},
   author = {Razouk, R. and Hay, B. and Anhalt, K. and Urban , D. and Milosevic, N.}
}

@Miscellaneous { CalonicoLRBBP,
   subid = {1447},
   title = {Absolute frequency measurement of the 1 S 0 – 3 P 0 transition of 171 Yb with a link to International Atomic Time},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   keywords = {Optical frequency standards, International Atomic Time},
   misc2 = {EMPIR 2018: SI Broader Scope},
   DOI = {10.5281/zenodo.3453859},
   stag_bib_extends_levelofaccess = {NA},
   author = {Calonico, D. and Levi, F. and Rauf, B. and Barbieri, P. and Bregolin, F. and Pizzocaro, M.}
}

@Miscellaneous { JostTPBGKDSFKGKKBRLSH,
   subid = {1982},
   title = {Development of white LED illuminants for colorimetry and recommendation of white LED reference spectrum for photometry},
   journal = {Not applicable},
   volume = {Not applic},
   number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products},
   pages = {2},
   keywords = {LED, light emitting diode, SSL, solid-state lighting, spectrum, spectral power distribution, illuminant, colorimetry, photometry},
   web_url = {https://doi.org/10.1088/1681-7575/aacae7},
   misc2 = {EMPIR 2015: SI Broader Scope},
   publisher = {PhotoLED},
   address = {photoled.aalto.fi},
   ISSN = {Not applicable},
   DOI = {10.1088/1681-7575/aacae7},
   stag_bib_extends_levelofaccess = {NA},
   author = {Jost, S. and Thorseth, A. and Poikonen, T. and Blattner, P. and Gerloff, T. and Kokka, A. and Dekker, P. and Smid, M. and Ferrero, A. and K{\"u}barsepp, T. and Gal, P. and K{\"a}llberg, S. and Klej, A. and Brida, G. and Reiners, T. and Ludwig, K. and Schneider, M. and Hui, L.}
}

@Miscellaneous { KruskopfBPCPREPPGS,
   subid = {2230},
   title = {Datasets of Kruskopf et al., IEEE Transactions on Electron Devices 68, 3672 (2021), ''Graphene QHE devices for ac and dc electrical metrology''},
   journal = {Zenodo},
   number2 = {18SIB07: GIQS: Graphene impedance quantum standard},
   keywords = {epitaxial graphene, quantum Hall effect, electrical metrology, resistance metrology, quantum metrology},
   misc2 = {EMPIR 2018: SI Broader Scope},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.5076039},
   author = {Kruskopf, M. and Bauer, S. and Pimsut, Y. and Chatterjee, A. and Patel, D.K. and Rigosi, A.F. and Elmquist, R.E. and Pierz, K. and Pesel, E. and G{\"o}tz, M. and Schurr, J.}
}

@Miscellaneous { LuisoRBMC,
   subid = {1750},
   title = {Dataset for publication ''Setup and Characterisation of Reference Current-to-Voltage Transformers for Wideband Current Transformers Calibration up to 2 kA''},
   number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation},
   keywords = {wideband, current transformers, calibration, measurement uncertainty, instrument transformers, power quality},
   tags = {SEG},
   misc2 = {EMPIR 2017: Industry},
   language = {1},
   DOI = {10.5281/zenodo.3734322},
   stag_bib_extends_levelofaccess = {NA},
   author = {Luiso, M. and Raether, P. and Badura, H. and Mohns, E. and Chen, Y.}
}

@Miscellaneous { FletcherJLSGFRBKK,
   subid = {2652},
   title = {Data set for ''Continuous-variable tomography of solitary electrons'' Fletcher et al. DOI: 10.1038/s41467-019-13222-1},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   keywords = {single-electron wave packet, tomography, single-electron quantum optics},
   misc2 = {EMPIR 2017: Fundamental},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3533120},
   author = {Fletcher, J.D. and Johnson, N. and Locane, E. and See, P. and Griffiths, J.P. and Farrer, I. and Ritchie, D.A. and Brouwer, P.W. and Kashcheyevs, V. and Kataoka, M.}
}

@Miscellaneous { UbbelohdeHPWRGF,
   subid = {1469},
   title = {Dataset for Freise et al. Phys. Rev. Lett. 124, 127701 (2020), ''Trapping and Counting Ballistic Nonequilibrium Electrons''},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   keywords = {Ballistic transport, Electron relaxation, Semiconductor quantum optics, Full counting statistics},
   misc2 = {EMPIR 2017: Fundamental},
   DOI = {10.5281/zenodo.3693569},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ubbelohde, N. and Hohls, F. and Pierz, K. and Weimann, T. and Reifert, D. and Gerster, T. and Freise, L.}
}

@Miscellaneous { LoeslerERS,
   subid = {1586},
   title = {Dataset for A Modified Approach for Process-Integrated Reference Point Determination},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   keywords = {Reference Point Determination, SLR, VLBI, Laser Tracker, Least-Squares Adjustment, In-Process Metrology, GGOS, VGOS},
   misc2 = {EMPIR 2018: SI Broader Scope},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3996200},
   author = {Loesler, M. and Eschelbach, C. and Riepl, S. and Sch{\"u}ler, T.}
}

@Miscellaneous { KlugelELR,
   subid = {2014},
   title = {Bundle adjustment code for 'ILRS Reference Point Determination using Close Range Photogrammetry'},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   keywords = {close range photogrammetry, bundle adjustment, reference point determination, unscentedtransformation, stochastic model, satellite laser ranging, GeoMetre},
   misc2 = {EMPIR 2018: SI Broader Scope},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://github.com/applied-geodesy/bundle-adjustment},
   author = {Kl{\"u}gel, T. and Eschelbach, C. and L{\"o}sler, M. and Riepl, S.}
}

@Miscellaneous { SahaZFMTSWBRKH,
   subid = {2462},
   title = {Data set for the article ''Formation of N{\'e}el-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy'' DOI: 10.1103/PhysRevB.100.144435},
   journal = {PHYSICAL REVIEW B},
   volume = {100},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {144435},
   keywords = {Skyrmions, Dzyaloshinskii–Moriya interaction},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {American Physical Society},
   ISSN = {2469-9950},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/3606088},
   author = {Saha, S. and Zelent, M. and Finizio, S. and Mruczkiewicz, M. and Tacchi, S. and Suszka, A.K.  and Wintz, S. and Bingham, N.S.  and Raabe, J. and Krawczyk, M. and Heyderman,  L.J. }
}

@Miscellaneous { RibeiroCSMLASBS,
   subid = {2012},
   title = {EMUE-D4-1-WaterVolumeMeasurement},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Measurement uncertainty; Water Supply Networks; Volume Totalization},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   DOI = {10.5281/zenodo.4700500},
   stag_bib_extends_levelofaccess = {NA},
   author = {Ribeiro, A.S. and Cox, M.G. and Sousa, J.A. and Martins, L.L. and Loureiro, D. and Almeida, M.C. and Silva, M.A. and Brito, R. and Soares, A.C.}
}

@Miscellaneous { SousaBDFPRMRv,
   subid = {2158},
   title = {EMUE-D5-5-Microflow},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Measurement uncertainty, Microflow, Bayesian},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   DOI = {10.5281/zenodo.5497823},
   stag_bib_extends_levelofaccess = {NA},
   author = {Sousa, J.A. and Batista, E. and Demeyer, S. and Fischer, N. and Pelegrino, O. and Ribeiro, A.S. and Martins, L.L. and Reader-Harris, M and van der Veen, A.M.H}
}

@Miscellaneous { LiuRPKZ,
   subid = {1669},
   title = {Dataset for Combining Harmonic Laser Beams by Fiber Components for Refractivity–Compensating Two-Color Interferometry},
   number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy},
   keywords = {beam properties, photonics crystal fiber (PCF), two–color interferometry, wavelength division multiplexing (WDM), photonic crystal fiber, wide-band transmission, index of refraction, polarization},
   web_url = {DOI: 10.7795/720.20200618\&\#10;ISNI: 0000 0001 2186 1887},
   misc2 = {EMPIR 2018: SI Broader Scope},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/720.20200618},
   author = {Liu, Y. and Rose, A. and Prellinger, G. and K{\"o}chert, P. and Zhu, J.}
}

@Miscellaneous { BenklerSLWPR,
   subid = {1666},
   title = {Fractional frequency ratio difference time series data sets (Optical frequency comb comparison)},
   number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales},
   keywords = {Comb comparison ; End-to-end topology ; optical frequency transfer},
   web_url = {https://oar.ptb.de/resources/show/10.7795/720.20191108},
   misc2 = {EMPIR 2018: SI Broader Scope},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {10.7795/720.20191108},
   author = {Benkler, E. and Sterr, U. and Lipphardt, B. and Wilk, R. and Puppe, T. and Rohde, F.}
}

@Miscellaneous { FernandezScarioniBCSHALRCKS,
   subid = {1799},
   title = {Dataset associated with ''Thermoelectric signature of individual skyrmions''},
   journal = {Zenodo},
   volume = {N/A},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   pages = {N/A},
   keywords = {skyrmions, anomalous Nernst effect, topological Nernst effect},
   web_url = {https://zenodo.org/record/4322235\#.X_wh1RYxlaQ},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Zenodo},
   ISSN = {N/A},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4322235},
   author = {Fern{\'a}ndez Scarioni, A. and Barton, C. and Corte-Le{\'o}n, H. and Sievers, S. and Hu, X. and Ajejas, F. and Legrand, W. and Reyren, N. and Cros, V. and Kazakova, O. and Schumacher, H.W.}
}

@Miscellaneous { FurtadoPQSLMAARLBCLA,
   subid = {2053},
   title = {First density comparison on viscoelastic samples by oscillation-type densimetry},
   journal = {ACTA IMEKO},
   volume = {9},
   number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements},
   pages = {79-84},
   keywords = {density; viscoelasticity; oscillationtype densimetry: degree of equivalence; rhoLiq},
   misc2 = {EMPIR 2017: Research Potential},
   publisher = {IMEKO},
   ISSN = {2221-870X},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4792271},
   author = {Furtado, A. and Pereira, J. and Quendera, R. and Schiebl, M. and Lenard, E. and Malejczyk, E. and  Alic,  A. and Alisic, S. and Rauch, J. and Lorenz, F. and Bescupschii, A. and Ciubara, A. and Laky, B. and Ams{\"u}ss, R.}
}

@Miscellaneous { GallianaCR,
   subid = {2522},
   title = {Towards a traceable divider for composite voltage waveforms below 1 kV},
   number2 = {19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes},
   keywords = {Voltage divider, Composite and combined voltages, Traceability, Scale factor calibration, Step response, Measurement uncertainty},
   tags = {SEG},
   misc2 = {EMPIR 2019: Pre-Co-Normative},
   language = {1},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5837928},
   author = {Galliana, F. and Caria, S.E. and Roccato, P.E.}
}

@Miscellaneous { RussellS,
   subid = {2354},
   title = {ctr26/MMSIM 1.4mmSIM: an open toolbox for accessible structured illumination microscopy},
   number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants},
   keywords = {structured illumination microscopy, software tool},
   misc2 = {EMPIR 2018: Health},
   DOI = {10.5281/zenodo.4432274},
   stag_bib_extends_levelofaccess = {NA},
   author = {Russell, C.T. and Shaw, M.}
}

@Miscellaneous { AssoulineJBWTJGKRPR,
   subid = {2631},
   title = {Excitonic nature of magnons in a quantum Hall ferromagnet},
   journal = {Nature Physics},
   volume = {17},
   number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements},
   pages = {1369-1374},
   keywords = {Graphene, p-n junction, interferometer, magnons},
   web_url = {https://doi.org/10.5281/zenodo.6500310},
   misc2 = {EMPIR 2017: Fundamental},
   publisher = {Springer Science and Business Media LLC},
   address = {Dordrecht, GX, Netherlands},
   language = {1},
   ISSN = {1745-2473, 1745-2481},
   DOI = {10.1038/s41567-021-01411-z},
   stag_bib_extends_levelofaccess = {NA},
   author = {Assouline, A. and Jo, M. and Brasseur, P. and Watanabe, K. and Taniguchi, T. and Jolicoeur, Th. and Glattli, D. C. and Kumada, N. and Roche, P. and Parmentier, F. D. and Roulleau, P.}
}

@Miscellaneous { ReaderHarrisFB,
   subid = {2132},
   title = {EMUE-D4-2-OrificePlate},
   number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards},
   keywords = {Orifice plate, Flowmeter uncertainty},
   misc2 = {EMPIR 2017: Pre-Co-Normative},
   DOI = {10.5281/zenodo.5142095},
   stag_bib_extends_levelofaccess = {NA},
   author = {Reader-Harris, M.J. and Forsyth, C. and Boussouara, T.}
}

@Miscellaneous { RiemanAEBMSSRIF,
   subid = {2335},
   title = {NeuroMET - SPECIAL MRS Reproducibility},
   number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases},
   keywords = {magnetic resonance spectroscopy (MRS), 7T, Reproducibility, Repeatability, Neurochemicals},
   web_url = {https://zenodo.org/record/5500320\#.YZ9eudDP1aS},
   misc2 = {EMPIR 2018: Health},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.5500319},
   author = {Rieman,  L.T. and Aigner, C.S. and Ellison, S.L.R. and Br{\"u}hl, R. and Mekle, R. and  Schmitter, S.. and Speck, O. and Rose, G. and Itterman, B. and Fillmer, A.}
}

@Miscellaneous { MilanoLLBRV,
   subid = {2237},
   title = {Structure-Dependent Influence of Moisture on Resistive Switching Behavior of ZnO Thin Films - Dataset},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   keywords = {effect of moisture on electroforming, electrical conductivity, memristors, nanostructures, resistive switching},
   misc2 = {EMPIR 2020: Fundamental},
   language = {1},
   DOI = {10.5281/zenodo.5095263},
   stag_bib_extends_levelofaccess = {NA},
   author = {Milano, G. and Luebben, M. and Laurenti, M. and Boarino, L. and Ricciardi, C. and Valov, I.}
}

@Miscellaneous { MilanoMR,
   subid = {2559},
   title = {Grid-graph modeling of emergent neuromorphic dynamics and heterosynaptic plasticity in memristive nanonetworks - Dataset},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   keywords = {nanoarchitectures, nanowire networks, memristive networks, heterosynaptic plasticity, neuromorphic systems, self-organizing systems},
   misc2 = {EMPIR 2020: Fundamental},
   language = {1},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5861513},
   author = {Milano, G. and Montano, K. and Ricciardi, C.}
}

@Miscellaneous { IelminiMPHRMBR,
   subid = {2677},
   title = {In materia reservoir computing with a fully memristive architecture based on self-organizing nanowire networks - Dataset},
   number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology},
   keywords = {memristive devices, memristive networks, nanowire networks, reservoir computing, physical computing},
   web_url = {https://doi.org/10.5281/zenodo.5153335},
   misc2 = {EMPIR 2020: Fundamental},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5153335},
   author = {Ielmini, D. and Milano, G. and Pedretti, G. and Hashemkhani, S. and Ricci, S. and Montano, K. and Boarino, L. and Ricciardi, C.}
}

@Miscellaneous { SudTSBSDSSWZZRCKKC,
   subid = {2424},
   title = {Dataset for the article ''Tailoring interfacial effect in multilayers with Dzyaloshinskii–Moriya interaction by helium ion irradiation'' DOI: 10.1038/s41598-021-02902-y},
   number2 = {17FUN08: TOPS: Metrology for topological spin structures},
   keywords = {Spintronics, Skyrmions, Dzyaloshinskii–Moriya interaction},
   misc2 = {EMPIR 2017: Fundamental},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5791032},
   author = {Sud, A. and Tacchi, S. and Sagkovits, D.  and Barton, C. and Sall, M. and Diez, L.H.  and Stylianidis,  E.  and Smith, N. and Wright, L. and Zhang,  S.  and Zhang, X. and Ravelosona, D.  and Carlotti, G. and Kurebayashi, H.  and Kazakova, O. and Cubukcu, M. }
}

@Miscellaneous { RustK,
   subid = {2695},
   title = {Microphone measurements in the vicinity of wind power plants: Results for the wind park in Gagel, Saxony Anhalt, Germany},
   number2 = {19ENV03: Infra-AUV: Metrology for low-frequency sound and vibration},
   keywords = {wind power ; wind power plants ; wind turbines ; noise measurement ; infrasound ; noise assessment},
   web_url = {https://oar.ptb.de/resources/show/10.7795/720.20211130},
   misc2 = {EMPIR 2019: Environment},
   publisher = {PTB Open Access Repository},
   stag_bib_extends_levelofaccess = {NA},
   stag_bib_extends_persistent_identifier = {10.7795/720.20211130},
   author = {Rust, Marvin and Koch, Christian}
}