This file was created by the TYPO3 extension bib --- Timezone: CEST Creation date: 2022-08-13 Creation time: 08-56-42 --- Number of references 381 article KrupkaSKKJW2022 2797 IEEE Microwave and Wireless Components Letters 2022 6 32 6 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 700-703 Microwave measurement, millimeter wave measurement, permittivity, silicon EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 1531-1309, 1558-1764 10.1109/LMWC.2022.3161393 NA J.Krupka B.Salski T.Karpisz P.Kopyt L.Jensen M.Wojciechowski article HoflingBHRHWTJBGR2022 2713 Optics Express 2022 4 25 30 10 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 15913 single photon source; optical quantum technology https://arxiv.org/abs/2202.09562 EMPIR 2020: Fundamental Optica Publishing Group 30 1094-4087 10.1364/OE.456777 NA S.Höfling S.Burger Al.Herkommer S.Rodt T.Huber K.Weber S.Thiele C.Jimenez L.Bremer H.Giessen S.Reitzenstein article GogneauCSCLTHJTH2022 2666 Nanoscale 2022 3 17 19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices piezoelectric nanowires, NW, AFM, stiffness, GaN, energy, harvesting https://pubs.rsc.org/en/Content/ArticleLanding/2022/NR/D1NR07863A EMPIR 2019: Energy Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/d1nr07863a NA N.Gogneau P.Chrétien T.Sodhi L.Couraud L.Leroy L.Travers J-C.Harmand F.H.Julien M.Tchernycheva F.Houzé article GeorgiKNSSTJ2022 2621 Medical Physics 2022 3 1-12 1-12 18NRM02: PRISM-eBT: Primary standards and traceable measurement methods for X-ray emitting electronic brachytherapy devices 1-12 dose verification, electronic brachytherapy, Monte Carlo dosimetry, plastic scintillators https://doi.org/10.1002/mp.15568 EMPIR 2018: Pre-Co-Normative Wiley 30 0094-2405, 2473-4209 10.1002/mp.15568 NA P.Georgi G.Kertzscher L.Nyvang J.Solc T.Schneider K.Tanderup J.G.Johansen article SunGLYCFJWBB2022 2588 Additive Manufacturing 2022 2 50 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 102558 Additive manufacturing, Surface texture, Reference standard, X-ray computed tomography https://www.sciencedirect.com/science/article/pii/S2214860421007053?via%3Dihub EMPIR 2017: Industry Elsevier BV 30 2214-8604 10.1016/j.addma.2021.102558 NA W.Sun C.Giusca S.Lou X.Yang X.Chen T.Fry X.Jiang A.Wilson S.Brown H.Boulter article JuradoCLLVdM2022 2544 Journal of the Association for Research in Otolaryngology 2022 2 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources loudness, DPOAE, infrasound EMPIR 2015: Health Springer Science and Business Media LLC 30 1525-3961, 1438-7573 10.1007/s10162-021-00830-2 NA C.Jurado M.Y.P.Chow K.M.L.Leung M.Larrea J.Vizuete A.de Cheveigné T.Marquardt proceedings SunCGLJBB2022 2584 Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022, 2022 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry calibration, X-ray computed tomography, additive manufacturing, Reference standard, surface texture, areal https://www.ndt.net/search/docs.php3?id=26568 EMPIR 2017: Industry Wels, Austria 11th Conference on Industrial Computed Tomography (iCT) 2022 08-02-2022 to 11-02-2022 30 NA https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id260.pdf W.Sun X.Chen C.Giusca S.Lou C.Jones H.Boulter S.Brown article DuKJMYCOMZ2022 2748 Physical Review Letters 2022 1 20 128 3 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems SU(1,1) interferometry, spin squeezing, entanglement EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 NA https://arxiv.org/abs/2004.14266 W.Du J.Kong . . . . J.Jia S.Ming C-H.Yuan J.F.Chen Z.Y.Ou M.W.Mitchell W.Zhang article HansenJJH2022 2518 Frontiers in Physics 2022 1 19 9 20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light 791459 metrology, Mueller ellipsometry, inverse modelling, scatterometry, nanostructures https://www.frontiersin.org/articles/10.3389/fphy.2021.791459/full EMPIR 2020: Fundamental Frontiers Media SA 30 2296-424X 10.3389/fphy.2021.791459 NA P-E.Hansen S.R.Johannsen S.A.Jensen P.Hansen article OanceaBPGJCOC2022 2657 Journal of Instrumentation 2022 1 17 01 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates C01003 MiniPIX Timepix3, Particle fluxes, Dose rates, FLASH electron beams, UHDpulse, electronradiotherapy https://doi.org/10.48550/arXiv.2201.13171 EMPIR 2018: Health IOP Publishing 30 1748-0221 10.1088/1748-0221/17/01/C01003 NA C.Oancea C.Bălan J.Pivec C.Granja J.Jakubek D.Chvatil V.Olsansky V.Chiș article MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022 2764 Nanoscale 2022 14 12 18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration 4690-4704 nanoparticle, concentration, standardization, VAMAS, interlaboratory EMPIR 2018: Support for Impact Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/D1NR07775A NA C.Minelli M.Wywijas D.Bartczak S.Cuello-Nuñez H.G.Infante J.Deumer C.Gollwitzer M.Krumrey K.E.Murphy M.E.Johnson A.R.Montoro Bustos I.H.Strenge B.Faure P.Høghøj V.Tong L.Burr K.Norling F.Höök M.Roesslein J.Kocic L.Hendriks V.Kestens Y.Ramaye M.C.Contreras Lopez G.Auclair D.Mehn D.Gilliland A.Potthoff K.Oelschlägel J.Tentschert H.Jungnickel B.C.Krause Y.U.Hachenberger P.Reichardt A.Luch T.E.Whittaker M.M.Stevens S.Gupta A.Singh F-h.Lin Y-H.Liu A.L.Costa C.Baldisserri R.Jawad S.E.L.Andaloussi M.N.Holme T.G.Lee M.Kwak J.Kim J.Ziebel C.Guignard S.Cambier S.Contal A.C.Gutleb J.“Kuba” Tatarkiewicz B.J.Jankiewicz B.Bartosewicz X.Wu J.A.Fagan E.Elje E.Rundén-Pran M.Dusinska I.P.Kaur D.Price I.Nesbitt S.O′ Reilly R.J.B.Peters G.Bucher D.Coleman A.J.Harrison A.Ghanem A.Gering E.McCarron N.Fitzgerald G.Cornelis J.Tuoriniemi M.Sakai H.Tsuchida C.Maguire A.Prina-Mello A.J.Lawlor J.Adams C.L.Schultz D.Constantin N.T.K.Thanh L.D.Tung L.Panariello S.Damilos A.Gavriilidis I.Lynch B.Fryer A.Carrazco Quevedo E.Guggenheim S.Briffa E.Valsami-Jones Y.Huang A.A.Keller V-T.Kinnunen S.Perämäki Z.Krpetic M.Greenwood A.G.Shard article GarberoglioHJ2021 2399 The Journal of Chemical Physics 2021 12 15 155 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 234103 Third dielectric virial coefficient, Path Integral Monte Carlo, Ab-initio calculation https://arxiv.org/abs/2111.02691 EMPIR 2018: SI Broader Scope AIP Publishing 30 1089-7690 NA 10.1063/5.0077684 G.Garberoglio A.Harvey B.Jeziorski article AssoulineJBWTJGKRPR2021 2371 Nature Physics 2021 12 17 12 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 1369-1374 Graphene, mangons, interferometry, p-n-junction https://arxiv.org/abs/2102.02068 EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 1745-2473, 1745-2481 10.1038/s41567-021-01411-z NA A.Assouline M.Jo P.Brasseur K.Watanabe T.Taniguchi Th.Jolicoeur D.C.Glattli N.Kumada P.Roche F.D.Parmentier P.Roulleau article ForbesJDE2021 2458 Measurement: Sensors 2021 12 18 1 17IND12: Met4FoF: Metrology for the Factory of the Future 100128 Gaussian processes, design of experiment, measurement uncertainty, sensor networks EMPIR 2017: Industry Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100128 NA A.Forbes K.Jagan J.Donlevy S.Eichstädt article GersakSNJFDRPSP2021 2330 Measurement: Sensors 2021 12 18 18RPT02: adOSSIG: Developing an infrastructure for improved and harmonised metrological checks of blood-pressure measurements in Europe 100260 Blood pressure, Sphygmomanometer, Simulator, Patient simulator, Oscillometry, Metrology EMPIR 2018: Research Potential Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100260 NA G.Geršak M.Schiebl M.Nawotka E.Jugo M. do C.Ferreira A.Duffy D.M.Rosu P.Pavlasek V.Sedlák D.Pražák article SedlakPSNJFDRPG2021 2331 Measurement: Sensors 2021 12 18 18RPT02: adOSSIG: Developing an infrastructure for improved and harmonised metrological checks of blood-pressure measurements in Europe 100283 Medical metrology, Smart specialisation concept, Metrological traceability, Intraocular pressure, Blood pressure EMPIR 2018: Research Potential Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100283 NA V.Sedlák D.Pražák M.Schiebl M.Nawotka E.Jugo M. do C.Ferreira A.Duffy D.M.Rosu P.Pavlasek G.Geršak article HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021 2336 NeuroImage 2021 11 241 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 118430 Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site EMPIR 2018: Health Elsevier BV 30 1053-8119 10.1016/j.neuroimage.2021.118430 NA S.C.N.Hui M.Mikkelsen H.J.Zöllner V.Ahluwalia S.Alcauter L.Baltusis D.A.Barany L.R.Barlow R.Becker J.I.Berman A.Berrington P.K.Bhattacharyya J.U.Blicher W.Bogner M.S.Brown V.D.Calhoun R.Castillo K.M.Cecil Y.B.Choi W.C.W.Chu W.T.Clarke A.R.Craven K.Cuypers M.Dacko C.de la Fuente-Sandoval P.Desmond A.Domagalik J.Dumont N.W.Duncan U.Dydak K.Dyke D.A.Edmondson G.Ende L.Ersland C.J.Evans A.S.R.Fermin A.Ferretti A.Fillmer T.Gong I.Greenhouse J.T.Grist M.Gu A.D.Harris K.Hat S.Heba E.Heckova J.P.Hegarty K-F.Heise S.Honda A.Jacobson J.F.A.Jansen C.W.Jenkins S.J.Johnston C.Juchem A.Kangarlu A.B.Kerr K.Landheer T.Lange P.Lee S.R.Levendovszky C.Limperopoulos F.Liu W.Lloyd D.J.Lythgoe M.G.Machizawa E.L.MacMillan R.J.Maddock A.V.Manzhurtsev M.L.Martinez-Gudino J.J.Miller H.Mirzakhanian M.Moreno-Ortega P.G.Mullins S.Nakajima J.Near R.Noeske W.Nordhøy G.Oeltzschner R.Osorio-Duran M.C.G.Otaduy E.H.Pasaye R.Peeters S.J.Peltier U.Pilatus N.Polomac E.C.Porges S.Pradhan J.J.Prisciandaro N.A.Puts C.D.Rae F.Reyes-Madrigal T.P.L.Roberts C.E.Robertson J.T.Rosenberg D-G.Rotaru R.L.O'Gorman Tuura M.G.Saleh K.Sandberg R.Sangill K.Schembri A.Schrantee N.A.Semenova D.Singel R.Sitnikov J.Smith Y.Song C.Stark D.Stoffers S.P.Swinnen R.Tain C.Tanase S.Tapper M.Tegenthoff T.Thiel M.Thioux P.Truong P.van Dijk N.Vella R.Vidyasagar A.Vovk G.Wang L.T.Westlye T.K.Wilbur W.R.Willoughby M.Wilson H-J.Wittsack A.J.Woods Y-C.Wu J.Xu M.Y.Lopez D.K.W.Yeung Q.Zhao X.Zhou G.Zupan R.A.E.Edden article TangSJHCMT2021 2730 Physical Review Research 2021 9 17 3 3 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems superradiance EMPIR 2017: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.3.033258 NA M.Tang S.A.Schäffer A.A.Jørgensen M.R.Henriksen B.T.R.Christensen J.H.Müller J.W.Thomsen article EdlerBGJTAASZ2021 2137 International Journal of Thermophysics 2021 8 42 11 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 1-13 Noble metal thermocouples, Reference function, Thermoelectric stability and homogeneity https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf. EMPIR 2017: Industry Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-021-02895-w NA F.Edler J.Bojkovski C.Garcia Izquerdo M.Jose Martin D.Tucker N.Arifovic S.L.Andersen L.Šindelárová V.Žužek article FuchsJKMB2021 2508 APL Photonics 2021 8 6 8 17FUN06: SIQUST: Single-photon sources as new quantum standards 086102 color centres, diamond, optical antenna, single-photon source https://aip.scitation.org/doi/10.1063/5.0057161 EMPIR 2017: Fundamental AIP Publishing 30 2378-0967 10.1063/5.0057161 NA P.Fuchs T.Jung M.Kieschnick J.Meijer C.Becher article TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021 2260 EJNMMI Physics 2021 7 23 8 1 15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom EMPIR 2015: Health Springer Science and Business Media LLC 30 2197-7364 10.1186/s40658-021-00397-0 NA J.Tran-Gia A.M.Denis-Bacelar K.M.Ferreira A.P.Robinson N.Calvert A.J.Fenwick D.Finocchiaro F.Fioroni E.Grassi W.Heetun S.J.Jewitt M.Kotzassarlidou M.Ljungberg D.R.McGowan N.Scott J.Scuffham K.S.Gleisner J.Tipping J.Wevrett M.Bardiès S.Berenato I.Bilas C.Bobin M.Capogni M.Chauvin S.COLLINS M.Cox J.Dabin M.D’Arienzo J.Gustafsson A.Hallam T.Kalathas G.Kayal G.Lorusso F-J.Maringer D.Morgan V.Smyth J.Solc L.Štemberková L.Struelens A.Vergara-Gil H.Wiedner M.Lassmann article NissilaFKMIJBKKOBMGK2021 2138 Applied Physics Letters 2021 7 19 119 3 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 032601 Josephson voltage standard, Josephson effect, Superconducting device, Laser, Photodiode EMPIR 2015: SI Broader Scope AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0060804 NA J.Nissilä T.Fordell K.Kohopää E.Mykkänen P.Immonen R.N.Jabdaraghi E.Bardalen O.Kieler B.Karlsen P.A.Øhlckers R.Behr A.J.Manninen J.Govenius A.Kemppinen article AmerWJA2021 2343 Sensors 2021 6 29 21 13 17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures 4470 dynamic pressure, shock tube, fast-opening valve, repeatability https://www.mdpi.com/1424-8220/21/13/4470 EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s21134470 NA E.Amer M.Wozniak G.Jönsson F.Arrhén techreport CoxJR2021 2192 National Physical Laboratory 2021 4 28 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations implant safety, magnetic resonance imaging, MR safety EMPIR 2017: Industry National Physical Laboratory 30 10.47120/npl.MS28 NA M.Cox K.Jagan S.Rajan article GanikiRJKH2021 2034 Sensors 2021 4 21 7 16ENV01: MercOx: Metrology for oxidised mercury 2501 Gaseous oxidized mercury, calibration, traceability, 197-Hg EMPIR 2016: Environment MDPI AG 30 1424-8220 10.3390/s21072501 NA J.Gačnik I.Živković S.Ribeiro Guevara R.Jaćimović J.Kotnik M.Horvat article RobertsonSPJ2021 2728 Computer Physics Communications 2021 4 261 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 107814 Alkaline earth atomsDivalent atomsAlkali atomsRydberg statesAtom–surface van der Waals interactionQuantum technologiesNeutral-atom quantum computingAtom-based sensors EMPIR 2017: Fundamental Elsevier BV 30 0010-4655 10.1016/j.cpc.2020.107814 NA E.J.Robertson N.Šibalić R.M.Potvliege M.P.A. Jones article JoBAFSWTDRGKPR2021 2125 Physical Review Letters 2021 4 126 14 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 146803 Graphene, electron interferometer, Mach-Zehnder, Quantum Hall Valley Beam Splitter https://arxiv.org/abs/2011.04958 EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.126.146803 NA M.Jo P.Brasseur A.Assouline G.Fleury H-S.Sim K.Watanabe T.Taniguchi W.Dumnernpanich P.Roche D.C.Glattli N.Kumada F.D.Parmentier P.Roulleau article JobbagyMS2021 1920 Journal of Radioanalytical and Nuclear Chemistry 2021 2 25 16ENV10: MetroRADON: Metrology for radon monitoring radon emanation, chemisorption, drop deposition, radon-in-water EMPIR 2016: Environment Springer Science and Business Media LLC 30 0236-5731, 1588-2780 10.1007/s10967-021-07630-1 NA V.Jobbágy M.Marouli H.Stroh article LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021 2093 Nanotechnology 2021 2 32 16 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 162003 Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap EMPIR 2017: Fundamental IOP Publishing 30 0957-4484, 1361-6528 10.1088/1361-6528/abb333 NA A.Laucht F.Hohls N.Ubbelohde M.Fernando Gonzalez-Zalba D.J.Reilly S.Stobbe T.Schröder P.Scarlino J.V.Koski A.Dzurak C-H.Yang J.Yoneda F.Kuemmeth H.Bluhm J.Pla C.Hill J.Salfi A.Oiwa J.T.Muhonen E.Verhagen M.D.LaHaye H.H.Kim A.W.Tsen D.Culcer A.Geresdi J.A.Mol V.Mohan P.K.Jain J.Baugh article JenningerABBDGISJKRSSSTTW2021 1775 Vacuum 2021 1 183 16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge 109884 Ionisation gauge, Hot cathode, Sensitivity, Simulation, Reference standard EMPIR 2016: Pre-Co-Normative Elsevier BV 30 0042-207X 10.1016/j.vacuum.2020.109884 NA B.Jenninger J.Anderson M.Bernien N.Bundaleski H.Dimitrova M.Granovskij C.Illgen J.Šetina K.Jousten P.Kucharski C.Reinhardt F.Scuderi R.A.S.Silva A.Stöltzel O.M.N.D.Teodoro B.Trzpil-Jurgielewicz M.Wüest article BernienGIDKBJ2021 2648 Measurement: Sensors 2021 18 December 2 20SIP01: ISO Gauge: Developing an ISO Technical Specification "Characteristics for a stable ionisation vacuum gauge" 100202 Ionization vacuum gaugeSensitivityLow currentTraceable measurementsMetrology EMPIR 2020: Support for Impact Elsevier Ltd 30 2665-9174 10.1016/j.measen.2021.100202 NA M.Bernien M.Götz C.Illgen D.Drung C.Krause T.Bock K.Jousten article VicarJJIBJBBST2021 2647 VACUUM 2021 189 2021 20SIP01: ISO Gauge: Developing an ISO Technical Specification "Characteristics for a stable ionisation vacuum gauge" 110239 Ionisation vacuum gaugeHot cathodeSensitivitySecondary electronsIon induced secondary electron yield https://arxiv.org/abs/2103.03566 EMPIR 2020: Support for Impact Elsevier Ltd 30 0042-207X 10.1016/j.vacuum.2021.110239 NA M.Vicar G.Jönnson B.Jenninger C.Illgen N.Bundaleski K.Jousten F.Boineau M.Bernien J.Šetina O.Teodoro proceedings JiangPSHHMDOMPG2021 2553 ISH 2021 2021 19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes Voltage Divider, RCR Divider, Capacitor SEG EMPIR 2019: Pre-Co-Normative ISH 2021 online 22nd International Symposium on High Voltage Engineering 21-11-2021 to 25-11-2021 30 NA https://zenodo.org/record/6073729 H.Jiang O.Pischler U.Schichler J.Havunen J.Hällström A.Merev S.Dedeoğlu S.Özer J.Meisner S.Passon F.Gerdinand article ForssenSSJBHAZ2020 1786 ACTA IMEKO 2020 12 31 9 5 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 287-292 Refractometry; Pressure; Gas Modulation, GAMOR; Transportable https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09%20%282020%29-05-59 EMPIR 2018: SI Broader Scope IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i5.986 NA C.Forssén I.Silander D.Szabo G.Jönsson M.Bjerling T.Hausmaninger O.Axner M.Zelan article ChouhanJHBGSBH2020 2033 Nano Select 2020 12 30 2 4 16ENV01: MercOx: Metrology for oxidised mercury 712-743 sorbent traps, tri‐s‐triazine‐based graphitic carbon nitride, nanostructured material, sonsors, mercury EMPIR 2016: Environment Wiley 30 2688-4011, 2688-4011 10.1002/nano.202000228 NA R.S.Chouhan I.Jerman D.Heath S.Bohm S.Gandhi V.Sadhu S.Baker M.Horvat article SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020 1841 Physica Medica 2020 12 80 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 134-150 Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project EMPIR 2018: Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2020.09.020 NA A.Schüller S.Heinrich C.Fouillade A.Subiel L.De Marzi F.Romano P.Peier M.Trachsel C.Fleta R.Kranzer M.Caresana S.Salvador S.Busold A.Schönfeld M. McEwen F.Gomez J.Solc C.Bailat V.Linhart J.Jakubek J.Pawelke M.Borghesi R-P.Kapsch A.Knyziak A.Boso V.Olsovcova C.Kottler D.Poppinga I.Ambrozova C-S.Schmitzer S.Rossomme M-C.Vozenin article LesiukPJ2020 1835 Physical Review A 2020 11 17 102 5 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 052816 dielectric properties, noble gases, neon, polarisability, magnetic susceptibility https://arxiv.org/abs/2006.15448 EMPIR 2018: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.102.052816 NA M.Lesiuk M.Przybytek B.Jeziorski article KokurewiczSBSKHMKJ2020 1842 Frontiers in Physics 2020 11 13 8 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates Dosimetry, FLASH beams, Absorbed dose, ultra-high pulse dose rates, High Energy Electron Accelerators EMPIR 2018: Health Frontiers Media SA 30 2296-424X 10.3389/fphy.2020.568302 NA K.Kokurewicz A.Schüller E.Brunetti A.Subiel R.Kranzer T.Hackel M.Meier R-P.Kapsch D.A.Jaroszynsk article IllgenJTBF2020 1695 Vacuum 2020 11 16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge 109907 Ion induced secondary electron emissionIonisation vacuum gaugesXPS https://arxiv.org/abs/2011.08568 EMPIR 2016: Pre-Co-Normative Elsevier BV 30 0042-207X 10.1016/j.vacuum.2020.109907 NA C.Illgen K.Jousten O.M.N.D.Teodoro N.Bundaleski I.Figueiredo article CzachorowskiPLPJ2020 2710 Physical Review A 2020 10 12 102 4 18SIB02: Real-K: Realising the redefined kelvin coefficient, Second virial https://arxiv.org/abs/2007.09767 EMPIR 2018: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.102.042810 NA P.Czachorowski M.Przybytek M.Lesiuk M.Puchalski B.Jeziorski article MantouvalouJSMKWHWGBGD2020 1689 Spectrochimica Acta Part B: Atomic Spectroscopy 2020 10 10 174 17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques 105995 GIXRFMultilayer characterization https://arxiv.org/abs/2006.12198 EMPIR 2017: Support for Impact Elsevier BV 30 0584-8547 10.1016/j.sab.2020.105995 NA I.Mantouvalou P.Jonnard V.Szwedowski-Rammert E.Meltchakov B.Kanngießer M.Wu P.Honicke U.Waldschläger A.Gross J.Baumann G.Goetzke F.Delmotte article BergstrandJH2020 1643 Journal of Geodesy 2020 10 94 10 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 105 Antenna, Calibration, GNSS, Local tie, Phase center offset, Phase center variation, Terrestrial reference frame, PCC, PCO, PCV, TRF EMPIR 2018: SI Broader Scope Springer Science and Business Media LLC 30 0949-7714, 1432-1394 10.1007/s00190-020-01433-0 NA S.Bergstrand P.Jarlemark M.Herbertsson article JandaGOPUHRSMRNCHWEACDMORONJKZ2020 1683 Physical Review Materials 2020 9 28 4 9 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 094413-1 to 094413-9 - https://arxiv.org/abs/2004.05460 EMPIR 2016: Energy American Physical Society (APS)

1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States

30 2475-9953 10.1103/PhysRevMaterials.4.094413 NA T.Janda J.Godinho T.Ostatnicky E.Pfitzner G.Ulrich A.Hoehl S.Reimers Z.Šobáň T.Metzger H.Reichlová V.Novák R. P.Campion J.Heberle P.Wadley K. W.Edmonds O. J.Amin J. S.Chauhan S. S.Dhesi F.Maccherozzi R. M.Otxoa P. E.Roy K.Olejník P.Němec T.Jungwirth B.Kaestner FrancoisZiade article WelshvBCHLLLvNTWWJ2020 1707 Journal of Extracellular Vesicles 2020 9 24 9 1 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses 1816641 Calibration; exosomes; extracellular vesicles; microvesicles; optical analysis; reference materials; standardization; quality control; validation EMPIR 2018: Health 30 2001-3078 10.1080/20013078.2020.1816641 NA J.A. Welsh E.van der Pol B.A. Bettin D.R.F. Carter A.Hendrix M.Lenassi M-A. Langlois A.Llorente A.S.van de Nes R.Nieuwland V.Tang L.Wang K.W. Witwer J.C. Jones article WilsonSSJR2020 1581 IEEE Transactions on Terahertz Science and Technology 2020 9 10 5 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 453-459 Rectangular waveguide, submillimeter-waves, terahertz, waveguide flanges, waveguide interfaces, waveguidestandards EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 2156-342X, 2156-3446 10.1109/TTHZ.2020.3010122 NA AlanWilson WenjuanSun XiaobangShang SusanJohny Nick M.Ridler article ivkoviBKJH2020 2030 Atmosphere 2020 7 24 11 8 16ENV01: MercOx: Metrology for oxidised mercury 780 Mercury, sorbent traps, atmosphere, traceability EMPIR 2016: Environment MDPI AG 30 2073-4433 10.3390/atmos11080780 NA I.Živković S.Berisha J.Kotnik M.Jagodic MilenaHorvat article SixOMLLJHBBLHYTYM2020 1577 Rapid Communications in Mass Spectrometry 2020 6 16 34 20 16ENV06: SIRS: Metrology for stable isotope reference standards 14/e8858 nitrous oxide, isotopic composition, isotope ratio mass spectrometry, laser spectroscopy https://www.dora.lib4ri.ch/empa/islandora/object/empa:22957 EMPIR 2016: Environment John Wiley & Sons 30 10.1002/rcm.8858 NA LongfeiYu ElizaHarris DominikaLewicka‐Szczebak MattiBarthel MargaretaBlomberg Stephen J.Harris Matthew S.Johnson Moritz F.Lehmann JesperLiisberg ChristophMüller Nathaniel E.Ostrom JohanSix SakaeToyoda NaohiroYoshida JoachimMohn article SetinaTIBBJVW2020 1519 Vacuum 2020 6 10 179 16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge Ionisation gauge, Hot cathode, Sensitivity, Secondary electrons, Electron stimulated desorption EMPIR 2016: Pre-Co-Normative Elsevier

Munich

30 0042-207X 10.1016/j.vacuum.2020.109545 NA K.Jousten F.Boineau N.Bundaleski C.Illgen J.Šetina O.M.N.D.Teodoro M.Vicar M.Wüest article PradyumnaLRTZJADGG2020 1574 Communications Physics 2020 6 3 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 104 Optical physicsQuantum metrologyQuantum optics https://www.nature.com/articles/s42005-020-0368-5#Bib1 EMPIR 2017: Fundamental Nature Research

233 Spring St. New York NY 10013 United States

30 2399-3650 10.1038/s42005-020-0368-5 NA S. T.Pradyumna E.Losero I.Ruo-Berchera P.Traina M.Zucco C. S.Jacobsen U. L.Andersen I. P.Degiovanni M.Genovese T.Gehring article QueleverGAJ2020 1530 Sensors 2020 5 23 20 10 16NRM07: Vector SAR: SAR measurement using vector probes 2956 dielectric measurement; process monitoring; open-ended coaxial probe; specificabsorption rate (SAR); tissue-equivalent materials EMPIR 2016: Pre-Co-Normative MDPI AG 30 1424-8220 10.3390/s20102956 NA Andrew P.Gregory KristellQuéléver DjamelAllal Ourouk Jawad article KongJTLTM2020 2746 Nature Communications 2020 5 15 11 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems Sensing beyond QSL, entanglement, hot atoms EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-020-15899-1 | NA J.Kong R.Jiménez-Martínez C.Troullinou V.G.Lucivero G.Tóth M.W.Mitchell article WangJW2020 1621 IEEE Transactions on Instrumentation and Measurement 2020 5 69 5 16ENG07: MultiFlowMet II: Multiphase flow reference metrology 1948-1961 gas-oil-water three phase, measurement, visualisation, data fusion, fuzzy logic method http://eprints.whiterose.ac.uk/149072/ EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2019.2923864 NA Q.Wang X.Jia M.Wang article FrisvadJMCYGMH2020 1849 Computer Graphics Forum 2020 5 39 2 18SIB03: BxDiff: New quantities for the measurement of appearance 729-755 Appearance, graphics, BRDF, BTDF, BSSRDF, https://diglib.eg.org/handle/10.1111/cgf14023 EMPIR 2018: SI Broader Scope Wiley 30 0167-7055, 1467-8659 10.1111/cgf.14023 NA J.R.Frisvad S.A.Jensen J.S.Madsen A.Correia L.Yang S.K.S.Gregersen Y.Meuret P‐E.Hansen article MartinezABNVJHKVKL2020 1488 Measurement Science and Technology 2020 4 23 15SIB09: 3DNano: Traceable three-dimensional nanometrology nanometrology, transfer standard, calibration, CSI, SWLI, AFM, traceability EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab8c6a NA V.Heikkinen I.Kassamakov T.Viitala M.Järvinen T.Vainikka A.Nolvi C.Bermudez R.Artigas P.Martinez V.Korpelainen A.Lassila proceedings TeniouJPA2020 1617 2020 14th European Conference on Antennas and Propagation (EuCAP) 2020 3 2020 14th 16NRM07: Vector SAR: SAR measurement using vector probes 1-5 SAR, RF Exposure, MIMO, Planar near field measurement, Vector field measurements, Active- Antenna Measurement https://hal.archives-ouvertes.fr/hal-02954816 EMPIR 2016: Pre-Co-Normative IEEE Copenhagen 2020 14th European Conference on Antennas and Propagation (EuCAP) 15-03-2020 to 20-03-2020 30 10.23919/EuCAP48036.2020.9135506 NA M.Teniou O.Jawad S.Pannetrat L.Aberbour article LerouxHHJA2020 1483 SciPost Physics 2020 3 8 3 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems optical tweezers, atomic imaging EMPIR 2017: Fundamental Stichting SciPost 30 2542-4653 10.21468/SciPostPhys.8.3.038 NA N.Jackson R.Hanley M.Hill F.Leroux C.Adams article JonesPS2020 2731 Physical Review Research 2020 3 2 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems Rydberg states, Standard Model, new physics beyond SM EMPIR 2017: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.2.013244 NA M.P.A. Jones R.M.Potvliege M.Spannowsky article JeziorskiLSP2020 1437 Physical Review A 2020 2 18 101 2 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 022505 Electron correlation calculations for atoms & ionsElectronic structure of atoms & moleculesFine & hyperfine structureRelativistic & quantum electrodynamic effects in atoms, molecules,& ions https://arxiv.org/abs/1912.12242 EMPIR 2018: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.101.022505 NA M.Puchalski K.Szalewicz M.Lesiuk B.Jeziorski article OverneyPBKBJ2020 1546 Measurement Science and Technology 2020 1 31 31 5 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 055004 Load compensation bridge for Josephson arbitrary EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab62c7 NA F.Overney Y.Pimsut S.Bauer O.Kieler R.Behr B.Jeanneret article WiekhorstLMSJB2020 1504 Sensors 2020 1 29 20 3 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 753 magnetic nanoparticles; optically pumped magnetometers; magnetorelaxometry imaging https://www.mdpi.com/1424-8220/20/3/753/htm EMPIR 2016: Pre-Co-Normative MDPI AG 30 1424-8220 10.3390/s20030753 NA A.Jaufenthaler P.Schier T.Middelmann M.Liebl F.Wiekhorst D.Baumgarten article ChristensenJHTS2020 1498 Physical Review A 2020 1 101 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems superradiant laser, optical clock, ultra narrow laser EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.101.013819 NA S.A.Schäffer M.Tang M.R.Henriksen A.A.Jørgensen B.T.R.Christensen article LofdahlJFKKL2020 1619 Nanomaterials 2020 10 9 18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants 1868 silver nanoparticles; human lung fibroblasts; precision-cut lung slices; toxicity;extracellular matrix; procollagen; growth factors; cytokines EMPIR 2018: Health 30 10.3390/nano10091868 NA A.Löfdahl A.Jern S.Flyman M.Kåredal H.L.Karlsson A-K. Larsson-Callerfelt proceedings ZhangHLBAJN2019 1422 2019 Computing in Cardiology Conference (CinC) 2019 12 30 46 18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management 097 Symmetric Projection Attractor Reconstruction, ECG signals, transfer learning http://www.cinc.org/archives/2019/pdf/CinC2019-097.pdf EMPIR 2018: Health Computing in Cardiology Singapore Computing in Cardiology 08-09-2019 to 11-09-2019 30 2325-887X 10.22489/CinC.2019.097 NA P.Aston J.Lyle E.Bonet-Luz C.Huang Y.Zhang K.Jeevaratnam M.Nandi article JeneiPZTRTCSMD2019 1545 Physical Review Research 2019 12 10 1 3 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere Waiting time distributions in a two-level fluctuator coupled to a superconducting charge detector EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2643-1564 10.1103/physrevresearch.1.033163 NA M.Jenei E.Potanina R.Zhao K.Y.Tan A.Rossi T.Tanttu K.W.Chan V.Sevriuk M.Möttönen A.Dzurak article PanuJTS2019 1309 Measurement Science and Technology 2019 12 31 3 16ENV01: MercOx: Metrology for oxidised mercury 034001 evaporation, traceability, reference gas, gas generator, gas flow, reactivecompounds, mercury EMPIR 2016: Environment IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab4d68 NA S.Sari R.Timo H.Jussi H.Panu article KashcheyevsFBJLSGFRK2019 1312 Nature Communications 2019 11 22 10 1 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements Single electron, Electron wave packet, Tomography EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-019-13222-1 NA J. D.Fletcher N.Johnson E.Locane P.See J. P.Griffiths I.Farrer D. A.Ritchie P. W.Brouwer V.Kashcheyevs M.Kataoka article BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019 2340 International Journal of Environmental Research and Public Health 2019 11 21 16ENV10: MetroRADON: Metrology for radon monitoring radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability EMPIR 2016: Environment 30 10.3390/ijerph182212150 NA T.R.Beck A.Antohe F.Cardellini A.Cucoş E.Fialova C.Grossi K.Hening J.Jensen D.Kastratović M.Krivošík P.Lobner A.Luca F.J.Maringer N.Michielsen P.P.S.Otahal L.Quindos D.Rabago C.Sainz L.Szücs T.Teodorescu C.Tolinsson C.L.Tugulan T.Turtiainen A.Vargas J.Vosahlik G.Vukoslavovic H.Wiedner K.Wołoszczuk article KlauiJPDGVCC2019 1308 Communications Physics 2019 11 15 2 1 17FUN08: TOPS: Metrology for topological spin structures 145 Skyrmion, MFM https://www.nature.com/articles/s42005-019-0242-5#article-info EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2399-3650 10.1038/s42005-019-0242-5 NA A.Casiraghi H.Corte-León M.Vafaee F.Garcia-Sanchez G.Durin M.Pasquale G.Jakob M.Kläui article KlauiJPDGVCC20190 1308 Communications Physics 2019 11 15 2 1 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 145 Skyrmion, MFM https://www.nature.com/articles/s42005-019-0242-5#article-info EMPIR 2015: SI Broader Scope Springer Science and Business Media LLC 30 2399-3650 10.1038/s42005-019-0242-5 NA A.Casiraghi H.Corte-León M.Vafaee F.Garcia-Sanchez G.Durin M.Pasquale G.Jakob M.Kläui article BochudNHLJJ2019 1231 Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment 2019 10 942 21 October 15SIB10: MetroBeta: Radionuclide beta spectra metrology 162384 magnetic spectrometer, beta shape measurement, acquisition system, Cl-36 https://reader.elsevier.com/reader/sd/pii/S0168900219309684?token=9907411027790E1C7A6500A4337D2D10E57E40E772BECF66298808C0FD62E4F989D02F38F9DA80F8EEB0FCC5EF556A53 EMPIR 2015: SI Broader Scope Elsevier BV 30 0168-9002 10.1016/j.nima.2019.162384 NA F.Juget F.Juget G.Lorusso G.Haefeli Y.Nedjadi F.Bochud proceedings KehrtJS2019 1445 2019 44th International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz) 2019 9 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies Optical waveguides, Power measurement, Detectors, Antenna measurements, Horn antennas https://oar.ptb.de/files/download/5e5d0f6f4c93903e3800394c EMPIR 2018: SI Broader Scope IEEE Paris 2019 44th International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz) 01-09-2019 to 06-09-2019 30 NA M.Kehrt R.Judaschke A.Steiger proceedings SauzayRJBBWS2019 1302 Proceedings of the 21st International Symposium on High Voltage Engineering 2019 8 30 17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors power transformers, losses, measurement, uncertainty. SEG EMPIR 2017: Pre-Co-Normative Budapest 21st International Symposium on High Voltage Engineering 26-08-2019 to 30-08-2019 30 10.5281/zenodo.3559837 NA M.Sauzay G.Rietveld B.Jönsson A.Bergman A.Bergman J.Walmsley J-B.Sund inbook RuttingerPGCPSKBJSBSWWS2019 1193 2019 8 23 Advances i 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 316-326 magnetic nanoparticles, standardisation European research https://arxiv.org/abs/1905.08791 EMPIR 2016: Pre-Co-Normative Springer International Publishing

Cham

Current Trends in Biomedical Engineering and Bioimages Analysis. PCBEE 2019. 30 978-3-030-29884-5 10.1007/978-3-030-29885-2_29 NA PeterSchier CraigBarton SimoSpassov ChristerJohansson DanielBaumgarten OlgaKazakova PaulSouthern QuentinPankhurst MarcoCoisson CordulaGrüttner AlexPrice RomanRüttinger FrankWiekhorst JamesWells UweSteinhoff article ChouhaniFiPBJVH2019 2041 Sensors 2019 8 19 15 16ENV01: MercOx: Metrology for oxidised mercury 3432 Nanostructure Knitting based Passive Sampler , Hg2+, Water EMPIR 2016: Environment MDPI AG 30 1424-8220 10.3390/s19153432 NA R.S.Chouhan G.Žitko V.Fajon I.Živković M.Pavlin S.Berisha I.Jerman A.Vesel M.Horvat article GennserCPBBMCKCRMBJDH2019 1311 Nature Communications 2019 7 29 10 1 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements Electronic wavefunction, Quantum tomography EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-019-11369-5 NA R.Bisognin A.Marguerite B.Roussel M.Kumar C.Cabart C.Chapdelaine A.Mohammad-Djafari J.-M.Berroir E.Bocquillon B.Plaçais A.Cavanna U.Gennser Y.Jin P.Degiovanni G.Fève article MichlerJPPON2019 1292 Applied Physics Letters 2019 7 115 2 17FUN06: SIQUST: Single-photon sources as new quantum standards 023103-5 InAs/InGaAs/GaAs quantum dots, telecom C-band, Fourier-transform spectroscopy, two-photon excitation https://aip.scitation.org/doi/full/10.1063/1.5095196 EMPIR 2017: Fundamental AIP Publishing 30 0003-6951, 1077-3118 10.1063/1.5095196 NA C.Nawrath F.Olbrich M.Paul S.L.Portalupi M.Jetter P.Michler article NawrathOPPJM2019 1808 Applied Physics Letters 2019 7 115 2 17FUN06: SIQUST: Single-photon sources as new quantum standards 023103 Quantum dotsSemiconductorsFourier transform spectroscopyExcitonsQuantum information EMPIR 2017: Fundamental AIP Publishing 30 0003-6951, 1077-3118 10.1063/1.5095196 NA C.Nawrath F.Olbrich M.Paul S.L.Portalupi M.Jetter P.Michler article RoscoeRJDW2019 1185 IEEE Transactions on Instrumentation and Measurement 2019 6 68 6 15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids 1688-1695 ROCOF, Instruments, Frequency measurement, Phase measurement, Relays, Power system stability, Phasor measurement units, Sea measurements, SEG EMPIR 2015: Pre-Co-Normative Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2018.2882907 NA P..Wright P.Davis K.Johnstone G.Rietveld A. J.Roscoe article OliveroBOFCJGSPBFHBER2019 1261 Advanced Quantum Technologies 2019 5 20 2 5-6 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1900006 diamond, ion‐beam irradiation, nitrogen vacancies ,NV magnetometry, quantum sensing, ultrafast laser writing EMPIR 2017: Fundamental Wiley 30 2511-9044, 2511-9044 10.1002/qute.201900006 NA http://hdl.handle.net/2318/1704485 S.M.Eaton J.P.Hadden V.Bharadwaj J.Forneris F.Picollo F.Bosia B.Sotillo A.N.Giakoumaki O.Jedrkiewicz A.Chiappini M.Ferrari R.Osellame P.E.Barclay P.Olivero R.Ramponi article RaaymakersJWvdWd2019 1046 Physics in Medicine and Biology 2019 4 15HLT08: MRgRT: Metrology for MR guided radiotherapy absorbed dose, MRgRT, kB, kQ, magnetic field https://iopscience.iop.org/article/10.1088/1361-6560/ab1511/pdf EMPIR 2015: Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ab1511 NA L.A.de Prez S.J.Woodings J.A.de Pooter B.van Asselen J.W.H.Wolthaus B.J.Jansen B.W.Raaymakers article MarquardtJ2019 1069 Journal of Low Frequency Noise, Vibration and Active Control 2019 3 25 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources 146134841983386 Vestibular-evoked myogenic potentials, wind turbines, infrasound and low-frequency hearing, wind-turbine noise syndrome, hearing and balance EMPIR 2015: Health SAGE Publications 30 1461-3484, 2048-4046 10.1177/1461348419833868 NA C.Jurado T.Marquardt article WangJW2019 1620 Measurement Science and Technology 2019 3 14 30 4 16ENG07: MultiFlowMet II: Multiphase flow reference metrology 045303 electrical tomography, 3D visualisation, flow regimes, bubble imaging EMPIR 2016: Energy IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab06a9 NA Q.Wang X.Jia M.Wang article NeuCJBPKC2019 1305 Journal of Applied Physics 2019 2 14 125 6 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 060901 MFM https://aip.scitation.org/doi/10.1063/1.5050712 EMPIR 2015: SI Broader Scope AIP Publishing 30 0021-8979, 1089-7550 10.1063/1.5050712 NA O.Kazakova R.Puttock C.Barton H.Corte-León HectorCorte-Leon M.Jaafar V.Neu article JohnenRMDEK2019 1052 Physics in Medicine & Biology 2019 2 64 4 15HLT08: MRgRT: Metrology for MR guided radiotherapy 04NT02 MRgRT EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aafef0 NA A.Elter S.Dorsch P.Mann A.Runz W.Johnen C.P.Karger article WittkamperPJdd2019 1140 Physics in Medicine & Biology 2019 1 31 64 3 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 039501 dosimetry, primary standard, flattening filter free, absorbed dose to water, kQ, code of practice, ion chamber https://iopscience.iop.org/article/10.1088/1361-6560/aaaa93/pdf EMPIR 2016: Pre-Co-Normative IOP Publishing 30 1361-6560 10.1088/1361-6560/aafa85 NA L.de Prez J.de Pooter B.Jansen T.Perik F.Wittkämper article KokvvWWJddR2019 1045 Physics in Medicine & Biology 2019 1 29 64 3 15HLT08: MRgRT: Metrology for MR guided radiotherapy 035013 dosimetry, MRgRT, primary standard, magnetic field, MRI-linac, calorimetry https://iopscience.iop.org/article/10.1088/1361-6560/aaf975 EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aaf975 NA L.de Prez J.de Pooter B.Jansen S.Woodings J.Wolthaus B.van Asselen T.van Soest J.Kok B.Raaymakers article JohnsonKCE2019 1148 Physical Review B 2019 1 22 99 4 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 045306 electron quantum optics, hot electron, energy relaxation, phonon https://arxiv.org/abs/1807.11814 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.99.045306 NA C.Emary L.A.Clark M.Kataoka N.Johnson article HashadEJS2019 805 Measurement 2019 1 131 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range 723-729 Primary pressure standard, Effective area, FPG characterization, Rarefied gas flow, https://www.sciencedirect.com/science/article/pii/S0263224118308443 EMPIR 2014: Industry Elsevier BV 30 0263-2241 10.1016/j.measurement.2018.09.016 NA A.S.Hashad S.Ehlers O.Jusko W.Sabuga article JarosovaKBPN2019 975 Frontiers in Endocrinology 2019 1 9 785 16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements 1-7 intraocular pressure, hypoxia, normobaric hypoxia, glaucoma, oxygen saturation https://www.frontiersin.org/research-topics/6935/the-role-of-hypoxia-in-the-regulation-of-metabolism EMPIR 2016: Research Potential Frontiers Media SA 30 1664-2392 10.3389/fendo.2018.00785 NA E.Najmanová F.Pluháček M.Botek J.Krejčí J.Jarošová article MarquardtJ2019_2 1491 Archives of Acoustics 2019 45 2 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources 313–319 low-frequency hearing; frequency-following response; infrasound; auditory brain https://discovery.ucl.ac.uk/id/eprint/10096761/ EMPIR 2015: Health 30 10.24425/aoa.2020.133151 NA T.Marquardt C.Jurado proceedings FateevPDJAWSSHSLAS2018 1022 Journal of Physics: Conference Series 2018 12 1065 2018 17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures 162015 dynamic pressure, dynamic temperature, traceability, measurement standard, calibration method, calibration procedure, measurement uncertainty, validation, reliability, pressure measurement, temperature measurement EMPIR 2017: Industry IOP Publishing Belfast XXII World Congress of the International Measurement Confederation (IMEKO 2018) 03-09-2018 to 06-09-2018 30 10.1088/1742-6596/1065/16/162015 NA S.Saxholm S.Saxholm R.Högström C.Sarraf G.Sutton R.Wynands F.Arrhén G.Jönsson Y.Durgut A.Peruzzi A.Fateev M.Liverts C.Adolfse article JaksiMODPCMTSSKDHLDGF2018 1009 ACS Photonics 2018 11 12 5 12 17FUN06: SIQUST: Single-photon sources as new quantum standards 4864-4871 color centers; diamond; ion implantation; lead; photoluminescence; single-photon source EMPIR 2017: Fundamental American Chemical Society (ACS) 30 2330-4022, 2330-4022 10.1021/acsphotonics.8b01013 NA S.Ditalia Tchernij T.Lühmann T.Herzig J.Küpper A.Damin S.Santonocito M.Signorile P.Traina E.Moreva F.Celegato S.Pezzagna I. P.Degiovanni P.Olivero M.Jakšić J.Meijer P. M.Genovese J.Forneris article JaksiMODPCMTSSKDHLDGF20180 1009 ACS Photonics 2018 11 12 5 12 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 4864-4871 color centers; diamond; ion implantation; lead; photoluminescence; single-photon source EMPIR 2017: Fundamental American Chemical Society (ACS) 30 2330-4022, 2330-4022 10.1021/acsphotonics.8b01013 NA S.Ditalia Tchernij T.Lühmann T.Herzig J.Küpper A.Damin S.Santonocito M.Signorile P.Traina E.Moreva F.Celegato S.Pezzagna I. P.Degiovanni P.Olivero M.Jakšić J.Meijer P. M.Genovese J.Forneris proceedings JohannHDM2018 856 2018 Conference on Precision Electromagnetic Measurements 2018 10 22 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients X-ray, High voltage, Transient, Impulse voltage, Déconvolution, Practical Peak Voltage https://ieeexplore.ieee.org/document/8500915 EMPIR 2015: Pre-Co-Normative Paris 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 08-07-2018 to 13-07-2018 30 978-1-5386-0974-3 2160-0171 10.5281/zenodo.1471188 NA P.Johann S.Hanane F.Dominique A.Mohamed article JakubowskiLKNPTRES2018 937 Neurology - Neuroimmunology Neuroinflammation 2018 10 19 6 1 15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease e515 Gadolinium, Gadolinium-based contrast agents, Human brain, MRI, LA-ICP-MS, Iron, Copper, Phosphorus http://nn.neurology.org/content/6/1/e515/ EMPIR 2015: Health Ovid Technologies (Wolters Kluwer Health) 30 2332-7812 10.1212/NXI.0000000000000515 NA A.H.El-Khatib H.Radbruch S.Trog B.Neumann F.Paul A.Koch M.W.Linscheid N.Jakubowski E.Schellenberger article PepperRFJGFSSREJJK2018 1113 Physical Review Letters 2018 9 26 121 13 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere Single electron pumps, hot electron transport, phonon emission, phonon relaxation, optical phonons, edge states, electron optics, electron quantum optics https://arxiv.org/abs/1712.09031 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.121.137703 NA N.Johnson C.Emary S.Ryu H.S.Sim P.See J.D.Fletcher J.P.Griffiths G.A.C.Jones I.Farrer D.A.Ritchie M.Pepper T.J.B.M.Janssen M.Kataoka article MarquardtJ2018 1068 Acta Acustica united with Acustica 2018 9 104 5 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources 825-829 Infrasound, auditory perception, psychoacoustic EMPIR 2015: Health S. Hirzel Verlag 30 1610-1928 10.3813/AAA.919232 NA T.Marquardt C.Jurado article YangBJCJTS2018 Biomedical Engineering / Biomedizinische Technik 2018 9 63 s1 HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound 240 OPM, SQUID, SQUID-MEG, signal-to-noise ratio EMRP A169: Call 2011 Metrology for Health Walter de Gruyter GmbH

Berlin

30 1862-278X, 0013-5585 10.1515/bmt-2018-6045 NA T.Yang R.Brühl A. Jodko-Władzińska P.Cotic Smole V.Jazbinšek L.Trahms T.Sander-Thömmes proceedings AllalARJG2018 1032 2018 IEEE Conference on Antenna Measurements & Applications (CAMA) 2018 9 16NRM07: Vector SAR: SAR measurement using vector probes 1-4 SAR, MIMO, Planar Near-Field Measurement System, Vector Field Measurement https://hal.archives-ouvertes.fr/hal-02376333 EMPIR 2016: Pre-Co-Normative IEEE Vasteras 2018 IEEE Conference on Antenna Measurements & Applications (CAMA) 03-09-2018 to 06-09-2018 30 10.1109/CAMA.2018.8530621 NA L.Aberbour O.Jawad M.Ramdani P.Giry T.Julien thesis Jaeger2018 1747 2018 8 30 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation Zeit Synchronisation, Abtastverfahren, digitaler Wandler, IEC 61850-9-2 EMPIR 2017: Industry Physikalisch-Technische Bundesanstalt (PTB)

Braunschweig

Ostfalia University of applied science (Wolfenbuettel, Germany) 43 NA https://doi.org/10.5281/zenodo.2628462 M.Jaeger article OguzAytekinKMSISFSZSJoHBHPV2018 1086 Journal of Physics: Conference Series 2018 8 1065 15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement 122019 Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019 EMPIR 2015: Research Potential IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1065/12/122019 NA N.Hodzic S.Čohodarević N.Jandrić R.Strnad D.Zvizdić D.Sestan V.Fernicola D.Smorgon L.Iacomini S.Simic D.Mac Lochlainn N.Karaboce S.Oguz Aytekin J.Bojkovski D.Hudoklin O.Petrušova T.Vukičević article JelezkoDNAEBGJSMTFDGO2018 1010 Physical Review Applied 2018 7 25 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance https://arxiv.org/abs/1706.07935 EMPIR 2017: Fundamental American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.014024 NA J.Forneris S.Ditalia Tchernij P.Traina E.Moreva N.Skukan M.Jakšić V.Grilj F.Bosia E.Enrico G.Amato I.P.Degiovanni B.Naydenov F.Jelezko M.Genovese P.Olivero article JelezkoDNAEBGJSMTFDGO20180 1010 Physical Review Applied 2018 7 25 10 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance EMPIR 2017: Fundamental American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.014024 NA https://arxiv.org/abs/1706.07935 J.Forneris S.Ditalia Tchernij P.Traina E.Moreva N.Skukan M.Jakšić V.Grilj F.Bosia E.Enrico G.Amato I.P.Degiovanni B.Naydenov F.Jelezko M.Genovese P.Olivero article LudwigSKSDGTNPFJBPKRI2018 900 Metrologia 2018 6 28 55 4 15SIB07: PhotoLED: Future photometry based on solid-state lighting products 526-534 Photometry, colorimetry, illuminant, reference spectrum, photometer, calibration, uncertainty EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aacae7 NA A.Kokka T.Poikonen P.Blattner S.Jost A.Ferrero T.Pulli M.Ngo A.Thorseth T.Gerloff P.Dekker F.Stuker A.Klej K.Ludwig M.Schneider T.Reiners E.Ikonen article HorvatJPP2018 566 Open Chemistry 2018 6 14 16 1 16ENV01: MercOx: Metrology for oxidised mercury 544-555 Mass spectrometry; Mercury; Temperature programmed, desorption; WFGD gypsum; Particle size, fractions https://doi.org/10.1515/chem-2018-0046 EMPIR 2016: Environment Walter de Gruyter GmbH 30 2391-5420 10.1515/chem-2018-0046 NA M.Pavlin A.Popovič R.Jaćimović M.Horvat article BarlowJ2018 823 Measurement Science and Technology 2018 5 23 29 7 14IND09: MetHPM: Metrology for highly-parallel manufacturing 074004 dimensional metrology, surface topography, hybrid measurement, high dynamic range, process control, inline measurement, calibration http://iopscience.iop.org/article/10.1088/1361-6501/aababd/meta EMPIR 2014: Industry IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aababd NA C.W.Jones DO’Connor article BelenguerJKLA2018 796 EuCAP 2018 5 14IND10: MET5G: Metrology for 5G communications 5G, antennas, millimetre-wave, Empty Substrate Integrated Waveguide. http://www.eucap.org/ EMPIR 2014: Industry 30 NA https://arxiv.org/abs/1809.07817 A.Belenguer S.F.Jilani Z.U.Khan T. H.Loh A.Alomainy article KastnerJHKPHHUFPRU2018 1690 ACS Omega 2018 4 12 3 4 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 4141-4147 - EMPIR 2016: Energy American Chemical Society (ACS) 30 2470-1343, 2470-1343 10.1021/acsomega.7b01931 NA B.Kästner C.M.Johnson P.Hermann M.Kruskopf K.Pierz A.Hoehl A.Hornemann G.Ulrich J.Fehmel P.Patoka E.Ruhl G.Ulm article WellerJEB2018 936 BMC Research Notes 2018 4 11 1 15HLT02: ReMiND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease 213-217 Ceruloplasmin, Immunocapture, ICP‑MS, ELISA, Human serum https://bmcresnotes.biomedcentral.com/articles/10.1186/s13104-018-3324-7 EMPIR 2015: Health Springer Nature 30 1756-0500 10.1186/s13104-018-3324-7 NA B.Bernevic A.H.El-Khatib N.Jakubowski M.G.Weller article GrobnerEJ2018 Atmospheric Measurement Techniques 2018 3 27 11 3 ENV59: atmoz: Traceability for atmospheric total column ozone 1707-1723 total ozone, atmosphere, cross sections EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-11-1707-2018 NA J.Gröbner H.Elandaloussi C.Janssen article PaleckiOMLLJIHHGDTPdTVM2018_2 International Journal of Climatology 2018 3 38 6 ENV58: MeteoMet2: Metrology for essential climate variables 2760-2774 climate, metrology, essential climate variables, climate change EMRP A169: Call 2013 Environment II Wiley 30 0899-8418 10.1002/joc.5458 NA M.Palecki T.Oakley A.Merlone J. H.Lawrimore D. H.Lister P. D.Jones N. B.Ingleby Z.Hausfather S.Harrigan B.Goodison H. J.Diamond P. W.Thorne T. C.Peterson M.de Podesta C.Tassone V.Venema G.Mana article WittkamperPJdd2018_2 705 Physics in Medicine & Biology 2018 2 20 63 4 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 045023 dosimetry, primary standard, flattening filter free, absorbed dose to water, kQ, code of practice, ion chamber EMPIR 2016: Pre-Co-Normative IOP Publishing 30 1361-6560 10.1088/1361-6560/aaaa93 NA L.de Prez J.de Pooter B.Jansen T.Perik F.Wittkämper proceedings BosseKJG2018 879 Conference Proceedings 22. IMEKO World Congress 2018 2018 14IND14: MNm Torque: Torque measurement in the MN•m range torque transducer, force lever, wind turbine, test benches, multiaxial loads, rotational speed EMPIR 2014: Industry Belfast, Northern Ireland 22. IMEKO World Congress 03-09-2018 to 06-09-2018 30 10.1088/1742-6596/1065/4/042050 NA J.Gnauert G.Jacobs S.Kock D.Bosse proceedings StrangfeldBJK2018 880 Conference Proceedings 22. IMEKO World Congress 2018 2018 14IND14: MNm Torque: Torque measurement in the MN•m range wind turbine test benches, torque measurement, multi-axial operation, rotational speed EMPIR 2014: Industry Belfast, Northern Ireland 22. IMEKO World Congress 03-09-2018 to 06-09-2018 30 10.1088/1742-6596/1065/4/042014 NA S.Kock G.Jacobs D.Bosse F.Strangfeld article BeckhoffMWJCHU2018 534 Journal of Analytical Atomic Spectrometry 2018 16ENG03: HyMet: Hybrid metrology for thin films in energy applications X-ray fluorescence, atomic fundamental parameters https://arxiv.org/abs/1805.02951 EMPIR 2016: Energy Royal Society of Chemistry (RSC)

Thomas Graham House Science Park, Milton Rd Science Park, Milton Rd Cambridge CB4 0WF United Kingdom

30 0267-9477, 1364-5544 10.1039/C8JA00046H NA R.Unterumsberger P.Honicke J.L.Colaux C.Jeynes M.Wansleben M.Muller B.Beckhoff article KoblarFSJPH2018 1156 American Journal of Analytical Chemistry 2018 09 12 16ENV01: MercOx: Metrology for oxidised mercury 602-621 Trace and Major Elements, Wet Flue Gas Desulphurization Gypsum, Particle Size Fractions, Mercury and Selenium, Sample Preparation EMPIR 2016: Environment Scientific Research Publishing, Inc, 30 2156-8251, 2156-8278 10.4236/ajac.2018.912044 NA M.Pavlin R.Jaćimović A.Stergaršek P.Frkal M.Koblar M.Horvat proceedings WangJW2018 1623 Proceedings of 9th World Congress on Industrial Process tomography 2018 16ENG07: MultiFlowMet II: Multiphase flow reference metrology Thresholding value method, fuzzy logic method, dual-modality electrical tomography, evaluation http://eprints.whiterose.ac.uk/140300/ EMPIR 2016: Energy ISIPT Bath, UK 9th World Congress on Industrial Process tomography 02-09-2018 to 06-09-2018 30 NA https://www.isipt.org/world-congress/9/29285.html Q.Wang X.Jia M.Wang article TakasuBBCJYKTT2017 775 Physical Review A 2017 12 96 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 063405 photoassociation, spectroscopy, ytterbium, EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.96.063405 NA M.Borkowski A.A.Buchachenko R.Ciuryło P.S.Julienne H.Yamada Y.Kikuchi K.Takahashi Y.Takahashi Y.Takasu article EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017 602 Physics in Medicine & Biology 2017 11 14 62 23 15HLT08: MRgRT: Metrology for MR guided radiotherapy L41-L50 MRgRT, Radiotherapy, MRI EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aa9517 NA B WRaaymakers I MJürgenliemk-Schulz G HBol MGlitzner A N T JKotte Bvan Asselen J C Jde Boer J JBluemink S LHackett M AMoerland S JWoodings J W HWolthaus H Mvan Zijp M E PPhilippens RTijssen J G MKok E Nde Groot-van Breugel IKiekebosch L T CMeijers C NNomden G GSikkes P A HDoornaert W S CEppinga NKasperts L G WKerkmeijer J H ATersteeg K JBrown BPais PWoodhead J J WLagendijk article JennettH2017 935 Journal of Physics D: Applied Physics 2017 10 20 50 45 14IND03: Strength-ABLE: Metrology for length-scale engineering of materials 455304 . https://pure.coventry.ac.uk/ws/portalfiles/portal/12629973/Hou_and_Jennett_Accpeted_version.pdf EMPIR 2014: Industry IOP Publishing 30 0022-3727, 1361-6463 10.1088/1361-6463/aa8a22 NA X DHou N MJennett inbook GillBRBBNKJGBM2017 379 2017 10 65 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 221-227 Frequency metrology, optical frequency standards, international atomic time http://empir.npl.co.uk/oc18/wp-content/uploads/sites/13/2016/04/Yb_J_Mod_Op.pdf EMPIR 2015: SI Broader Scope Informa UK Limited Journal of Modern Optics 30 0950-0340, 1362-3044 NA https://arxiv.org/abs/1707.00646v2 P.Gill K.Bongs A.Rolland P.E.G.Baird F.Baynes P.B.R.Nisbet-Jones S.A.King J.M.Jones R.M.Godun C.F.A.Baynham H.S.Margolis proceedings RietveldJPS2017 827 CIRED - Open Access Proceedings Journal 2017 10 2017 1 15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids 1927-1930 phasor measurement, distribution networks, power grids, load flow, data acquisition EMPIR 2015: Pre-Co-Normative Institution of Engineering and Technology (IET) Glasgow CIRED 12-06-2017 to 15-06-2017 30 2515-0855 10.1049/oap-cired.2017.1035 NA N.Save M.Popov A.Jongepier G.Rietveld article BogucarskaPdJASSSKSTv2017 Applied Radiation and Isotopes 2017 9 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities nuclear decommissioning, radioactive waste, free release, clearance level EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.09.043 NA T.Bogucarska B.Pedersen P.De Felice S.Jerome D.Arnold L.Skala J.Solc J.Smoldasova P.Kovář J.Šuráň F.Tzika R.Van Ammel article FrazerESJCS2017 Tribology International 2017 7 111 ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems 184-191 gears, lubrication, profile errors, EHL http://www.sciencedirect.com/science/article/pii/S0301679X17300944?via%3Dihub EMRP A169: Call 2013 Energy II Elsevier BV 30 0301-679X 10.1016/j.triboint.2017.02.034 NA R.Frazer H.P.Evans K.J.Sharif H.U.Jamali A.Clarke B.Shaw article SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017 477 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fibre, network, clock, time, dissemination, service https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE 30 10.1109/FCS.2017.8089004 NA P.Krehlik L.Śliwczyński J.Dostal J.Radil V.Smotlacha R.Velc J.Vojtech M.Campanella D.Calonico C.Clivati F.Levi O.Číp S.Rerucha R.Holzwarth M.Lessing F.Camargo B.Desruelle J.Lautier-Gaud E.L.English J.Kronjäger P.Whibberley P.E.Pottie R.Tavares P.Tuckey F.John M.Snajder J.Stefl P.Nogaś R.Urbaniak A.Binczewski W.Bogacki K.Turza G.Grosche H.Schnatz E.Camisard N.Quintin J.Diaz T.Garcia E.Ros A.Galardini A.Seeds Z.Yang A.Amy-Klein article SeidelinGFLPGJGL2017 399 Optics Express 2017 6 23 25 13 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 15539 Metrological instrumentation, Fabry-Perot, Laser stabilization, Rare-earth-doped materials EMPIR 2015: SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.25.015539 NA O.Gobron K.Jung N.Galland K.Predehl R.Le Targat A.Ferrier P.Goldner S.Seidelin Y.Le Coq article JeanneretO2017 IEEE Transactions on Instrumentation and Measurement 2017 6 66 6 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 1516-1523 Voltage measurement, Impedance, Calibration, Current measurement, Impedance measurement, Standards, Frequency measurement EMRP A169: Call 2012 SI Broader scope (II) Institute of Electrical and Electronics Engineers (IEEE)

Piscataway NJ

30 0018-9456, 1557-9662 10.1109/TIM.2017.2652500 NA B.Jeanneret F.Overney article JongepierPSR2017 Proceedings of CIRED 2017 2017 6 1 1 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics 1035 Power Systems, PMU, Smart Grids, Analysis SEG http://cired.net/publications/cired2017/pdfs/CIRED2017_1035_final.pdf;
doi: 10.1049/oap-cired.2017.1035 EMRP A169: Call 2013 Energy II CIRED

Glasgow

30 978-178561-483-5 2032-9644 NA AJongepier MPopov NSave GRietveld article XuCJSCPVHSC2017 574 Optics Letters 2017 6 42 11 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 2239 temperature, silicon on insulator, microspectrometer https://digital.csic.es/handle/10261/164048 EMPIR 2014: Industry The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.42.002239 NA A.Herrero-Bermello A.V.Velasco H.Podmore P.Cheben J.H.Schmid S.Janz M.L.Calvo D.XXu A.Scott P.Corredera article SchmittWJRLSMK2017 604 Journal of Physics: Conference Series 2017 5 847 15HLT08: MRgRT: Metrology for MR guided radiotherapy 012040 3D dosimetry, gel dosimeter, radiotherapy, MRgRT EMPIR 2015: Health IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/847/1/012040 NA PMann NSaito CLang ARunz WJohnen MWitte DSchmitt C PKarger article JehlBKCVSHLBKC2017 369 IEEE Electron Device Letters 2017 4 38 4 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 414-417 Quantum dots, Quantum effect semiconductor devices, Quantization, Current control https://arxiv.org/abs/1612.09547 http://www.e-si-amp.eu/outputs/ EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0741-3106, 1558-0563 10.1109/LED.2017.2670680 NA P.Clapera J.Klochan R.Lavieville S.Barraud L.Hutin M.Sanquer M.Vinet A.Cinins G.Barinovs V.Kashcheyevs X.Jehl article HemmingWLEKJHL2017 Precision Engineering 2017 4 48 IND62: TIM: Traceable in-process dimensional measuremen 181-190 Application of Monte Carlo simulation for estimation of uncertainty of four-point roundness measurements of rolls EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV

360 Park Ave S, New York, NY 10010, USA

30 0141-6359 10.1016/j.precisioneng.2016.12.001 NA B.Hemming T.Widmaier A.Lassila V.-P.Esala P.Kuosmanen J.Juhanko J.Haikio P.Laukkanen article PrancePPJHHGGBPB2017 504 Scientific Reports 2017 4 7 15SIB02: InK 2: Implementing the new kelvin 2 45566 Electronic devices, Electronic properties and materials https://www.nature.com/articles/srep45566 EMPIR 2015: SI Broader Scope Springer Nature 30 2045-2322 10.1038/srep45566 NA D. I.Bradley A. M.Guénault D.Gunnarsson R. P.Haley S.Holt A. T.Jones Y. A.Pashkin J.Penttilä J. R.Prance M.Prunnila L.Roschier article MartinezVerduLAKOGKJFSPSC2017 Applied Optics 2017 3 56 7 IND52: XD Reflect: Multidimensional reflectometry for industry 1996 BSDF, BRDF, BTDF, Densitometers, reflectometers, Reflection. EMRP A169: Call 2012 Metrology for Industry (II) The Optical Society

2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States

30 0003-6935, 1539-4522 10.1364/AO.56.001996 NA F. M.Martínez-Verdú F. B.Leloup J.Audenaert S.Källberg G.Obein G.Ged A.Koo P.Jaanson A.Ferrero C.Strothkämper E.Perales A.Schirmacher J.Campos article PavsiDBFVJSeHRKMAAM2017 2144 Analytical and Bioanalytical Chemistry 2017 1 26 409 10 HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms 2601-2614 Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials EMRP A169: Call 2011 Metrology for Health Springer Science and Business Media LLC 30 1618-2642, 1618-2650 10.1007/s00216-017-0206-0 NA J.Pavšič A.Devonshire A.Blejec C.A.Foy F.Van Heuverswyn G.M.Jones H.Schimmel J.Zel J.F.Huggett N.Redshaw M.Karczmarczyk E.Mozioglu S.Akyürek M.Akgöz M.Milavec article JelinekKC2017 Measurement Science and Technology 2017 1 24 28 3 SIB61: CRYSTAL: Crysalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology 034005 density functional theory, atomic force microscopy, uncertainty EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing

Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom

30 0957-0233, 1361-6501 10.1088/1361-6501/aa5075 NA PavelJelínek PetrKlapetek Anna CharvátováCampbell article PfaffenbergerNJK2017 600 Physics in Medicine and Biology 2017 1 23 62 4 15HLT08: MRgRT: Metrology for MR guided radiotherapy 1358-1377 MRgRT, synthetic CT data, MRI, CT, Radiotherapy https://doi.org/10.1088/1361-6560/aa5200 EMPIR 2015: Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/aa5200 NA K.M.Kraus O.Jäkel N.I.Niebuhr A.Pfaffenberger article JennettAH2017 381 Measurement Science and Technology 2017 1 13 28 2 14IND03: Strength-ABLE: Metrology for length-scale engineering of materials 025016 nano-indentation, elevated temperature, thermal equilibrium, isothermal contact https://pure.coventry.ac.uk/ws/portalfiles/portal/8188288/Establishing_isothermal_contact_accepted_MST_104245_corrected_postprint.pdf EMPIR 2014: Industry IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa533d NA X.D.Hou C.L.M.Alvarez N.M.Jennett article Applied Optics 2017 1 6 56 2 SIB60: Surveying: Metrology for long distance surveying 239-246 long-distance surveying, laser absorption spectroscopy, refractive index compensation https://www.osapublishing.org/ao/abstract.cfm?uri=ao-56-2-239 EMRP A169: Call 2012 SI Broader scope (II) OSA Publishing

Washington

30 1559-128X (print), 2155-3165 (online) 10.1364/AO.56.000239 1 59 No, EURAMET is never allowed to make the publication publicly available. T.Tomberg T.Fordell J.Jokela M.Merimaa T.Hieta proceedings WeidingerBJK2017 243 3rd Conference for Wind Power Drives 2017 1 14IND14: MNm Torque: Torque measurement in the MN•m range 1-14 nacelle test bench, FEM simulation, measurement uncertainty EMPIR 2014: Industry Books on Demand

Norderstedt

Aachen, Germany 3rd Conference for Wind Power Drives , Aachen , Germany 07-03-2017 to 08-03-2017 30 978-3-7431-3456-0 10.18154/RWTH-2017-02946 NA S.Kock G.Jacobs D.Bosse P.Weidinger article BojkovskiOKMSISFZSSJoHHPV2017 1095 18th International Congress of Metrology 2017 2017 18th 15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement 4/06006 Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html EMPIR 2015: Research Potential EDP Sciences 30 10.1051/metrology/201706006 NA N.Hodzic S.Čohodarević N.Jandrić R.Strnad D.Sestan D.Zvizdić V.Fernicola D.Smorgon L.Iacomini S.Simic D.Mac Lochlainn N.Karaboce S.Oguz Aytekin J.Bojkovski D.Hudoklin O.Petrušova T.Vukičević article Solar Energy Materials and Solar Cells 2016 12 2 161 November 2016 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 89-95 Printed solar cells, Organic photovoltaics, Defects, Transient photovoltage, Transient photocurrent, Characterisation http://www.sciencedirect.com/science/article/pii/S0927024816304974 EMRP A169: Call 2013 Energy II Elsevier

Amsterdam

30 0927-0248 10.1016/j.solmat.2016.11.029 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SWood DO’Connor C WJones J DClaverley J CBlakesley CGiusca F ACastro article ReitzensteinKLRSSKSMRWFDJK2016 336 ACS Photonics 2016 11 22 3 12 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 2461-2466 single-photon source, 3D lithography, 3D direct laser writing, semiconductor quantum dot, micro-objective http://pubs.acs.org/doi/pdf/10.1021/acsphotonics.7b00253 EMPIR 2014: Industry American Chemical Society (ACS) 30 2330-4022, 2330-4022 10.1021/acsphotonics.6b00707 NA T.Jakubczyk V.Delmonte S.Fischbach D.Wigger D.E.Reiter Q.Mermillod P.Schnauber A.Kaganskiy J.H.Schulze A.Strittmatter S.Rodt W.Langbein T.Kuhn S.Reitzenstein J.Kasprzak article Nature Photonics 2016 11 14 - SIB57: NEWSTAR: New primary standards and traceability for radiometry Imaging and sensing, Nanowires, Optical metrology, Optical sensors, X-rays http://www.nature.com/nphoton/journal/vaop/ncurrent/full/nphoton.2016.226.html EMRP A169: Call 2012 SI Broader scope (II) Nature

-

30 10.1038/nphoton.2016.226 1 No, EURAMET is never allowed to make the publication publicly available. M.A.Juntunen J.Heinonen V.Vähänissi P.Repo D.Valluru H.Savin article Metrologica 2016 11 4 53 6 ENV53: MetEOC2: Metrology for earth observation and climate 1331-1338 fluorescence, reference standard, Lambertian, angle resolved, goniometrical, radiance factor, bispectral luminescent radiance factor http://iopscience.iop.org/article/10.1088/0026-1394/53/6/1330/meta EMRP A169: Call 2013 Environment II BIPM & IOP Publishing Ltd

Bistol

30 10.1088/0026-1394/53/6/1330 1 59 No, EURAMET is never allowed to make the publication publicly available. PJJaanson TPPulli FMManoocheri EIIkonen article Journal of Luminescence 2016 11 1 179 November 2016 EXL02: SIQUTE: Single-photon sources for quantum technologies 59-63 Diamond; Color center; Defect; Ion implantation; Photoluminescence http://www.journals.elsevier.com/journal-of-luminescence EMRP A169: Call 2012 Open excellence call Elsevier

Amsterdam

30 0022-2313 10.1016/j.jlumin.2016.06.039 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-1 J.J. Forneris A.A. Tengattini S.S. Ditalia Tchernij F.F. Picollo A.A. Battiato P.P. Traina I.P.I.P. Degiovanni E.E. Moreva G.G. Brida V.V. Grilj N.N. Skukan M.M. Jakšić M.M. Genovese P.P. Olivero article Journal of Environmental Radioactivity 2016 10 162-163 - ENV57: MetroERM: Metrology for radiological early warning networks in Europe 358-370 Nuclear chronometry; Uncertainty; CTBT; Non-proliferation; Geochronology; Nuclear medicine; Dosimetry http://www.sciencedirect.com/science/article/pii/S0265931X16302144 EMRP A169: Call 2013 Environment II Elsevier

Amsterdam

30 0265-931X 10.1016/j.jenvrad.2016.06.013 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.sciencedirect.com/science/article/pii/S0265931X16302144 SPommé SMCollins AHarms SMJerome article RietveldvJJNCAC2016 2016 17th International Conference on Harmonics and Quality of Power (ICHQP) 2016 10 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics Phasor measurement units, Power Quality, Power system harmonics, Impedance measurement, Harmonic impedance, Load modeling SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/ICHQP.2016.7783374 NA G.Rietveld H.E.van den Brom A.Jongepier W.Jin F.Ni V.Cuk M.Acanski J.F.G.Cobben article LegreKKJGCBMMS2016 751 Physical Review A 2016 9 15 94 3 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 030302(R) Quantum Cryptography, Quantum Communication https://link.aps.org/accepted/10.1103/PhysRevA.94.030302 EMPIR 2014: Industry American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.94.030302 NA V.Makarov J.P.Bourgoin P.Chaiwongkhot M.Gagné T.Jennewein S.Kaiser R.Kashyap M.Legré C.Minshull S.Sajeed proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 16 SIB51: GraphOhm: Quantum resistance metrology based on graphene Chemical vapor deposition (CVD), Hexame-thyldisilazane (HMDS), Copper (Cu), CVD graphene (CVDG) http://ieeexplore.ieee.org/document/7540498/ EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540498 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Thodkar C.Schönenberger M.Calame F.Lüönd F.Overney B.Jeanneret proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 11 SIB51: GraphOhm: Quantum resistance metrology based on graphene Graphene, AC quantum Hall effect, quantum Hall resistance, frequency dependence, AC coaxial bridge, Resistance, Electrical resistance measurement, Bridge circuits, Frequency measurement, Standards http://ieeexplore.ieee.org/document/7540655/ EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540655 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Lüönd F.Overney B.Jeanneret A.Müller M.Kruskopf K.Pierz proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 11 SIB51: GraphOhm: Quantum resistance metrology based on graphene Epitaxial layers, Graphene, measurement standards, microfabrication, quantum hall effect http://ieeexplore.ieee.org/document/7540516/?denied EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540516 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. H.He T.J.B.M.Janssen S.Rozhko A.Tzalenchuk S.Lara-Avila R.Yakimova S.Kubatkin proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 11 SIB51: GraphOhm: Quantum resistance metrology based on graphene quantum Hall effect, graphene, primary resistance metrology, cryogenic current comparators. http://ieeexplore.ieee.org/document/7540654/?denied EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540654 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.J.B.M.Janssen S.Rhozhko J.M.Williams J.Ireland H.He S.Lara-Avila S.Kubatkin R.Yakimova A.Tzalenchuk proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 11 SIB51: GraphOhm: Quantum resistance metrology based on graphene Graphene, materials science and technology, measurement standards, metrology, quantum Hall effect devices http://ieeexplore.ieee.org/document/7540650/ EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540650 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Brun-Pcard R.Ribeiro-Palau F.Lafont D.Kazazis A.Michon F.Cheynis O.Couturaud C.Consejo B.Jouault W.Poirier F.Schopfer article Journal of Analytical Atomic Spectrometry 2016 8 3 31 9/2016 HLT05: Metallomics: Metrology for metalloproteins 1756-1765 Metalloproteins, Haemoglobin, transferrin, superoxide dismutase, ceruloplasmin, prenatal diagnostics http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00181E#!divAbstract EMRP A169: Call 2011 Metrology for Health Royal Society of Chemistry

Cambridge, United Kingdom

30 0267-9477 (print) ; 1364-5544 (online) 10.1039/c6ja00181e 1 No, EURAMET is never allowed to make the publication publicly available. ClaudiaSwart NorbertJakubowski article SvecSSRPNMLKJGFFDMAHBTTVW2016_2 Applied Radiation and Isotopes 2016 8 114 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry 167-172 Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET EMRP A169: Call 2010 Industry Elsevier BV 30 0969-8043 10.1016/j.apradiso.2016.05.014 NA A.Svec J.Solc L.Silva M.Reis V.Peyres M.Nečemer H.Moser A.Luca S.Klemola A.Javornik E.García-Toraño L..Ferreux A.Fazio P.Dryák B.C.Marroyo D.Arnold M.Hult O.Burda F.Tzika Z.Tyminski B.Vodenik U.Wätjen article FisicaroPJPFRA2016 Journal of Chromatography A 2016 8 1459 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 112-119 Environmental quality standard (EQS), Humic acid, Isotope dilution, Surface water, Suspended particulate matter, Tributyltin (TBT) EMRP A169: Call 2010 Environment Elsevier BV 30 0021-9673 10.1016/j.chroma.2016.06.068 NA P.Fisicaro U.Panne N.Jakubowski R.Philipp I.Fettig J.Richter E.Alasonati article Nature: Scientific Reports 2016 7 26 6 SIB51: GraphOhm: Quantum resistance metrology based on graphene 30296 graphene, measurement, QHE, http://www.nature.com/articles/srep30296?WT.feed_name=subjects_physical-sciences EMRP A169: Call 2012 SI Broader scope (II) Scientific reports 30 10.1038/srep30296 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.A.Alexander-Webber J.Huang D.K.Maude T.J.B.M.Janssen A.Tzalenchuk V.Antonov T.Yager S.Lara-Avila S.Kubatkin R.Yakimova R.J.Nicholas proceedings Advanced Photonics 2016 SPPCom 2016 7 18 2016 IND51: MORSE: Metrology for optical and RF communication systems SpTu1F.3 Coherent communications Fiber optics communications Modulation https://www.osapublishing.org/abstract.cfm?uri=SPPCom-2016-SpTu1F.3 EMRP A169: Call 2012 Metrology for Industry (II) Optical Society of America

Washington, D.C.

Vancouver, Canada Advanced Photonics 18-07-2016 30 978-1-943580-14-9 N/A 10.1364/SPPCOM.2016.SpTu1F.3 1 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S. S.Dash FPythoud BB AJosten PLeuchtmann DHillerkuss JLeuthold article MerimaaWWMJGKNTLHLGP2016 IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control 2016 7 63 7 SIB04: Ion Clock: High-accuracy optical clocks with trapped ions 981-985 Frequency transfer, GPS precise point positioning (PPP), optical clock https://ieeexplore.ieee.org/document/7398135/keywords EMRP A169: Call 2011 SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0885-3010 10.1109/TUFFC.2016.2524988 NA M.Merimaa A.Wallin P. B.Whibberley H. S.Margolis J. M.Jones R. M.Godun S. A.King P. B. R.Nisbet-Jones C.Tamm B.Lipphardt N.Huntemann J.Leute P.Gill E.Peik proceedings 19th World Conference on Non-Destructive Testing 2016 2016 7 2016 Modelling and Data Processing ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-8 Ultrasonic Testing (UT), Modelling and Data Processing http://www.ndt.net/article/wcndt2016/papers/fr1h5.pdf EMRP A169: Call 2013 Energy II NDT.net

Bad Breisig, Germany

Internationales Congress Center München Messegelände, Munich, Germany 19th World Conference on Non-Destructive Testing 2016 13-06-2016 to 17-06-2016 30 978-3-940283-78-8 1435-4934 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. KJJezzine DSSegur REEcault NDDominguez proceedings 19th World Conference on Non-Destructive Testing 2016 2016 7 2016 Composite Materials ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-10 Infrared Testing (IRT), Ultrasonic Testing (UT), Visual and Optical Testing (VT/OT), Other Methods, delamination, validation, carbon fiber reinforced plastic (CFRP), Glass Fiber Reinforced Plastic (GFRP), tensile load, flat bottom hole http://www.ndt.net/article/wcndt2016/papers/we1e4.pdf EMRP A169: Call 2013 Energy II NDT.net

Bad Breisig, Germany

Internationales Congress Center München Messegelände, Munich, Germany 19th World Conference on Non-Destructive Testing 2016 13-06-2016 to 17-06-2016 30 978-3-940283-78-8 1435-4934 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MGGower MLLodeiro AAAktas RSShaw CMMaierhofer RKKrankenhagen SAAugustin MRRöllig LKKnazovická ABBlahut CMMonte RJJudaschke DSSegur proceedings CalmonDESJ2016 QNDE16 2016 6 16 ENG57: VITCEA: Validated inspection techniques for composites in energy applications Hybrid ray-FDTD simulation ultrasonic inspection CFRP http://aip.scitation.org/doi/pdf/10.1063/1.4974660 EMRP A169: Call 2013 Energy II Atlanta QNDE16 17-07-2016 to 22-07-2016 30 10.1063/1.4974660 NA P.Calmon N.Dominguez R.Ecault D.Ségur K.Jezzine article REVIEW OF SCIENTIFIC INSTRUMENTS 2016 5 24 87 051906 (2016) SIB58: Angles: Angle metrology 1-9 Apertures, Calibration Charge coupled devices, Ray tracing, Optical aberrations http://aip.scitation.org/doi/10.1063/1.4950734 EMRP A169: Call 2012 SI Broader scope (II) American Institute of Physics

Melville, NY 11747-4300 USA

30 Print: 0034-6748, Online: 1089-7623 10.1063/1.4950734 1 55,59 No, EURAMET is never allowed to make the publication publicly available. R. D.Geckeler N. A.Artemiev S. K.Barber AJust I.Lacey OKranz B. V.Smith V. V.Yaschckuk article ZorinJL2016 Applied Physics Letters 2016 4 25 108 17 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 172603 microwave detection, single-electron tunneling EMRP A169: Call 2012 Open excellence call AIP Publishing 30 0003-6951, 1077-3118 10.1063/1.4948258 NA A. B.Zorin B.Jalali-Jafari S. V.Lotkhov article Metrologia 2016 4 11 53 3 SIB51: GraphOhm: Quantum resistance metrology based on graphene 918 Keywords: metrology, ac bridges, impedance measurements, quantum Hall effect, digitally assisted (Some http://iopscience.iop.org/article/10.1088/0026-1394/53/3/918/meta EMRP A169: Call 2012 SI Broader scope (II) IOP 30 10.1088/0026-1394/53/3/918 1 59 No, EURAMET is never allowed to make the publication publicly available. FedericOverney FelixLüönd BlaiseJeanneret BlaiseJeanneret proceedings Proceedings of the third Joint International Symposium on Deformation Monitoring 2016 4 SIB60: Surveying: Metrology for long distance surveying Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf EMRP A169: Call 2012 SI Broader scope (II) Vienna, Austria Joint International Symposium on Deformation Monitoring March 30-April 1, 2016 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Pollinger A.Bauch J.Leute K.Meiners-Hagen J.Mildner J.Guillory J.-P.Wallerand J.Jokela U.Kallio H.Koivula S.Lahtinen M.Poutanen M.Astrua C.Francese M.Zucco L.Eusebio F.Marques C.Pires F.Saraiva O.Pelligrino T.Tomberg T.Hieta T.Fordell M.Merimaa V.Kupko P.Neyezhmakov S.Bergstrand S.A.van den Berg T.Kersten T.Krawinkel article Philosophical Transactions of the Royal Society A 2016 3 28 374 2064 SIB01: InK: Implementing the new kelvin 20150044 high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics http://rsta.royalsocietypublishing.org/content/374/2064/20150044 EMRP A169: Call 2011 SI Broader Scope The Royal Society

London

30 10.1098/rsta.2015.0044 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.RWooliams KAnhalt MBallico PBloembergen FBourson SBriaudeau JCampos M.GCox Ddel Campo WDong M.RDury VGavrilov IGrigoryeva M.LHernanz FJahan BKhlevnoy VKhromchenko D.HLowe XLu GMachin J.MMantilla M.JMartin H.CMcEvoy BRougie MSaldi S.G.RSalim NSasajima D.RTaubert A.D.WTodd RVan den Bossche article HainsworthKHJ2016_2 380 Philosophical Magazine 2016 3 24 96 32-34 14IND03: Strength-ABLE: Metrology for length-scale engineering of materials 3396-3413 Nano-scratch testing, nano-scratch hardness, lateral size effects https://pure.coventry.ac.uk/ws/portalfiles/portal/10344470/Nigel_Jennett_Manuscript_revised.pdf EMPIR 2014: Industry Informa UK Limited 30 1478-6435, 1478-6443 10.1080/14786435.2016.1146828 NA A.Kareer X.D.Hou N.M.Jennett S.V.Hainsworth proceedings Optical Fiber Communication Conference 2016 3 20 N/A 2016 IND51: MORSE: Metrology for optical and RF communication systems Th2A.46 Coherent communications Fiber optics communications Modulation https://www.osapublishing.org/abstract.cfm?uri=OFC-2016-Th2A.46 EMRP A169: Call 2012 Metrology for Industry (II) Optical Society of America

Washington, D.C.

Anaheim, California Optical Fiber Communication Conference 20-03-2016 30 978-1-943580-07-1 N/A 10.1364/OFC.2016.Th2A.46 1 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S. S.Dash FPythoud BBaeuerle AJosten DHillerkuss PLeuchtmann JLeuthold article NadvornikNSNNOJTKWJ2016 Scientific Reports 2016 3 16 6 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems 22901 Long-range and high-speed electronic spin-transport at a GaAs/AlGaAs semiconductor interface EMRP A169: Call 2012 Open excellence call Springer Nature

233 Spring St., New York NY 10013, USA

30 2045-2322 10.1038/srep22901 NA L.Nádvorník P.Němec V.Skoromets H.Němec V.Novák K.Olejník T.Janda F.Trojánek P.Kužel J.Wunderlich T.Jungwirth article Applied Radiation and Isotopes 2016 3 1 109 Special Issue: ICRM 2015 HLT11: MetroMRT: Metrology for molecular radiotherapy 226-230 90Y resin microspheres; Ionisation chambers; calibration factors; Capintec CRC-25R http://ac.els-cdn.com/S0969804315303134/1-s2.0-S0969804315303134-main.pdf?_tid=5a48db6c-1dc9-11e6-b9a5-00000aab0f6b&acdnat=1463666312_e589a503e7b566030018889dc6beaabd EMRP A169: Call 2011 Metrology for Health Elsevier

London

30 0969-8043 10.1016/j.apradiso.2015.11.074 1 59 No, EURAMET is never allowed to make the publication publicly available. KMFerreira AJFenwick AArinc LCJohansson article PacynaHJDCBBBPHBGEPF2016 Environmental Science & Technology 2016 3 50 6 ENV51: MeTra: Traceability for mercury measurements 2767-2770 Mercury, Minamata Convention, EMRP A169: Call 2013 Environment II American Chemical Society (ACS) 30 0013-936X, 1520-5851 10.1021/acs.est.6b00573 NA J.Pacyna M.Horvat D.Jaffe C.T.Driscoll C.Chen P.Bustamante J.Blum N.Basu A.Pierce C.R.Hammerschmidt M.S.Bank M.S.Gustin D.C.Evers N.Pirrone P.Fisicaro article Surface Topography: Metrology and Properties 2016 2 29 4 2 NEW08: MetNEMS: Metrology with/for NEMS 025001 graphene, Raman spectroscopy, Metrology, scanning probe microscopy techniques http://iopscience.iop.org/article/10.1088/2051-672X/4/2/025001/pdf EMRP A169: Call 2011 Metrology for New Technologies IOP Publishing

Bristol

30 n/a 10.1088/2051-672X/4/2/025001 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. RWang RPearce JGallop TPatel FZhao APollard NKlein RJackman AZurutuza LHao article EomJKKK2016_3 Measurement 2016 2 80 SIB58: Angles: Angle metrology 288-293 Absolute angle measurement, Angle encoder, Graduated disk, Absolute position binary code, Nonlinearity error EMRP A169: Call 2012 SI Broader scope (II) Elsevier BV 30 0263-2241 10.1016/j.measurement.2015.11.037 NA T.B.Eom J.Jin C.S.Kang J.W.Kim J.A.Kim article LotkhovJZ2016 Applied Sciences 2016 1 27 6 2 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 35 micro´wave detection, single-electron tunneling EMRP A169: Call 2012 Open excellence call MDPI AG 30 2076-3417 10.3390/app6020035 NA S.Lotkhov B.Jalali-Jafari A.Zorin article Applied Optics 2016 1 7 55 2 14IND09: MetHPM: Metrology for highly-parallel manufacturing 317-322 https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-2-317 EMPIR 2014: Industry OSA Publishing

Washington

30 10.1364/AO.55.000317 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-1-7 https://arxiv.org/ftp/arxiv/papers/1509/1509.07623.pdf M.HMadsen PBoher P.EHansen J.FJørgensen article Measurement Science and Technology 2016 1 5 27 2 IND52: XD Reflect: Multidimensional reflectometry for industry 025204 quantum efficiency, quantum yield, bispectral luminescent radiance factor, goniometrical, fluorescence, uncertainty http://iopscience.iop.org/article/10.1088/0957-0233/27/2/025204/meta EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing

Bristol

30 1361-6501 10.1088/0957-0233/27/2/025204 1 59 No, EURAMET is never allowed to make the publication publicly available. PJaanson FManoocheri EIkonen article DenoziereJPPPPGBR2016 Metrologia 2016 1 53 1A HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 06007-06007 absorbed dose to water, medium energy x ray, comparison EMRP A169: Call 2011 Metrology for Health IOP Publishing 30 0026-1394, 1681-7575 10.1088/0026-1394/53/1A/06007 NA M.Denoziere BJansen L.dPrez J.d.Pooter M.Pinto M.Pimpinella A.S.Guerra L.Büermann B.Rapp techreport TerauchiKSBWWADGAAHUWSJKKFSBSS2016 415 Metrologia 2016 1 53 1A 14SIP05: TF-STANDARD: Developing a Standard for Valid Methodology for the Characterisation of Functional Alloy Thin Films 08011-08011 CIGS, Cu(In,Ga)Se2, mole fractions, key comparison CCQM-K129 http://iopscience.iop.org/article/10.1088/0026-1394/53/1A/08011
https://www.bipm.org/utils/common/pdf/final_reports/QM/K129/CCQM-K129.pdf EMPIR 2014: Support for Impact IOP Publishing 30 0026-1394, 1681-7575 10.1088/0026-1394/53/1A/08011 NA A.S.Kim K.J.Kim J.S.Jang J.K.Suh T.Wirth W.Unger V.D.Hodoroaba J.R.Araujo B.S.Archanjo C.E.Galhardo J.Damasceno C.A.Achete H.Wang M.Wang J.Bennett D.Simon A.Kurokawa S.Terauchi T.Fujimoto C.Streeck B.Beckhoff S.Spencer A.Shard proceedings Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on 2016 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity Impedance simulator, LCR meter, Sampling technique, digital bridge. http://ieeexplore.ieee.org/document/7540610/ EMRP A169: Call 2012 SI Broader scope (II) Ottawa Conference on Precision Electromagnetic Measurements 10-15 July 2016 30 2160-0171 10.1109/CPEM.2016.7540610 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Overney B.Jeanneret proceedings 2015 IEEE International Workshop on Applied Measurements for Power Systems 2016 2015 na ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids 13-18 current clamp, high voltage capacitor, analogue integrator, sampling system, asynchronous sampling SEG http://amps2015.ieee-ims.org/front EMRP A169: Call 2013 Energy II IEEE Aachen, Germany 6rd IEEE International Workshop on Applied Measurements for Power Systems, AMPS 2015 September 2015 30 978-1-4799-9997-2 59 No option selected E.Mohns S.Fricke C.Jäschke P.Schegner proceedings CIE Proceeding 2016 IND52: XD Reflect: Multidimensional reflectometry for industry Goniofluorescence, fluorescence, photoluminescence, spectrophotometry EMRP A169: Call 2012 Metrology for Industry (II) International Comission on Illumination

Serrano 144

Manchester/UK 28th Session CIE June 28 - July 4, 2015 30 59 No, EURAMET is never allowed to make the publication publicly available. AFerrero BBernad J LVelazquez APons M LHernanz PJaanson F MMartinez-Verdu EChorro EPerales JCampos article Proceedings of the 2015 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Taipei, Taiwan 2016 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 604-607 Reverberation Chamber, Stirrer Design, Stirrer Comparison EMRP A169: Call 2012 SI Broader scope (II) IEEE

Piscataway, NJ

30 2162-7673 10.1109/APEMC.2015.7175394 1 59 No, EURAMET is never allowed to make the publication publicly available. A.Ubin R.Vogt-Ardatjew F.Leferink M.Z.M.Jenu S.van de Beek proceedings Conference on Precision Electromagnetic Measurements Digest 2016 CPEM 2016 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 The LEVEL OF ACCESS has changed in 06/09/2016 to: No, EURAMET is never allowed to make the publication publicly available" Artificial Neural Networks, digital measurements, spectral analysis, frequency estimation, harmonics, interharmonics http://ieeexplore.ieee.org/document/7540649/?arnumber=7540649 EMRP A169: Call 2012 SI Broader scope (II) IEEE Transactions on Instrumentation and Measurement Ottawa (Canadá) Conference on Precision Electromagnetic Measurements 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9133-7 10.1109/CPEM.2016.7540649 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J. R.Salinas F.García-Lagos J.Diaz de Aguilar G.Joya R.Lapuh F.Sandoval article Applied Radiation and Isotopes 2016 112 Not Available HLT11: MetroMRT: Metrology for molecular radiotherapy 156-164 Quantitative imaging Molecular radiotherapy Gamma camera Calibration Radionuclide therapy http://ac.els-cdn.com/S0969804316300902/1-s2.0-S0969804316300902-main.pdf?_tid=0dfc2a3c-6de4-11e6-8cf3-00000aab0f02&acdnat=1472473873_beaec1e776a0c054de0ab95c6804d14c EMRP A169: Call 2011 Metrology for Health Elsevier Ltd

Netherlands, Amsterdam

30 0969-8043 10.1016/j.apradiso.2016.03.007 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-6-30 MarcoD'Arienzo MartaCazzato Maria LetiziaCozzella MauriceCox MarcoD'Andrea AldoFazio AndrewFenwick GiuseppeIaccarino LenaJohansson LidiaStrigari SaraUngania PierinoDe Felice article Optica Pura y Aplicada 2015 12 1 48 4 14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications 283-289 integrated optics, spectroscopy, Fourier transform, Silicon on insulator, temperature drift, spectral retrieval. - EMPIR 2014: Industry SEDOPTICA

MADRID

112 - 10.7149/OPA.48.4.283 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A. V.Velasco J.Galindo-Santos P.Cheben M. LCalvo J.Schmid A.Delage D.-X.Xu S.Janz P.Corredera article Applied Surface Science 2015 11 30 356 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 631–638 Thin solar Cu(In,Ga)Se2 cells, Ion beam analysis, RBS/PIXE techniques, Synchrotron GIXRF analysis, Depth profiling http://ac.els-cdn.com/S0169433215019467/1-s2.0-S0169433215019467-main.pdf?_tid=cba9d288-1c21-11e6-9bf0-00000aab0f26&acdnat=1463484395_b9279df87868924a41b103cfe0aeacf7 EMRP A169: Call 2013 Energy II Elsevier 30 0169-4332 10.1016/j.apsusc.2015.08.133 1 59 No, EURAMET is never allowed to make the publication publicly available. AGKKarydas CSStreeck IBRBogdanovic Radovic CKKaufmann TRRissom BBBeckhoff MJJakšic NPBBarradas proceedings SperlingPTRPJBR2015 Proceedings of the CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard 2015 11 26 1 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 1-5 LED standard, multiple standard, characterisation sphere setup EMRP A169: Call 2013 Energy II Commission Internationale de L'Eclairage

CIE Central Bureau, Babenbergerstraße 9/9A, 1010 Vienna, Austria

Braunschweig, Germany CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard 26-11-2015 to 26-11-2015 30 978-3-902842-28-2 NA A.Sperling S.Penda M.Taddeo E.Revtova T.Poikonen W.Jordan P.Blattner D.Renoux article SourgenCBDJSH2015 Meteorological Applications 2015 11 18 22 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 836-841 calibration; thermistors; uncertainty; stratosphere; metrological characterization EMRP A169: Call 2010 Environment Wiley 30 1350-4827 10.1002/met.1504 NA D.Sourgen G.Coeur-Joly J.Bordereau T.Deuzé D.Jouin F.Sparasci A.Hertzog article Metrologia 2015 11 12 52 6 SIB04: Ion Clock: High-accuracy optical clocks with trapped ions 842-856 blackbody radiation shift, ion traps, optical atomic clocks, ion clocks, thermal and high frequency finite element method modelling http://iopscience.iop.org/article/10.1088/0026-1394/52/6/842 EMRP A169: Call 2011 SI Broader Scope IOP Publishing, BIPM

Bristol

30 0026-1394, 1681-7575 10.1088/0026-1394/52/6/842 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MDoležal PBalling P B RNisbet-Jones S AKing J MJones H AKlein PGill TLindvall A EWallin MMerimaa CTamm CSanner NHuntemann NScharnhorst I DLeroux P OSchmidt TBurgermeister T EMehlstäubler EPeik manual 2015 11 2015 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects Nanoparticles, SEM, PMMA http://www.ptb.de/emrp/2618.html EMRP A169: Call 2011 Metrology for New Technologies 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. H.Jones J.Urquhart D.Cox article OliveroGSGMEDBBAMTF2015 563 Scientific Reports 2015 10 29 5 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 15901 Single Photon Sources, NV centers https://www.nature.com/articles/srep15901 EMPIR 2014: Industry Springer Nature 30 2045-2322 10.1038/srep15901 NA J.Forneris P.Traina D.G.Monticone G.Amato L.Boarino G.Brida I.P.Degiovanni E.Enrico E.Moreva V.Grilj N.Skukan M.Jakšić M.Genovese P.Olivero article Measuring the Thickness of Flakes of Hexagonal Boron Nitride Using the Change in Zero-Contrast Wavelength of Optical Contrast 2015 10 19 5 SIB51: GraphOhm: Quantum resistance metrology based on graphene 503-507 Thickness, Optical contrast, h-BN, Microscope, Optical inspection, Surface measurements, Thin films, figure, optical properties http://www.osapublishing.org/abstract.cfm?uri=josk-19-5-503 EMRP A169: Call 2012 SI Broader scope (II) Journal of the Optical Society of Korea 30 10.3807/JOSK.2015.19.5.503 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. KimDong Hyun KimSung-Jo YuJeong-Seon KimJong-Hyun article ReganFJPCP2015 Applied Radiation and Isotopes 2015 10 104 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 203-211 Half-Life, 227Th, Radioactivity ,Nucleardata, Radioactivity ,γ-rayspectrometry ,Ionisation chamber ,Nuclearmedicine, NORM, TENORM EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2015.07.001 NA P.H.Regan K.M.Ferreira S.M.Jerome S.Pommé S.M.Collins A.K.Pearce article 17th International Congress of Metrology 2015 9 21 17th 2015 SIB64: METefnet: Metrology for moisture in materials 15003 Development - Moisture in materials http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences

London

30 NA 10.1051/metrology/20150015003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SBell AAro FArpino SAytekin GCortellessa MDell’Isola ZFerenčíková VFernicola RGavioso EGeorgin MHeinonen DHudoklin LJalukse NKaraböce ILeito AMäkynen PMiao JNielsen INicolescu MRudolfová MOjanen-Saloranta PÖsterberg PØstergaard MRujan MSega RStrnad TVachova article Microscopy and Microanalysis 2015 9 14 21 6 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 1644-1648 elemental distributions, thin films, laser-induced breakdown spectroscopy, grazing-incidence X-ray fluorescence analysis, comparison http://journals.cambridge.org/action/displayAbstract?fromPage=online&aid=10063275&fulltextType=RA&fileId=S1431927615015093 EMRP A169: Call 2013 Energy II Cambridge University Press (CUP) 30 1431-9276 10.1017/S1431927615015093 1 59 No, EURAMET is never allowed to make the publication publicly available. DARAbou-Ras RCCaballero CSStreeck BBBeckhoff JHIIn SJJeong article Physical Review Letters 2015 9 11 115 11 HLT10: BiOrigin : Metrology for biomolecular origin of disease 117801 https://www.researchgate.net/publication/280773225_Molecular-Scale_Remnants_of_the_Liquid-Gas_Transition_in_Supercritical_Polar_Fluids EMRP A169: Call 2011 Metrology for Health American Physical Society

Maryland

10.1103/PhysRevLett.115.117801 1 59 No, EURAMET is never allowed to make the publication publicly available. V. P.Sokhan A.Jones F. S.Cipcigan J.Crain G. J.Martyna article KimNHLAHLHMLHJBCPYKSPPHK2015 ACS Nano 2015 8 25 9 8 SIB51: GraphOhm: Quantum resistance metrology based on graphene 8352-8360 amorphous carbon, bottom-up growth, graphene, graphene growth from polymer, graphene-based heterostructure EMRP A169: Call 2012 SI Broader scope (II) American Chemical Society (ACS)

Washington, USA

30 1936-0851, 1936-086X 10.1021/acsnano.5b03037 NA Kwang S.Kim Konstantin S.Novoselov ChanyongHwang ZonghoonLee Jong-HyunAhn Sang WooHan Tae GeolLee SeungHyun ArtemMishchenko Seoung-KiLee SungHuh GumhyeJeon JinseokByun Dong-HunChae Hyo JuPark Seong UkYu Yong-JinKim Jin GyeongSon JaesungPark BeomjinPark Byung HeeHong Jin KonKim article Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system 2015 8 19 2 3 SIB51: GraphOhm: Quantum resistance metrology based on graphene 035015 graphene, Quantum Hall, cryogen-free, measurement http://iopscience.iop.org/2053-1583/2/3/035015/video/abstract EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing Ltd 30 2053-1583 10.1088/2053-1583/2/3/035015 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.J.B.M.Janssen S.Rozhko I.Antonov A.Tzalenchuk J. M.Williams Z.Melhem H.He S.Lara-Avila S.Kubatkin R.Yakimova article Journal of Infrared, Millimeter, and Terahertz Waves 2015 8 15 36 11 SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1089-1100 Scattering parameters, Waveguide standards, Measurement uncertainty, Verification artifacts, Microwave measurements EMRP A169: Call 2012 SI Broader scope (II) Springer

New York

30 1866-6906 10.1007/s10762-015-0193-1 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. N.Shoaib K.Kuhlmann R.Judaschke M.Sellone L.Brunetti proceedings 135 IAG 150 Years - Proceedings of the 2013 IAG Scientific Assembly 2015 8 1 143 2015 SIB60: Surveying: Metrology for long distance surveying calibration · EDM · GNSS · local ties · reference baseline · long distance http://link.springer.com/chapter/10.1007%2F1345_2015_154 EMRP A169: Call 2012 SI Broader scope (II) Springer International Publishing

Berlin Heidelberg

Potsdam, Germany International Association of Geodesy (IAG) Scientific Assembly 2013 September 1-6, 2013 30 0939-9585 10.1007/1345_2015_154 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Pollinger M.Astru A.Bauch S.Bergstrand B.Görres J.Jokela U.Kallio H.Koivula H.Kuhlmann V.Kupko K.Meiners-Hagen M.Merimaa W.Niemeier P.Neyezhmakov M.Poutanen F.Saraiva S.Schön S.A.van den Berg J.-P.Wallerand M.Zucco article 2015 7 SIB51: GraphOhm: Quantum resistance metrology based on graphene epitaxial graphene, measurements, graphene, magnetotransport, magnetic field B∥, http://arxiv.org/abs/1507.03841v1 EMRP A169: Call 2012 SI Broader scope (II) arXiv.org 30 10.1103/PhysRevLett.115.106602 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S.Lara-Avila S.Kubatkin O.Kashuba J. A.Folk S.Lüscher R.Yakimova T.J.B.M.Janssen A.Tzalenchuk V.Fal'ko proceedings BlattnerKJSHB2015 Proceedings of the 28th Session of the CIE Manchester, United Kingdom, 28 June – 4 July 2015 2015 7 1 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 797-811 measurement uncertainty, LED, CIE S 025, Test Method for LED lamps, international standard EMRP A169: Call 2013 Energy II Commission Internationale de L'Eclairage

CIE Central Bureau, Babenbergerstraße 9/9A, 1010 Vienna, Austria

Manchester, UK 28th Session of the CIE 28-06-2015 to 04-07-2015 30 978-3-902842-55-8 NA P.Blattner U.Krüger W.Jordan W.Steudtner R.Hornischer W.Bechter article Optics Express 2015 6 30 23 15 SIB04: Ion Clock: High-accuracy optical clocks with trapped ions 19771-19776 http://arxiv.org/abs/1505.02084 EMRP A169: Call 2011 SI Broader Scope 30 1 59 No, EURAMET is never allowed to make the publication publicly available. N.Scharnhorst J. B.Wübbena S.Hannig K.Jakobsen J.Kramer I. D.Leroux P. O.Schmidt proceedings Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 2015 2015 6 15 n/a n/a ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1-5 phasor measurement units, smart grids, renewable energy sources http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf EMRP A169: Call 2013 Energy II n/a

n/a

Lyon, France 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 14-06-15 to 15-06-15 30 n/a n/a 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf GRietveld AJongepier Jvan Seters MVisser PLiu MAcanski DHoogenboom H. E.van den Brom article Proceedings of the National Academy of Sciences of the United States of America 2015 5 19 112 20 HLT10: BiOrigin : Metrology for biomolecular origin of disease 6341-6346 subcritical water intermolecular interactions many-body dispersion coarse-grained model electronic responses http://www.pnas.org/content/112/20/6341.full.pdf EMRP A169: Call 2011 Metrology for Health PNAS

Washington

30 10.1073/pnas.1418982112 1 59 No, EURAMET is never allowed to make the publication publicly available. Vlad P.Sokhan Andrew P.Jones Flaviu S.Cipcigan JasonCrain Glenn J.Martyna article Radiation Protection Dosimetry 2015 5 19 164 4 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 493-496 Timepix, EEC, radon progenies http://rpd.oxfordjournals.org/content/164/4/493.long EMRP A169: Call 2012 Metrology for Industry (II) Oxford University Press

Oxford

30 1742-3406 10.1093/rpd/ncv343 1 59 No, EURAMET is never allowed to make the publication publicly available. http://rpd.oxfordjournals.org/content/164/4/493.abstract BBBulánek JHHůlka KJJílek IŠŠtekl proceedings Proceedings Radio Science Conference (URSI AT-RASC), 2015 1st URSI Atlantic 2015 5 16 n.a. n.a. SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1 verification, waveguide EMRP A169: Call 2012 SI Broader scope (II) IEEE

Danvers

Gran Canaria Radio Science Conference (URSI AT-RASC), 2015 1st URSI Atlantic 16-05-2015 to 24-05-2015 30 n.a. n.a. 10.1109/URSI-AT-RASC.2015.7302818 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 N.Shoaib K.Kuhlmann R.Judaschke article Measurement 2015 5 14 SIB58: Angles: Angle metrology Angle measurement; Angle standard; Angle encoder; Autocollimator; Traceability; Key comparison EMRP A169: Call 2012 SI Broader scope (II) 30 59 No, EURAMET is never allowed to make the publication publicly available. R DGeckeler MKrause AJust OKranz HBosse article Comptes Rendus Physique 2015 5 8 16 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 531–539 Time and frequency metrology Optical links Frequency stabilized lasers Fibre optics www.sciencedirect.com EMRP A169: Call 2011 SI Broader Scope 30 10.1016/j.crhy.2015.04.005 1 59 No, EURAMET is never allowed to make the publication publicly available. O.Lopez F.Kéfélian H.Jiang A.Haboucha A.Bercy F.Stefani B.Chanteau A.Kanj D.Rovera J.Achkar CChardonnet P.-O.Pottie A.Amy-Klein G.Santarelli article Advanced Optical Technologies 2015 5 SIB58: Angles: Angle metrology angle metrology; autocollimator calibration; deflectometry; spatial angles; synchrotron metrology EMRP A169: Call 2012 SI Broader scope (II) 30 10.1515/aot-2015-0017 59 No, EURAMET is never allowed to make the publication publicly available. OKranz R DGeckeler AJust MKrause WOsten article Acta Physica Polonica A 2015 5 127 5 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 1516-1519 PACS numbers: 87.53.Bn, 87.53.-j http://przyrbwn.icm.edu.pl/APP/ABSTR/127/a127-5-18.html EMRP A169: Call 2011 SI Broader Scope 30 10.12693/APhysPolA.127.1516 59 No, EURAMET is never allowed to make the publication publicly available. U.Kamierczak A.Bantsar D.Banas J.Braziewicz J.Czub M.Jaskóla A.Korman M.Kruszewski A.Lankoff H.Lisowska M.Pietrzak S.Pszona T.Stepkowski Z.Szeflinski M.Wojewódzka article Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements 2015 5 SIB51: GraphOhm: Quantum resistance metrology based on graphene Dirac-point physics, epitaxial graphene, magneto-transport, measurement, graphene, hall effect, electron-hole puddles, http://arxiv.org/abs/1505.03747 EMRP A169: Call 2012 SI Broader scope (II) arXiv.org 30 10.1103/PhysRevB.92.075407 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Huang J.A.Alexander-Webber A.M.R.Baker T.J.B.M.Janssen A.Tzalenchuk V.Antonov T.Yager S.Lara-Avila S.Kubatkin R.Yakimova R.J.Nicholas article JakubowskiPFR2015 Environmental Science and Pollution Research 2015 5 22 13 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 9589-9594 Tributyltin, European Water Framework Directive, Whole water body, Reference method EMRP A169: Call 2010 Environment Springer Nature 30 0944-1344, 1614-7499 10.1007/s11356-015-4614-4 NA N.Jakubowski R.Philipp I.Fettig J.Richter article Metrologia 2015 4 24 52 4 SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 469–477 VNA verification standard, coaxial air-line, type N coaxial connector http://stacks.iop.org/0026-1394/52/i=4/a=469 EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing on behalf of BIPM

Bristol

30 1681-7575 10.1088/0026-1394/52/4/469 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. N.Shoaib K.Kuhlmann R.Judaschke article Nature Nanotechnology 2015 4 20 10 SIB51: GraphOhm: Quantum resistance metrology based on graphene 965-971 graphene, QHR, measurement https://www.ptb.de/emrp/resources/documents/graphohm/Sonstige_Fotos/NatureComms7806-2015-Lafont.pdf EMRP A169: Call 2012 SI Broader scope (II) Macmillan Publishers 30 10.1038/ncomms7806 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Lafont R.Ribeiro-Palau D.Kazazis A.Michon O.Couturaud C.Consejo T.Chassagne M.Zielinski M.Portrail B.Jouault F.Schopfer W.Poirier article Vacuum 2015 4 8 IND12: Vacuum: Vacuum metrology for production environments Outgassing rate measurement, Outgassing reference probes, Outgassing reference samples EMRP A169: Call 2010 Industry 30 0042-207X 10.1016/j.vacuum.2015.03.033 59 No, EURAMET is never allowed to make the publication publicly available. V.Hauer K.Battes M.Flämmich V.Lerardi K.Jousten J.Šetina article Analytical Chemistry 2015 4 7 87 7 HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms 3706-13 digital PCR, tuberculosis, molecular diagnostics, extraction, purification, platform, primer, precision, bias, genomic DNA, mycobacterium, reproducibility, mycobacterium tuberculosis, mycobacterium bovis, infection, infectious disease http://pubs.acs.org/doi/abs/10.1021/ac5041617 EMRP A169: Call 2011 Metrology for Health ACS Publications

Washington

30 1520-6882 10.1021/ac5041617 1 59 No, EURAMET is never allowed to make the publication publicly available. ASDevonshire IHoneyborne AGutteridge ASWhale GNixon PWilson GJones TDMcHugh CAFoy JFHuggett article Journal of Biomolecular NMR 2015 2 21 62 1 HLT10: BiOrigin : Metrology for biomolecular origin of disease 17-23 7 trans-membrane proteins Poorly available proteins Fast magic angle spinning Heteronuclear detection 13C-detection Low sample volumes http://link.springer.com/article/10.1007%2Fs10858-015-9911-1 EMRP A169: Call 2011 Metrology for Health Springer

Berlin

30 10.1007/s10858-015-9911-1 1 59 No, EURAMET is never allowed to make the publication publicly available. AnthonyWatts Peter J.Judge LubicaAsilmovska Marc PhilippPfeil Victoria A.Higman KrisztinaVarga Garrick F.Taylor Hugh R WDannatt article RoyROHCJIWG2015 Physical Review Letters 2015 2 11 114 6 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems Optical Spin-Transfer-Torque-Driven Domain-Wall Motion in a Ferromagnetic Semiconductor EMRP A169: Call 2012 Open excellence call American Physical Society (APS)

1 Research Rd, Ridge, NY 11961, USA

30 0031-9007, 1079-7114 10.1103/PhysRevLett.114.067202 NA P. E.Roy A. J.Ramsay R. M.Otxoa J. A.Haigh R. P.Campion T.Janda A. C.Irvine J.Wunderlich B. L.Gallagher article BeckerBBBJJMPV2015 Measurement 2015 2 61 IND12: Vacuum: Vacuum metrology for production environments Gas flow metrology, Standard leak artefacts, Experimental data set A169 EMRP A169: Call 2010 Industry English 10.1016/j.measurement.2014.10.045 1 59 NA UteBecker DjlaliBentouati MerdedeBergoglio FrédéricBoineau WolfangJitschin KarlJousten DomenicoMari DominikPražák MartinVičar article Analyst 2015 1 28 140 6 HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices http://pubs.rsc.org/en/Content/ArticleLanding/2015/AN/C4AN02248C#!divAbstract EMRP A169: Call 2011 Metrology for Health 30 0003-2654 10.1039/c4an02248c 59 No, EURAMET is never allowed to make the publication publicly available. A.Hennig P. M.Dietrich F.Hemmann T.Thiele H.Borcherding A.Hoffmann U.Schedler C.Jäger U.Resch-Genger W. E. S.Unger article MorenoNJCZ2015 Journal of Quantitative Spectroscopy and Radiative Transfer 2015 1 151 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 251-259 Laser spectroscopy, Optical parametric oscillator, Line Parameters, Methane EMRP A169: Call 2010 Environment Elsevier BV

New York, USA

30 0022-4073 10.1016/j.jqsrt.2014.10.006 NA Marco P.Moreno LinhNguyen MohammadJahjah MaloCadoret Jean-JacquesZondy proceedings WinterOOJvWISN2015 Proc. Intl. Soc. Mag. Reson. Med. 2015 23 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI http://www.ismrm.org/15/ A169 EMRP A169: Call 2011 Metrology for Health Toronto, Ontario, Canada ISMRM 23rd Annual Meeting & Exhibition 30 May-05 June 2015 English 1 59 NA LukasWinter EvaOberacker CelalÖzerdem YiyiJi Florianvon Knobelsdorff-Brenkenhoff GerdWeidemann BerndIttermann FrankSeifert ThoralfNiendorf proceedings WinterOOJvWISN2015_2 Proc. Intl. Soc. Mag. Reson. Med. 2015 23 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI http://www.ismrm.org/15/ A169 EMRP A169: Call 2011 Metrology for Health Toronto, Ontario, Canada ISMRM 23rd Annual Meeting & Exhibition 30 May-05 June 2015 English 1 59 NA LukasWinter EvaOberacker CelalÖzerdem YiyiJi Florianvon Knobelsdorff-Brenkenhoff GerdWeidemann BerndIttermann FrankSeifert ThoralfNiendorf article tm – Technisches Messen 2015; 82(7–8): 359–366 2015 82 7-8 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 359-366 Nanopositioning and nanomeasuring machine, multiscale measurement, optical and tactile sensors EMRP A169: Call 2012 Metrology for Industry (II) De Gruyter

Oldenbourg

30 10.1515/teme-2015-0011 1 59 No, EURAMET is never allowed to make the publication publicly available. E.Manske R.Fuessl R.Mastylo N.Vorbringer-Dorozhovets O.Birli G.Jaeger proceedings Frequency Control Symposium & the European Frequency and Time Forum (FCS), 2015 Joint Conference of the IEEE International 2015 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 276-279 Frequency transfer, Optical fiber network, Optical fiber, DWDM. http://ieeexplore.ieee.org/xpl/articleDetails.jsp?reload=true&arnumber=7138840 EMRP A169: Call 2011 SI Broader Scope IEEE Denver, CO 12-16 April 2015 30 978-1-4799-8865-5 10.1109/FCS.2015.7138840 59 No, EURAMET is never allowed to make the publication publicly available. S.-C.Ebenhag M.Zelan P. O.Hedekvist M.Karlsson B.Josefsson article Phys. Chem. Chem. Phys. 2015 17 14 HLT10: BiOrigin : Metrology for biomolecular origin of disease 8660-8669 http://pubs.rsc.org/en/content/articlelanding/2015/cp/c4cp05506c#!divAbstract EMRP A169: Call 2011 Metrology for Health RSC Publishing

Cambridge

30 10.1039/C4CP05506C 1 59 No, EURAMET is never allowed to make the publication publicly available. Flaviu S.Cipcigan Vlad P.Sokhan Andrew P.Jones JasonCrain Glenn J.Martyna article JEOS 2015 10 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices Optical metrology, ellipsometry, scatterometry, RCWA, Fourier scatterometry, sensitivity EMRP A169: Call 2010 Industry 30 1990-2573 10.2971/jeos.2015.15002 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. P.Petrik N.Kumar M.Fried B.Fodor G.Juhasz S.E.Pereira S.Burger H. P.Urbach article Metrologia 2015 52 2015 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies 433-443 watt balance, Planck’s constant, kilogram EMRP A169: Call 2011 SI Broader Scope IOP Publishing 30 10.1088/0026-1394/52/2/433 1 59 No, EURAMET is never allowed to make the publication publicly available. MatthieuThomas PatrickEspel DjamelZiane PatrickPinot PatrickJuncar FranckPereira Dos Santos SébastienMerlet FrançoisPiquemal GérardGenvès article Metrologia 2015 52 6 SIB10: NOTED: Novel techniques for traceable temperature dissemination 827-834 water triple point, thermometry, oxygen isotopes, isotope correction. http://iopscience.iop.org/article/10.1088/0026-1394/52/6/827/meta EMRP A169: Call 2011 SI Broader Scope IOP Publishing, Bureau International des Poids et Mesures

Berlin

30 ISSN 0026-1394 10.1088/0026-1394/52/6/827 1 59 No, EURAMET is never allowed to make the publication publicly available. V.Faghihi M.Kozick A.TAerts-Bijma H. G.Jansen J.J.Spriensma A.Peruzzi H.A.J.Meijer proceedings Proceedings 2015 IEEE International Symposium on Medical Measurements and Applications 2015 - - SIB54: Bio-SITrace: Traceability for biologically relevant molecules 517-520 erythrocytes, leukocytes, cell concentration, reference measurement procedure, dead time correction, external quality assurance - EMRP A169: Call 2012 SI Broader scope (II) IEEE (ed.)

New York

Torino, Italy 2015 IEEE International Symposium on Medical Measurements and Applications 07-05-2015 to 09-05-2015 30 978-1-4799-6476-5 978-1-4799-6477-2/15 1 59 No, EURAMET is never allowed to make the publication publicly available. IEEE Catalog Number: CFP15MEA-USB M.Kammel A.Kummrow M.John K.Witt J.Neukammer inbook 2015 3 SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology 29-24 AFM/STM measurements EMRP A169: Call 2012 SI Broader scope (II) Springer International Publishing Switzerland Noncontact Atomic Force Microscopy 30 978-3-319-15587-6 10.1007/978-3-319-15588-3_3 59 No, EURAMET is never allowed to make the publication publicly available. P.Hapala M.Ondrácek O.Stetsovych M.Švec P.Jelínek article METEOROLOGICAL APPLICATIONS 2015 22 1 ENV58: MeteoMet2: Metrology for essential climate variables 842 - 846 automatic weather station calibration; calibration chamber; pressure; simultaneous calibration of pressure and temperature;temperature;thermometercalibrationinair;traceabilityformeteorologicalobservations;uncertainty http://onlinelibrary.wiley.com/doi/10.1002/met.1514/abstract EMRP A169: Call 2013 Environment II Royal Meteorological Society

Reading

30 1350-4827 10.1002/met.1514 1 59 No, EURAMET is never allowed to make the publication publicly available. GLopardo SBellagarda FBertiglia AMerlone GRoggero NJandric article HapalaTSJ2014 Physical Review Letters 2014 11 28 PRL 113 226101 SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology 226101-1 - 226101-5 A169 EMRP A169: Call 2012 SI Broader scope (II) 10.1103/PhysRevLett.113.226101 1 59 NA ProkopHapala RuslanTemirov F.Stefan Tautz PavelJelínek article Metrologia 2014 11 20 51 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate S314–S318 BRDF, modelling, aluminium, anodized, reflectance http://iopscience.iop.org/article/10.1088/0026-1394/51/6/S314/meta EMRP A169: Call 2010 Environment IOP Publishing

Bristol

30 0026-1394 10.1088/0026-1394/51/6/S314 1 59 No, EURAMET is never allowed to make the publication publicly available. PJJaanson FMManoocheri HMMäntynen MGGergely JLWWidlowski EIIkonen article Metrologia 2014 11 20 51 6 IND07: Thin Films: Metrology for the manufacturing of thin films S302-S308 http://iopscience.iop.org/article/10.1088/0026-1394/51/6/S302/meta EMRP A169: Call 2010 Industry IOP Publishing 30 0026-1394 10.1088/0026-1394/51/6/S302 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SPPourjamal HMMäntynen PJJaanson DMRRosu AHHertwig FMManoocheri EIIkonen proceedings MuhligSLJSB2014 Proceedings of 58th Ilmenau Scientific Colloqium 2014 11 11 IND10: Form metrology: Optical and tactile metrology for absolute form characterization Twyman-Green Interferometer, Asphere and freeform measurement, Interfrometer calibration, Virtual experiments http://www.db-thueringen.de/servlets/DocumentServlet?id=24989 A169 EMRP A169: Call 2010 Industry Technische Universität Ilmenau, Ilmenau, Germany 58th Ilmenau Scientific Colloquium 08 - 12 Sep. 2014 English 1 59 NA S.Mühlig J.Siepmann M.Lotz S.Jung J.Schindler G.Baer proceedings LotzSMJB2014 Proceedings of 58th Ilmenau Scientific Colloqium 2014 11 11 58 IND10: Form metrology: Optical and tactile metrology for absolute form characterization Tilted Wave Interferometer, Asphere and freeform measurement, Design http://www.db-thueringen.de/servlets/DerivateServlet/Derivate-30704/ilm1-2014iwk-117.pdf A169 EMRP A169: Call 2010 Industry Technische Universität Ilmenau, Ilmenau, Germany 58th ILMENAU SCIENTIFIC COLLOQUIUM 8.-12. September 2014 1 59 NA M.Lotz J.Siepmann S.Mühlig S.Jung G.Baer article MaringerSKCPGCDVHRMSJDTAHM2014 Applied Radiation and Isotopes 2014 11 81 ENV09: MetroRWM: Metrology for Radioactive Waste Management Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal http://www.sciencedirect.com/ A169 EMRP A169: Call 2010 Environment English 0969-8043 10.1016/j.apradiso.2013.03.046 1 59 NA F.J.Maringer J.Šuráň P.Kovář B.Chauvenet V.Peyres E.García-Toraño M.L.Cozzella P.De Felice B.Vodenik M.Hult U.Rosengård M.Merimaa L.Szücs C.Jeffery J.C.J.Dean Z.Tymińsk D.Arnold R.Hincam G.Mirescu article Physical Review Letters 2014 11 113 21 SIB04: Ion Clock: High-accuracy optical clocks with trapped ions Optical frequency metrology, fundamental constants EMRP A169: Call 2011 SI Broader Scope 30 0031-9007 10.1103/PhysRevLett.113.210801 1 59 No, EURAMET is never allowed to make the publication publicly available. R. M.Godun P. B. R.Nisbet-Jones J. M.Jones S. A.King L. A. M.Johnson H. S.Margolis K.Szymaniec S. N.Lea K.Bong P.Gill article TesaovaBGWERCTSJNMMN2014 Physical Review B 2014 10 23 90 15 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems Comparison of micromagnetic parameters of the ferromagnetic semiconductors (Ga,Mn)(As,P) and (Ga,Mn)As EMRP A169: Call 2012 Open excellence call American Physical Society (APS)

1 Research Rd, Ridge, NY 11961, USA

30 1098-0121, 1550-235X 10.1103/PhysRevB.90.155203 NA N.Tesařová D.Butkovičová B. L.Gallagher P.Wadley K. W.Edmonds A. W.Rushforth R. P.Campion F.Trojánek E.Schmoranzerová T.Jungwirth V.Novák P.Motloch P.Malý P.Němec article Analytical and Bioanalytical Chemistry 2014 10 1 406 / 2014 27 HLT05: Metallomics: Metrology for metalloproteins 6963–6977 Bioanalytical methodsCell systems/single cell analysisMass spectrometry/ICP-MS http://link.springer.com/article/10.1007/s00216-014-8143-7 EMRP A169: Call 2011 Metrology for Health Springer Berlin

Heidelberg

30 1618-2642 (print); 1618-2650 (online) 10.1007/s00216-014-8143-7 1 No, EURAMET is never allowed to make the publication publicly available. LarissaMueller HeikeTraub NorbertJakubowski DanielaDrescher Vladimir I.Baranov JaninaKneipp article Analytical and Bioanalytical Chemistry 2014 10 406 26 SIB54: Bio-SITrace: Traceability for biologically relevant molecules 6499-6512 Cell-free DNA, Circulating nucleic acids, Clinical/biomedical analysis, Diagnostics, Liquid biopsy,Reference materials http://link.springer.com/article/10.1007%2Fs00216-014-7835-3 EMRP A169: Call 2012 SI Broader scope (II) Springer

Berlin

30 1618-2650 10.1007/s00216-014-7835-3 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. ASDevonshire ASWhale AGutteridge GJones SCowen CAFoy JFHuggett article Journal of Quantitative Spectroscopy and Radiative Transfer. 2014 10 146 Electromagnetic and Light Scattering by Nonspherical Particles XIV ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate 376-390 Bidirectional reflectance, BRF, Spectrum, Polarisation, Calibration http://www.sciencedirect.com/science/article/pii/S0022407314001666 EMRP A169: Call 2010 Environment Elsevier 30 0022-4073 10.1016/j.jqsrt.2014.04.011 1 59 No, EURAMET is never allowed to make the publication publicly available. JIPPeltoniemi THHakala JSSuomalainen EHHonkavaara LMMarkelin MGGritsevich JEEskelinen PJJaanson EIIkonen article Journal of Sol-Gel Science and Technology 2014 9 23 73 3 IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale 544-549 Nanogerator, p–n junction, ZnO nanorods, Piezoelectric, Energy harvesting, Surface passivation http://link.springer.com/article/10.1007%2Fs10971-014-3512-4 EMRP A169: Call 2012 Metrology for Industry (II) Springer US 30 0928-0707 10.1007/s10971-014-3512-4 59 No, EURAMET is never allowed to make the publication publicly available. NJJalali JBBriscoe YZTZhi Tan PWWoolliams MSStewart PMWWeaver MGCCain SDDunn article LerardiBPFVJ2014 Measurement 2014 9 16 58 IND12: Vacuum: Vacuum metrology for production environments Focused ion beam,Nanotechnology, SEM, STEM, AFM, Standard leak, Gas flow meter, Vacuum Metrology, DSMC. A169 EMRP A169: Call 2010 Industry English 10.1016/j.measurement.2014.09.017 1 59 NA V.Lerardi U.Becker S.Pantazis G.Firpo U.Valbusa K.Jousten article WinterOOJvWISN2014 Magnetic Resonance in Medicine 2014 9 11 early view HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI ultrahigh field MR; RF heating; coronary stents; specific absorption rate; RF power deposition A169 EMRP A169: Call 2011 Metrology for Health english 1522-2594 10.1002/mrm.25483 1 59 NA LukasWinter EvaOberacker Celal €Ozerdem YiyiJi Florianvon Knobelsdorff-Brenkenhoff GerdWeidemann BerndIttermann FrankSeifert ThoralfNiendorf article Measurement Science and Technology 2014 9 25 10 SIB58: Angles: Angle metrology angle, metrology, calibration, rotary encoder, autocollimator, shearing, error-separation EMRP A169: Call 2012 SI Broader scope (II) 30 10.1088/0957-0233/25/10/105009 59 No, EURAMET is never allowed to make the publication publicly available. R DGeckeler AJust article Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene 2014 9 SIB51: GraphOhm: Quantum resistance metrology based on graphene hot carriers, bilayer graphene, energy loss rate, magnetotransport http://arxiv.org/abs/1409.6267v1 EMRP A169: Call 2012 SI Broader scope (II) arXiv.org 30 10.1088/0953-8984/27/16/164202 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Huang J.A.Alexander-Webber T.J.B.M.Janssen A.Tzalenchuk T.Yager S.Lara Avila S.Kubatkin R. L.Myers-Ward D. K.Gaskill R.J.Nicholas proceedings Proceedings on 29th Conference on Precision Eletromagnetic Measurements 2014 8 25 n.a. n.a. SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 20-21 Comparison, complex, complex quantity, equivalence, measurements comparison, measurement uncertainty, uncertainty EMRP A169: Call 2012 SI Broader scope (II) IEEE

Danvers

Rio de Janeiro 29th Conference on Precision Eletromagnetic Measurements 25-08-2014 to 29-08-2014 30 978-1-4799-5205-2 0589-1485 10.1109/CPEM.2014.6898238 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-1-1 K.Kuhlmann R.Judaschke proceedings Proceedings of 29-th Conference on Precision Electromagnetic Measurements (CPEM) 2014 8 24 29 1 NEW07: THz Security: Microwave and terahertz metrology for homeland security 188-189 Terahertz, Time Domain Spectroscopy, Time domain analysis, Spectroscopy, Terahertz measurements http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898322 EMRP A169: Call 2011 Metrology for New Technologies IEEE

Piscataway

Rio de Janeiro, Brazil Conference on Precision Electromagnetic Measurements 24-29/08/2014 30 978-1-4799-5205-2 0589-1485 10.1109/CPEM.2014.6898322 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. L.Oberto M.Bisi D.Jahn S.Lippert L.Brunetti proceedings SchererGJMPR2014 Nur online: EPJ Web of Conferences 77, 00004 (2014) 2014 8 19 77 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere http://epjwoc.epj.org/articles/epjconf/abs/2014/14/epjconf_icm2014_00004/epjconf_icm2014_00004.html A169 EMRP A169: Call 2011 SI Broader Scope Paris, France 16th International Congress of Metrology 7-10 October 2013 English 10.1051/epjconf/20147700004 1 59 NA H.Scherer S. P.Giblin X.Jehl A.Manninen F.Piquemal D. A.Ritchie article 16th International Congress of Metrology 2014 8 19 77 ENG01: GAS: Characterisation of Energy Gases 00018 http://www.epj-conferences.org/articles/epjconf/abs/2014/14/epjconf_icm2014_00018/epjconf_icm2014_00018.html EMRP A169: Call 2009 Energy EDP Sciences

Les Ulis

30 2100-014X 10.1051/epjconf/20147700018 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31 MSadli FBourson ADiril CJourneau DLowe CParga article Applied Physics Letters 2014 8 12 105 6 SIB51: GraphOhm: Quantum resistance metrology based on graphene 063106 dirac point, graphene, SiC http://scitation.aip.org/content/aip/journal/apl/105/6/10.1063/1.4892922 EMRP A169: Call 2012 SI Broader scope (II) AIP Publishing 30 10.1063/1.4892922 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Lartsev T.Yager T.Bergsten A.Tzalenchuk T.J.B.M.Janssen R.Yakimova S.Lara-Avila S.Kubatkin article GoveniusLTPJMVM2014 Physical Review B 2014 8 11 90 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 74.78.Na, 07.57.Kp, 74.45.+c, 85.25.Cp http://journals.aps.org/prb/abstract/10.1103/PhysRevB.90.064505 http://arxiv.org/abs/1403.6586 A169 EMRP A169: Call 2012 Open excellence call English 1098-0121 10.1103/PhysRevB.90.064505 1 59 NA J.Govenius R. E.Lake K. Y.Tan V.Pietilä J. K.Julin I. J.Maasilta P.Virtanen M.Möttönen proceedings 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 2014 8 SIB51: GraphOhm: Quantum resistance metrology based on graphene 662-663 C,Conductivity,Graphene,Metrology,Microwave measurement,Resistance,Silicon carbide,Substrates,electrical conductivity measurement,functional property,graphene,graphene metrology,graphene morphology,graphene topography,industrial production,joining processes,linking morphology,measurement standards,microwave materials,microwave measurement,noncontact microwave conductivity measurement,quality control,quantum Hall effect,rapid noninvasive quality control http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898559 EMRP A169: Call 2012 SI Broader scope (II) IEEE 30 978-1-4799-2479-0 0589-1485 10.1109/CPEM.2014.6898559 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.J.B.M.Janssen C.Giusca J.Gallop L.Hao O.Kazakova V.Panchal R.Pierce A.Tzalenchuk proceedings 29th Conference on Precision Electromagnetic Measurements (CPEM 2014), 2014 8 SIB51: GraphOhm: Quantum resistance metrology based on graphene 540--541 C,CVD graphene,Chemical Vapor Deposition (CVD),Copper (Cu),Electrical resistance measurement,Films,Graphene,Graphene (G),Magnetic field measurement,Quantum Hall effect (QHE),Raman spectra,Raman spectroscopy,Resistance,Substrates,Temperature measurement,chemical vapor deposition,chemical vapour deposition,electric variables measurement,electrical quantum metrology,electrical transport measurements,graphene,quantum Hall effect http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898498 EMRP A169: Call 2012 SI Broader scope (II) IEEE 30 978-1-4799-2479-0 0589-1485 10.1109/CPEM.2014.6898498 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Thodkar C.Nef W.Fu C.Schönenberger M.Calame F.Lüönd F.Overney B.Jeanneret proceedings 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 2014 8 SIB51: GraphOhm: Quantum resistance metrology based on graphene 226--227 AC resistor calculation,AC transport property,Bridge circuits,C,Electrical resistance measurement,Impedance,Metrology,Resistance,Standards,Voltage measurement,Windings,audio frequency measurement,automatic quantum Hall effect measurement,bridge circuit,bridge circuits,digitally assisted coaxial bridge,frequency 100 Hz to 20 kHz,frequency measurement,graphene,impedance standard,precision measurement,quantum Hall effect,resistors http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898341 EMRP A169: Call 2012 SI Broader scope (II) IEEE 30 978-1-4799-2479-0 0589-1485 10.1109/CPEM.2014.6898341 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Overney F.Lüönd B.Jeanneret article LafontRKMCCCZPJSP2014 Cornell University Library 2014 7 14 SIB51: GraphOhm: Quantum resistance metrology based on graphene http://arxiv.org/abs/1407.3615v1 A169 EMRP A169: Call 2012 SI Broader scope (II) 1 59 NA F.Lafont R.Ribeiro-Palau D.Kazazis A.Michon O.Couturaud C.Consejo T.Chassagne M.Zielinski M.Portail B.Jouault F.Schopfer W.Poirier article Methods 2014 7 1 68 2 HLT10: BiOrigin : Metrology for biomolecular origin of disease 317-324 Stable isotope; NanoSIMS; Atomic force microscopy; Backscattered electron imaging; Correlative analysis http://www.sciencedirect.com/science/article/pii/S1046202314000425 EMRP A169: Call 2011 Metrology for Health Elsevier Inc.

Amsterdam

30 10.1016/j.ymeth.2014.02.012 1 59 No, EURAMET is never allowed to make the publication publicly available. H.Jiang E.Favaro C.N.Goulbourne P.D.Rakowska G.M.Hughes M.G.Ryadnov L.G.Fong S.G.Young D.J.P.Ferguson A.L.Harris C.R.M.Grovenor article CadoretMNCZJ2014 Applied Physics B 2014 6 20 117 2 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 681-687 optical parametric oscillator, methane, line strength EMRP A169: Call 2010 Environment Springer Nature

233 Spring St, New York, NY 10013, USA

30 0946-2171, 1432-0649 10.1007/s00340-014-5883-1 NA MaloCadoret Marco P.Moreno LinhNguyen Flavio C.Cruz Jean-JacquesZondy MohammadJahjah article ChuaCLYLKKFYPJTS2014 Nano Letters 2014 5 21 SIB51: GraphOhm: Quantum resistance metrology based on graphene SiC epitaxial graphene, quantum hall e ff ect, scanning gate microscopy, monolayer and bilayer graphene, resistance metrology, quantum point contact A169 EMRP A169: Call 2012 SI Broader scope (II) English 10.1021/nl5008757 1 59 NA CassandraChua MalcolmConnolly ArseniyLartsev TomYager SamuelLara-Avila SergeyKubatkin SergeyKopylov VladimirFalko RositzaYakimova RuthPearce T. J. B. M.Janssen AlexanderTzalenchuk Charles G.Smith article Journal of Materials Chemistry A 2014 5 8 2014 2 IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale 10945-10951 TRUTHS, Cross-calibration, Libya-4, radiometric uncertainty http://pubs.rsc.org/en/content/articlelanding/2014/ta/c4ta01714e#!divAbstract EMRP A169: Call 2012 Metrology for Industry (II) Royal Society of Chemistry

London, England

30 2050-7488 10.1039/C4TA01714E 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. NJJalali PWWoolliams MSStewart PMWWeaver MGCCain SDDunn JBBriscoe article Physical Review A (Rapid Communications) 2014 5 A89 SIB04: Ion Clock: High-accuracy optical clocks with trapped ions http://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.050501 EMRP A169: Call 2011 SI Broader Scope 30 1050-2947 10.1103/PhysRevA.89.050501 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. GPBarwood GHuang HAKlein LAMJohnson SAKing HSMargolis KSzymaniec PGill article YuJPKHCKHK2014 Science Direct, Elsevier Carbon 2014 4 24 76 SIB51: GraphOhm: Quantum resistance metrology based on graphene 133-122 A169 EMRP A169: Call 2012 SI Broader scope (II) English 10.1016/j.carbon.2014.04.057 1 59 NA Jeong-SeonYu XiaozhanJin JaesungPark Dong HyunKim Dong-HanHa Dong-HunChae Wan-SeopKim ChanyongHwang Jong-HyunKim article Metrologia 2014 4 51 2 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies S88-S95 kilogram, International System of units SI, watt balance, guiding system, flexure mechanical ele-ments. http://iopscience.iop.org/article/10.1088/0026-1394/51/2/S88/meta EMRP A169: Call 2011 SI Broader Scope IOP

Bristol BS1 6HG

30 0026-1394 10.1088/0026-1394/51/2/S88 1 59 No, EURAMET is never allowed to make the publication publicly available. FCosandier AEichenberger HBaumann BJeckelmann BBonny VChatagny RClavel proceedings Surface and Interface Analysis 2014 3 18 46 10-11 IND15: SurfChem: Traceable quantitative surface chemical analysis for industrial applications SIMS; organic depth profiling; argon cluster; ToF-SIMS; Ar-GCIB http://onlinelibrary.wiley.com/doi/10.1002/sia.5429/abstract EMRP A169: Call 2010 Industry Sardinia European Applications of Surface and Interface Analysis - ECASIA'13 October 13-18, 2013 30 10.1002/sia.5429 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M.Holzweber A. G.Shard H.Jungnickel A.Luch W. E.S.Unger proceedings Proceedings of SPIE 2014 2 24 9018 IND52: XD Reflect: Multidimensional reflectometry for industry 901804 Reflectometry ; Metrology ; Modeling ; Optical design ; Optical testing ; Bidirectional reflectance transmission function ; CCD cameras ; Calibration ; Data analysis ; Light sources http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835520 EMRP A169: Call 2012 Metrology for Industry (II) SPIE - The International Society for Optical Engineering

Bellingham

San Francisco (USA) Measuring, Modeling, and Reproducing Material Appearance 4-5 February, 2014 30 978-0-8194-9935-6 0277-786X 10.1117/12.2035981 1 59 No option selected A.Höpe A.Koo F.-M.Verdu F.-B.Leloup G.Obein G.Wübbeler J.Campos P.Iacomussi P.Jaanson S.Källberg M.Smids article JOURNAL OF ATMOSPHERIC AND OCEANIC TECHNOLOGY 2014 2 31 2 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 447-457 Atmosphere-land interaction, Atmospheric circulation, Boundary layer, Wind, Planetary atmospheres, Instrumentation/sensors EMRP A169: Call 2010 Environment 30 0739-0572 10.1175/JTECH-D-13-00141.1 59 No, EURAMET is never allowed to make the publication publicly available. GC.HOLSTEIN-RATHLOU J.Merrison J. J.IVERSEN A. B.JAKOBSEN R.NICOLAJSEN P.NØRNBERG K.RASMUSSEN A.Merlone G.Lopardo T.HUDSON D.BANFIELD G.PORTYANKINA article Organic Electronics 2014 1 1 15 1 IND07: Thin Films: Metrology for the manufacturing of thin films 226-239 DITS, Polymer film, Charge trapping, DOS, Gaussian disorder, Exponential tail http://www.sciencedirect.com/science/article/pii/S1566119913005016 EMRP A169: Call 2010 Industry Elsevier

Amsterdam, Netherlands

30 1566-1199 10.1016/j.orgel.2013.11.014 1 59 No, EURAMET is never allowed to make the publication publicly available. IJJurić ETTutiš proceedings Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR 2014 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 444-445 Electron pumps, small currents, SI system EMRP A169: Call 2011 SI Broader Scope Rio de Janeiro Conference on Precision Electromagnetic Measurements 24-29 August 2014 30 978-1-4799-2478-3 59 No, EURAMET is never allowed to make the publication publicly available. S. P.Giblin T. J. B. M.Janssen J. D.Fletcher P.See M.Kataoka proceedings KohlmannBKDSSTGMJONLIWLVBECHvO2014 CPEM 2014 Digest 2014 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 522 - 523 AC Josephson voltage standards European Metrology Research Programme (EMRP) binary-divided Josephson series arrays pulse-driven Josephson series arrays http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250 A169 EMRP A169: Call 2012 SI Broader scope (II) Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements 24 - 29 August 2014 English 0589-1485 10.1109/CPEM.2014.6898489 1 59 NA J.Kohlmann R.Behr O.Kieler J.Diaz de Aguilar Rois M.Sira A.Sosso B.Trinchera J.Gran H.Malmbekk B.Jeanneret F.Overney J.Nissilä T.Lehtonen J.Ireland J.Williams R.Lapuh B.Voljc T.Bergsten G.Eklund T.Coskun Ozturk E.Houtzager H.E.van den Brom P.Ohlckers proceedings OverneyJ2014 CPEM 2014 Digest 2014 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 684 - 685 Metrology, impedance, measurement, LCR meters,calibration, audio frequency. http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6251114 A169 EMRP A169: Call 2012 SI Broader scope (II) Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements 24 - 29 August 2014 0589-1485 10.1109/CPEM.2012.6251114 1 59 NA Fr´ed´ericOverney BlaiseJeanneret proceedings Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR 2014 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 446-447 Electron Pump, Simulation, Coulomb Blockade, Si-CMOS, Charge Pumping EMRP A169: Call 2011 SI Broader Scope Rio de Janeiro Conference on Precision Electromagnetic Measurements 24-29 August 2014 30 978-1-4799-2478-3 59 No, EURAMET is never allowed to make the publication publicly available. S. J.Ray P.Clapera X.Jehl T.Charron S.Djordjevic L.Devoille E.Potanina G.Barinovs V.Kashcheyevs proceedings Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR 2014 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 442-443 Electron pumps, Cryogenic current comparator, Quantum metrology EMRP A169: Call 2011 SI Broader Scope Rio de Janeiro Conference on Precision Electromagnetic Measurements 24-29 August 2014 30 978-1-4799-2478-3 59 No, EURAMET is never allowed to make the publication publicly available. T.Charron L.Devoille S.Djordjevic O.Séron F.Piquemal P.Clapera S. J.Ray X.Jehl R.Wacquez M.Vinet article JoustenPBMWI2014 Vacuum 2014 100 IND12: Vacuum: Vacuum metrology for production environments 14-17 http://www.sciencedirect.com/science/article/pii/S0042207X13002546 EMRP A169: Call 2010 Industry Elsevier English 0042-207X 10.1016/j.vacuum.2013.07.037 1 59 NA K.Jousten S.Pantazis J.Buthig R.Model M.Wüest J.Iwicki proceedings Margolis2014 Proceedings of European Frequency and Time Forum & International Frequency Control Symposium (EFTF/IFC) 2014 SIB55: ITOC: International timescales with optical clocks 908-911 geodesy, international timescales, optical clock, redefinition of the second, time and frequency transfer http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6702183 EMRP A169: Call 2012 SI Broader scope (II) Prague, Czech Republic European Frequency and Time Forum & International Frequency Control Symposium (EFTF/IFC) 21 - 25 July 2013 English 10.1109/EFTF-IFC.2013.6702183 1 59 NA H.Margolis R.Godun P.Gill L.Johnson L.Shemar P.Whibberley D.Calonico F.Levi L.Lorini M.Pizzocaro P.Delva S.Bize J.Achkar H.Denker L.Timmen C.Voigt S.Falke D.Piester C.Lisdat U.Sterr S.Vogt S.Weyers J.Gersl T.Lindvall M.Merimaa article PommeGMCJVPS2014 Applied Radiation and Isotopes 2014 87 1 ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants Alpha-particle spectrometry; 238U; Decay data; Alpha-particle emissionprobabilities A169 EMRP A169: Call 2009 Energy English 0969-8043 10.1016/j.apradiso.2013.11.075 1 59 NA StefaanPommé EduardoGarcía-Toraño MariaMarouli Maria-TeresaCrespo ViktorJobbágy RafVan Ammel JanPaepen HeikoStroh article PantazisJ2014 Vacuum, Special Issue on Vacuum Gas Dynamics, 2014 2014 IND12: Vacuum: Vacuum metrology for production environments Unsteady flow, dynamic vacuum standard, DSMC, hybrid, gas expansion, vacuum gauge http://www.sciencedirect.com/science/article/pii/S0042207X1400164X A169 EMRP A169: Call 2010 Industry English 10.1016/j.vacuum.2014.05.005 1 59 NA S.Pantazis K.Jousten article JoustenK2014 Vacuum 2014 101 March 2014 IND12: Vacuum: Vacuum metrology for production environments 457-461 Vacuum metrology, standardization, ISO, quadrupole mass spectrometers A169 EMRP A169: Call 2010 Industry English 0042-207X 10.1016/j.vacuum.2013.07.013 1 59 NA KJousten Jin-TaeKim article PantazisBJ2014 International Journal of Heat and Mass Transfer, 2014 2014 70 IND12: Vacuum: Vacuum metrology for production environments Conjugate heat transfer, Thermocouple, Unsteady, Low temperature. http://www.sciencedirect.com/science/article/pii/S0017931013009873 A169 EMRP A169: Call 2010 Industry English 0017-9310 10.1016/j.ijheatmasstransfer.2013.11.033 1 59 NA SPantazis JButhig KJousten article PeksaGJVSKP2014_2 Vacuum 2014 101 IND12: Vacuum: Vacuum metrology for production environments orifice, multi-opening-orifice, orifice flow standard, gas throughput A169 EMRP A169: Call 2010 Industry English 0042-207X/$ 10.1016/j.vacuum.2013.10.014 1 59 NA LadislavPeksa TomášGronych MartinJeřáb MartinVičar FrantišekStaněk ZdeněkKrajíček DominikPražák article VargasNVPJ2014 Vacuum 2014 109 IND12: Vacuum: Vacuum metrology for production environments Unsteady vacuum gas dynamics, Binary mixtures, Gas separation, DSMC, Hybrid models, Rarefied gas dynamics. A169 EMRP A169: Call 2010 Industry English 10.1016/j.vacuum.2014.06.024 1 59 NA ManuelVargas SteryiosNaris DimitrisValougeorgis SarantisPantazis KarlJousten proceedings ClaperaRJSVB2014 Low Temperature Electronics (WOLTE), 2014 11th International Workshop on, IEEE 2014 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 73 to 76 http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6881029&pageNumber%3D42493%26rowsPerPage%3D75 A169 EMRP A169: Call 2011 SI Broader Scope Grenoble 11th International Workshop On Low Temperatures Electronics 7-9 July 2014 English 10.1109/WOLTE.2014.6881029 1 59 NA PClapera SRay XJehl MSanquer AValentian SBarraud article KaltenbachNGPRKKJRG2014 Analytical and Bioanalytical Chemistry 2014 SIB09: ELEMENTS: Primary standards for challenging elements Digestion. Rhodium. Molybdenum. Reference solution. Metrological traceability. ICP OES. MC-ICP-MS A169 EMRP A169: Call 2011 SI Broader Scope English 10.1007/s00216-014-8395-2 1 59 NA A.Kaltenbach J.Noordmann V.Görlitz C.Pape S.Richter H.Kipphardt G.Kopp R.Jährling O.Rienitz B.Güttler article ThomasEBGBPJP2014 Metrologia 2014 51 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies S54, S64 watt balance, alignment, LNE A169 EMRP A169: Call 2011 SI Broader Scope English 10.1088/0026-1394/51/2/S54 1 59 NA MatthieuThomas PatrickEspel YvesBriand GérardGenevès FranckBielsa PatrickPinot PatrickJuncar FrançoisPiquemal proceedings Proceedings of NEWRAD 2014 2014 IND52: XD Reflect: Multidimensional reflectometry for industry 295-297 http://newrad2014.aalto.fi/Newrad2014_Proceedings.pdf EMRP A169: Call 2012 Metrology for Industry (II) Seongchong Park

Yuseong-gu

Helsinki NEWRAD 2014 2014 30 59 No, EURAMET is never allowed to make the publication publicly available. A.Höpe A.Koo C.Forthmann F. M.Verdú F.Manoocheri F. B.Leloup G.Obein G.Wübbeler G.Ged J.Campos K. O.Hauer L.Yang M.Šmíd M.Langovoy P.Iacomussi P.Jaanson S.Källberg article PAK 2014 60 02 (2014) IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 069-072 nanopositioning and nanomeasuring machine, metrological scanning probe microscope, SPM, AFM http://pak.info.pl/index.php?menu=artykulSzczegol&idArtykul=3967 EMRP A169: Call 2012 Metrology for Industry (II) PAK

Gliwice

30 59 No option selected N.Vorbringer-Dorozhovets E.Manske G.Jäger proceedings The EMRP Project GraphOhm - Towards Quantum Resistance Metrology Based on Graphene 2014 SIB51: GraphOhm: Quantum resistance metrology based on graphene 548-549 Measurement standards, resistance, quantum hall effect, graphene, C, Calibration, EMRP project GraphOhm, Electrical resistance measurement, Hall effect devices, JRP, Materials, Metrology, Resistance, Standards, electric resistance measurement, electrical measurement, intrinsically referenced resistance standard disse, joint research project, quantum resistance metrology standard, semiconductor quantum Hall device http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898502 EMRP A169: Call 2012 SI Broader scope (II) IEEE Rio de Janeiro 24-29 Aug. 2014 30 978-1-4799-2479-0 0589-1485 10.1109/CPEM.2014.6898502 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Ahlers J.Kučera W.Poirier B.Jeanneret A.Satrapinski A.Tzalenchuk P.Vrabček T.Bergsten C.Hwang R.Yakimova S.Kubatkin proceedings Breakdown of the quantum Hall effect in epitaxial graphene 2014 SIB51: GraphOhm: Quantum resistance metrology based on graphene 40-41 Current measurement,Electric breakdown,Electrical resistance measurement,Graphene,Hall effect,Hall effect devices,Resistance,SiC-C,Silicon carbide,carrier density,current density,electric breakdown,graphene,magnetic field,magnetic fields,measurement standards,phase space,polymer gated epitaxial graphene,polymers,quantum Hall effect,quantum Hall effect breakdown,quantum resistance standard,silicon compounds,wide band gap semiconductors http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898248 EMRP A169: Call 2012 SI Broader scope (II) IEEE Rio de Janeiro CPEM2014 24-29 Aug. 2014 30 978-1-4799-2479-0 0589-1485 10.1109/CPEM.2014.6898248 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.J.B.M.Janssen S.Rozhko A.Tzalenchuk J.A.Alexander-Webber R.J.Nicholas proceedings CPEM 2014 Digest 2014 2014 2014 SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 16-17 Measurement technique, calibration, stability analysis, temperature dependence, scattering parameters, network analysis, electronic calibration EMRP A169: Call 2012 SI Broader scope (II) IEEE

n/a

Rio de Janeiro, Brazil Conference on Precision Electromagnetic Measurements 25-08-2014 to 29-08-2014 30 978-1-4799-5205-2 0589-1485 10.1109/CPEM.2014.6898236 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MZeier JHoffmann PHuerlimann JRuefenacht MWollensack RJudaschke KKuhlmann article IEEE International Ultrasonics Symposium 2014 HLT03: DUTy: Dosimetry for ultrasound therapy 146-149 Ultrasound, modelling, bone, elastic EMRP A169: Call 2011 Metrology for Health IEEE 30 10.1109/ULTSYM.2014.0037 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BETreeby JJaros DRohrbach BTCox article Applied Optics 2014 53 24 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate 5344-5352 https://www.osapublishing.org/ao/abstract.cfm?uri=ao-53-24-5344&origin=search EMRP A169: Call 2010 Environment Optical Society of America

Massachusetts

30 1559-128X 10.1364/AO.53.005344 1 59 No, EURAMET is never allowed to make the publication publicly available. AHHueni DSSchlaepfer MJJehle MESSchaepman article 2014 International Symposium on Electromagnetic Compatibility 2014 1 1 IND60: EMC: Improved EMC test methods in industrial environments 1031-1036 Feature Selective Validation method (FSV), Validation, Data comparison, Computational Electromagnetics (CEM), Computer simulation, Numerical simulation, reference limits. http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=6931054&isnumber=6930855 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Gothenburg

30 2325-0356 10.1109/EMCEurope.2014.6931054 1 59 No, EURAMET is never allowed to make the publication publicly available. 14696931 RicardoJauregui MarcPous FerranSilva article EPJ Web of Conferences 2014 77 00022 HLT11: MetroMRT: Metrology for molecular radiotherapy 7 There are no keywords in the paper http://www.epj-conferences.org/articles/epjconf/pdf/2014/14/epjconf_icm2014_00022.pdf EMRP A169: Call 2011 Metrology for Health EDP Sciences

17, Avenue du Hoggar Parc d'Activité de Courtabœuf BP 112 91944 Les Ulis Cedex A France

30 Not available 10.1051/epjconf/20147700022 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MarcoD'Arienzo MarcoCapogni V.Smyth MauricCox LenaJohansson JaroslavSolc ChristopheBobin HansRabus LeilaJoulaeizadeh proceedings CPEM 2014 Conference Digest 2014 1 Special issue CPEM 2014 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 422-423 ANN, digital measurements, non-synchronous sampling, sampling methods, sine fitting, spectral analysis. http://ieeexplore.ieee.org/document/6898439/ EMRP A169: Call 2012 SI Broader scope (II) IEEE Transactions on Instrumentation and Measurement

Kentucky, USA

Rio de Janeiro (Brazil) Conference on Precision Electromagnetic Measurements 25-08-2014 to 29-08-2014 30 978-1-4799-5205-2 0589-1485 10.1109/CPEM.2014.6898439 1 59 No, EURAMET is never allowed to make the publication publicly available. J.R.Salinas J.Díaz de Aguilar F.García-Lagos J.Joya F.Sandoval M.L.Romero article BaigJWHZW2013 Review of Scientific Instruments 2013 12 9 84 124701 SIB04: Ion Clock: High-accuracy optical clocks with trapped ions 11 Segmented ion trap, arbitrary waveform generator, quantum information A169 EMRP A169: Call 2011 SI Broader Scope 10.1063/1.4832042 1 1 59 NA M. TBaig MJohanning AWiese SHeidbrink MZiolkowski ChWunderlich article Journal of the Americal Chemical Society 2013 12 4 135 51 HLT05: Metallomics: Metrology for metalloproteins 19354–19361 Alzheimer disease; Amyloid formation; Copper; Enzymes http://pubs.acs.org/doi/abs/10.1021/ja410812r EMRP A169: Call 2011 Metrology for Health ACS Publications

Washington

30 0002-7863, 1520-5126 10.1021/ja410812r 1 No, EURAMET is never allowed to make the publication publicly available. Lisa M.Munter HolgerSieg TobiasBethge FilipLiebsch Frank S.Bierkandt MichaelSchleeger Heiko J.Bittner JoachimHeberle NorbertJakubowski Peter W.Hildebrand GerdMulthaup article Molecular Physics 2013 10 8 111 22-23 HLT10: BiOrigin : Metrology for biomolecular origin of disease 3465-3477 water, quantum Drude oscillator, path integral methods, coarse-grained model, many-body dispersion http://www.researchgate.net/publication/260967300_Electronically_coarse-grained_molecular_dynamics_using_quantum_Drude_oscillators EMRP A169: Call 2011 Metrology for Health Taylor & Francis Group

Abingdon

30 10.1080/00268976.2013.843032 1 59 No, EURAMET is never allowed to make the publication publicly available. A.P.Jones J.Crain F.S.Cipcigan V.P.Sokhan M.Modani G.J.Martynaa article RichterFPPJ2013 GIT Labor-Fachzeitschrift 2013 9 20 9 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 586-588 http://www.git-labor.de/forschung/chemie-physik/tributylzinn-gesamtwasserproben A169 EMRP A169: Call 2010 Environment German 1 59 NA JanineRichter InaFettig ChristianPiechotta RosemariePhilipp NorbertJakubowski article InterNoise 2013 2013 9 15 Proceedings of inter.noise 2013 HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound 9 Free field, Microphone Calibration, Ultrasound EMRP A169: Call 2011 Metrology for Health INTER-NOISE

Innsbruck, Austria

30 978-1-6326S-267-5 1 59 No, EURAMET is never allowed to make the publication publicly available. Source-ID: 117330393 SBarrera-Figueroa ATorras-Rosell FJacobsen article Applied Surface Science 2013 9 15 281 IND07: Thin Films: Metrology for the manufacturing of thin films 123-128 Zinc oxide, Spectroscopic ellipsometry, X-ray fluorescence, Raman spectrometry, VUV reflectometry, Atomic layer deposition, Sputtering http://www.sciencedirect.com/science/article/pii/S0169433212021861 EMRP A169: Call 2010 Industry Elsevier

Philadelphia

30 0169-4332 10.1016/j.apsusc.2012.12.035 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. PPPetrik BPPollakowski SZZakel TGGumprecht BBBeckhoff MLLemberger ZLLabadi ZBBaji MJJank ANNutsch article Metrologia 2013 9 6 50 5 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies SI, kilogram, watt balance, ICAG, gravimetry, link, local gravity field http://iopscience.iop.org/0026-1394/50/5/452 EMRP A169: Call 2011 SI Broader Scope 30 1681-7575 10.1088/0026-1394/50/5/452 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Z.Jiang et al. article Thin Solid Films 2013 8 31 541 Current Trends in Optical and X-Ray Metrology of Advanced Materials for Nanoscale Devices III IND07: Thin Films: Metrology for the manufacturing of thin films 131-135 Spectroscopic ellipsometry, X-ray reflectometry, VUV reflectometry, Atomic layer deposition, Ultra-thin layer http://www.sciencedirect.com/science/article/pii/S0040609013000175 EMRP A169: Call 2010 Industry Elsevier

Amsterdam, Netherlands

30 0040-6090 10.1016/j.tsf.2012.12.091 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. PPPetrik TGGumprecht ANNutsch GRRoeder MLLemberger GJJuhasz OPPolgar CMMajor PKKozma MJJanosov BFFodor EAAgocs MFFried article Journal of Biological Chemistry 2013 7 12 288 28 HLT10: BiOrigin : Metrology for biomolecular origin of disease 20162-20172 Antimicrobial Peptides, Membrane Biophysics Microscopy, Molecular Dynamics, Nuclear Magnetic Resonance, Protein Design, Protein Folding http://www.jbc.org/content/288/28/20162.short#corresp-1 EMRP A169: Call 2011 Metrology for Health ASBMB

Maryland

30 10.1074/jbc.M113.459560 1 59 No, EURAMET is never allowed to make the publication publicly available. LloydRyan BaptisteLamarre TingDiu JascindraRavi Peter J.Judge AdamTemple MatthewCarr EleonoraCerasoli BoSu Howard F.Jenkinson GlennMartyna SasonCrain AnthonyWatts Maxim G.Ryadnov article GeorgJCESPBHVA2013 Radiotherapy and Oncology 2013 7 108 1 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 99-106 Alanine; Audit; Carbon ions; Dosimetry; Protons EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 0167-8140 10.1016/j.radonc.2013.04.029 NA D.Georg O.Jäkel N.Chaudhri S.Ecker P.Sharpe H.Palmans N.Bassler R.Herrmann S.Vatnitsky A.Ableitinger article PNAS 2013 5 28 110 22 HLT10: BiOrigin : Metrology for biomolecular origin of disease 8918-8923 innate host defense de novo protein design nanometrology antibiotics nanoscopy http://www.pnas.org/content/110/22/8918.abstract EMRP A169: Call 2011 Metrology for Health 30 10.1073/pnas.1222824110 1 59 No, EURAMET is never allowed to make the publication publicly available. PaulinaRakowska HaiboJiang SantanuRay AlicePyne BaptisteLamarre MatthewCarr PeterJudge JascindraRavi Ulla I. M.Gerling BeateKoksch Glenn J.Martyna Bart W.Hoogenboom AnthonyWatts JasonCrain Chris R. M.Grovenor Maxim G.Ryadnov article Climate of the Past 2013 3 14 9 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 657–677 www.clim-past.net/9/657/2013/ EMRP A169: Call 2010 Environment 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K. M.Willett C. N. Jr.Williams R. J. H.Dunn P. W.Thorne S.Bell M. dePodesta P. D.Jones D. E.Parker article Journal of Raman Spectroscopy 2013 2 1 44 2 NEW02: Raman: Metrology for Raman Spectroscopy 283–289 soil science; Terra Preta de Índio; carbon http://onlinelibrary.wiley.com/doi/10.1002/jrs.4191/abstract EMRP A169: Call 2011 Metrology for New Technologies Wiley

Hobeken

30 0377-0486 10.1002/jrs.4191 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-2-28 j.Ribeiro-Soares L.GCançado N.P.SFalcãob E.HMartins Ferreirac; C.AAchetec AJorio article Phys. Rev. 2013 1 4 87 HLT10: BiOrigin : Metrology for biomolecular origin of disease 18 EMRP A169: Call 2011 Metrology for Health American Physical Society

Maryland

30 10.1103/PhysRevB.87.144103 1 59 No, EURAMET is never allowed to make the publication publicly available. AndrewJones JasonCrain VladSokhan TroyWhitfield GlennMartyna article BaumannEJCCRT2013 Metrologia 2013 50 3 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies Kilogram, Planck constant, International System of Units SI, watt balance EMRP A169: Call 2011 SI Broader Scope English 10.1088/0026-1394/50/3/235 1 59 NA H.Baumann A.Eichenberger B.Jeckelmann F.Cosandier R.Clavel D.Reber D.Tommasini article JehlVCCRRSDDWV2013 Physical Review X 2013 3 021012 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 021012-1 - 021012-7 EMRP A169: Call 2011 SI Broader Scope English 1098-0121 10.1103/PhysRevX.3.021012 1 59 NA X.Jehl B.Voisin T.Charron P.Clapera S.Ray B.Roche M.Sanquer S.Djordjevic L.Devoille R.Wacquez M.Vinet article SondereggerDBPJ2013 Journal of Vacuum Science and Technology A 2013 31 6 IND12: Vacuum: Vacuum metrology for production environments UHV, gate valve, dynamic pressure, gas expansion, load locks EMRP A169: Call 2010 Industry English 10.1116/1.4813836 1 59 NA K.Sonderegger M.Duer J.Buthig S.Pantazis K.Jousten article JursicR2013 International Journal of Thermophysics 2013 ENG06: Powerplants: Metrology for Improved Power Plant Efficiency EMRP A169: Call 2009 Energy English 59 NA I.Jursic S.Rudtsch article JobbagyTVMMPG2013 Journal of Radioanalytical and Nuclear Chemistry 2013 298 ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants 345-352 238U, High-resolution alpha-spectrometry, Alpha-emission probability, Electrodeposition http://rd.springer.com/article/10.1007%2Fs10967-013-2444-8# EMRP A169: Call 2009 Energy English 0236-5731 10.1007/s10967-013-2444-8 1 59 NA V.Jobbágy M.Teresa Crespo R.Van Ammel M.Marouli A.Moens S.Pommé E.García-Toraño proceedings MerloneLABBBdDDEGGHHJKKMMMdSSSSSV2013 AIP Conference Proceedings 2013 8 1552 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 1030-1035 air humidity, air pressure, air temperature, air speed and direction, historical temperature data series, meteorological instruments calibration, traceable climate measurements http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821419 EMRP A169: Call 2010 Environment Los Angeles (USA) 9th International Temperature Symposium 19-23 March 2012 10.1063/1.4821419 1 59 NA A.Merlone G.Lopardo I.Antonsen S.Bell RBenyon N.Boese D.del Campo M.Dobre J.Drnovsek A.Elkatmis E.Georgin E.Grudniewicz M.Heinonen C.Holstein-Rathlou J.Johansson P.Klason R.Knorova C.Melvad J.Merrison K.Migaa M.de Podesta H.Saathoff D.Smorgon F.Sparasci R.Strnad A.Szmyrka-Grzebyk E.Vuillermoz article VargasNVPJ2013 Journal of Vacuum Science and Technology A 2013 32 2 IND12: Vacuum: Vacuum metrology for production environments vacuum, kinetic theory, Knudsen number, dynamic gas espansion, hybrid modeling A169 EMRP A169: Call 2010 Industry English 10.1116/1.4830283 1 59 NA ManuelVargas SteryiosNaris DimitrisValougeorgis SarantisPantazis KarlJousten article The Journal of Chemical Physics 2013 139 IND07: Thin Films: Metrology for the manufacturing of thin films 1-10 http://scitation.aip.org/content/aip/journal/jcp/139/6/10.1063/1.4816706 EMRP A169: Call 2010 Industry American Institute of Physics (AIP)

New York

30 0021-9606 10.1063/1.4816706 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SWWood JSKKim DTJJames WCTTsoi GEMMurphy JSKKim article Metallomics 2012 11 2 4 12/2012 HLT05: Metallomics: Metrology for metalloproteins 1239 - 1244 iron saturation in human transferrin, molecular properties, isotope dilution, HPLC ICP-MS http://pubs.rsc.org/en/Content/ArticleLanding/2012/MT/c2mt20183f#!divAbstract EMRP A169: Call 2011 Metrology for Health RSC Publ.

Cambridge, United Kingdom

30 1756-5901 (print) ; 1756-591X (online) 10.1039/c2mt20183f 1 59 No, EURAMET is never allowed to make the publication publicly available. ClaudiaFrank OlafRienitz ReinhardJaehrling DetlefSchiel SabineZakel article Metrologia 2012 8 10 49 5 HLT03: DUTy: Dosimetry for ultrasound therapy 275-278 HITU, acoustic output power, burst mode , duty cycle http://iopscience.iop.org/issue/0026-1394/49/5 EMRP A169: Call 2011 Metrology for Health BIPM & IOP Publishing Ltd.

Bristol

30 0026-1394 10.1088/0026-1394/49/5/S275 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K VJenderka VWilkens proceedings HaleWDWJHHFB2012 Conference on Precision Electromagnetic Measurements 2012 2012 7 IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications 522 to 523 A169 EMRP A169: Call 2010 Industry Washington, USA Conference on Precision Electtromagnetic Measurements 2012 1 to 6 July 2012 English 0589-1485 10.1109/CPEM.2012.6251033 1 59 NA P.DHale D.FWilliams ADienstfrey JWang JJargon D.AHumphreys MHarper HFüser MBieler article Journal of analytical atomic spectrometry 2012 5 30 27 9 HLT05: Metallomics: Metrology for metalloproteins 1474 - 1483 cisplatin–protein complexes, gel electrophoresis in biological samples, protein separation conditions https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/26562 EMRP A169: Call 2011 Metrology for Health Royal Society of Chemistry

Cambridge, United Kingdom

30 0267-9477 1364-5544 10.1039/c2ja30016h 1 No, EURAMET is never allowed to make the publication publicly available. EstefaniaMoreno-Gordaliza DiegoEsteban-Fernandez CharlotteGiesen KarolaLehmann AlbertoLazaro AlbertoTejedor ChristianScheler BenitoCanas NorbertJakubowski Michael W.Linscheid M. MilagrosGomez-Gomez article HauswaldtRJFSLM2012 Accreditation and Quality Assurance 2012 17 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 129-138 iMERA-Plus: Call 2007 Health English 10.1007/s00769-011-0827-5 1 59 NA A.-L.Hauswaldt O.Rienitz R.Jährling N.Fischer D.Schiel G,Labarraque B.Magnusson article PollingerMBDSNJHAM2012 Measurement Science and Technology 2012 23 9 T3.J3.1: Long distance: Absolute long distance measurement in air 094018 geodetic baseline, long distance measurement, refractivity compensation, calibration, measurement uncertainty, length measurement, femtosecond laser-based time-of-flight distance meter http://stacks.iop.org/MST/23/094018 iMERA-Plus: Call 2007 Length English 0957-0233 10.1088/0957-0233/23/9/094018 1 59 NA F.Pollinger T.Meyer J.Beyer N.Doloca W.Schellin W.Niemeier J.Jokela P.Häkli A.Abou-Zeid K.Meiners-Hagen proceedings HudlickaJSK2013 Conference on Precision Electromagnetic Measurements (CPEM) 2012 IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications error vector magnitude, waveform metrology EMRP A169: Call 2010 Industry Washington DC, USA Conference on Precision Electromagnetic Measurements (CPEM) 1 - 6 July 2012 English 10.1109/CPEM.2012.6251035 1 59 NA M.Hudlicka C.Jastrow T.Schrader T.Kleine-Ostmann proceedings KleineOstmannJPJKS2012 Proceedings of the Conference on Precision Electromagnetic Measurements (CPEM) 2012 IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications EMRP A169: Call 2010 Industry Washington DC, USA Conference on Precision Electromagnetic Measurements (CPEM) 1 - 6 July 2012 English 10.1109/CPEM.2012.6250900 1 59 NA T.Kleine-Ostmann C.Jastrow S.Priebe M.Jacob T.Kürner T.Schrader article HallerJSKMSDGG2012 Metrologia 2012 49 5 HLT03: DUTy: Dosimetry for ultrasound therapy 297-281 temperature, HITU EMRP A169: Call 2011 Metrology for Health English 0026-1394 (Print), 1681-7575 (Online) 10.1088/0026-1394/49/5/S279 1 59 NA J.Haller K.Jenderka F.Seifert T.Klepsch E.Martin A.Shaw G.Durando C.Guglielmone F.Girard proceedings KleineOstmannJPDSK2012 Proceedings of the 37th International Conference on Infrared, Milimeter and Terahertz Waves (IRMMW-THz) 2012 IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications EMRP A169: Call 2010 Industry Wollongong, Australia The 37th International Conference on Infrared, Milimeter and Terahertz Waves (IRMMW-THz) 23 - 28 September 2012 English 10.1109/IRMMW-THz.2012.6380411 1 59 NA T.Kleine-Ostmann M.Jacob S.Priebe R.Dickhoff T.Schrader T.Kürner article GeckelerKJK2012 Advanced Optical Technologies 2012 6 IND10: Form metrology: Optical and tactile metrology for absolute form characterization http://www.degruyter.com/view/j/aot.2012.1.issue-6/aot-2012-0048/aot-2012-0048.xml?format=INT EMRP A169: Call 2010 Industry English 2192-8584 (Online), 2192-8576 (Print) 10.1515/aot-2012-0048 1 59 NA R.Geckeler O.Kranz A.Just M.Krause proceedings PulliKMSJM2012 AIP Conference Proceedings 2012 1531 ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation Radiometry, solar UV, diffusers, Monte Carlo analysis http://proceedings.aip.org/resource/2/apcpcs/1531/1/813_1 A169 EMRP A169: Call 2010 Environment Dahlem Cube, Free University, Berlin, Germany RADIATION PROCESSES IN THE ATMOSPHERE AND OCEAN (IRS2012): Proceedings of the International Radiation Symposium (IRC/IAMAS) 6 to 10 August 2012 English 0094-243X 10.1063/1.4804894 1 59 NA TomiPulli PetriKärhä JoopMes JosefSchreder PriitJaanson FarshidManoocheri proceedings FluggeBJMPRSSSVV2012 2012 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures A169 EMRP A169: Call 2010 Industry Stockholm, Sweden Proceedings of the 12th euspen International Conference June 2012 978-0-9566790-0-0 1 59 NA J.Flügge E.Beckert N.Jennett T.Maxwell D.Petit S.Rudtsch J.Salgado M.Schalles R.Schödel D.Voigt M.Voigt proceedings HallerJKSKS2011 AIP Conference Proceedings 2011 4 1481 HLT03: DUTy: Dosimetry for ultrasound therapy 125-130 ultrasound therapy, calibration phantom, MR thermometry, HITU, HIFU EMRP A169: Call 2011 Metrology for Health New York, USA 11th International Symposium on Therapeutic Ultrasound (ISTU) 11 - 13, April 2011 English 0094-243X (print), 1551-7616 (online) 10.1063/1.4757322 1 59 NA J.Haller K.Jenderka C.Koch F.Seifert T.Klepsch A.Shaw article HaoAGCRKJDS2011 Applied Physics Letters 2011 2 28 98 9 T4.J02: NanoSpin: Nanomagnetism and Spintronics No pdf received iMERA-Plus: Call 2007 Electricity and Magnetism English 10.1063/1.3561743 1 59 NA L.Hao C.Assmann J. C.Gallop D.Cox F.Ruede O.Kazakova P.Josephs-Franks D.Drung Th.Schurig article JeanneretROvH2011 Metrologia 2011 48 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 311-316 Only available as publisher's version. iMERA-Plus: Call 2007 Electricity and Magnetism English 10.1088/0026-1394/48/5/011 1 59 NA B.Jeanneret A.Ruefenacht F.Overney H.van den Brom E.Houtzager article FellmuthFGJPSZ2011 Metrologia 2011 48 5 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0026-1394/48/5/020 1 59 NA B.Fellmuth JoachimFischer ChristofGaiser OttoJusko TasaneePriruenrom WladimirSabuga ThorstenZandt article GoenagaInfanteKSHJ2011 Analytical and Bioanalytical Chemistry 2011 399 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 1789-1797 iMERA-Plus: Call 2007 Health English 1 59 NA HeidiGoenaga-Infante ShireenKassam EmmaStokes ChristopherHopley Simon P.Joel proceedings BielsaGEGJ2011 Proceedings 15th International Congress of Metrology 2011 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Paris 15th International Congress of Metrologyp 3 - 6 October 2011 French 1 59 NA F.Bielsa O.Gilbert A.Eichenberger G.Genevès P.Juncar article JenderkaDKRS2011 Journal of Physics: Conference Series 2011 279 012015 T2.J07: EBCT: External Beam Cancer Therapy iMERA-Plus: Call 2007 Health English 1 59 NA K.-V.Jenderka G.Durando B.Karaböce S.Rajagopal A.Shaw article WilkensSJ2011 Journal of Physics: Conference Series 2011 279 012018 T2.J07: EBCT: External Beam Cancer Therapy iMERA-Plus: Call 2007 Health English 1 59 NA V.Wilkens S.Sonntag K.-V.Jenderka proceedings DencksJK2011 Proceedings 2010 IEEE International Ultrasonics Symposium (IUS) 2011 T2.J07: EBCT: External Beam Cancer Therapy 463-466 iMERA-Plus: Call 2007 Health San Diego, USA 2010 IEEE International Ultrasonics Symposium (IUS) 11 - 14 October 2010 English 1 59 NA S.Dencks K.-V.Jenderka C.Koch proceedings HallerJK2011 Proceedings of the 10th International Symposium on Therapeutic Ultrasound 2011 1359 T2.J07: EBCT: External Beam Cancer Therapy 19-23 iMERA-Plus: Call 2007 Health AIP Conference Proceedings Tokyo, Japan 10th International Symposium on Therapeutic Ultrasound 9 - 12 June 2011 English 1 59 NA J.Haller K.-V.Jenderka V.Wilkens C.Koch article dePodestaSUBSBJ2011 Metrologia 2011 48 L1 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0026-1394/48/1/L01 1 59 NA M.de Podesta G.Sutton R.Underwood S.Bell M.Stevens T.Byrne P.Josephs-Franks article HuSMJS2011_2 Physical Review B84 2011 84 2 IND08: MetMags: Metrology for Advanced Industrial Magnetics http://link.aps.org/doi/10.1103/PhysRevB.84.024404 A169 EMRP A169: Call 2010 Industry English 10.1103/PhysRevB.84.024404 1 59 NA X.K.Hu S.Sievers A.Müller V.Janke H.W.Schumacher article JeanneretORNJ2010 IEEE Transactions on Instrumentation and Measurement 2010 59 7 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 1894-1899 AC measurements,  Josephson devices,  Josephson voltage standard,  waveform synthesizer iMERA-Plus: Call 2007 Length English 0018-9456 1 59 NA B.Jeanneret F.Overney A.Rufenacht J.Nissilä article RufenachtOMJ2010 2010 Conference on Precision Electromagnetic Measurements digest 2010 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 147-148 iMERA-Plus: Call 2007 Electricity and Magnetism English 1 59 NA A.Rüfenacht F.Overney A.Mortara B.Jeanneret proceedings EichenbergerBJJ2010 Proceedings of the 2010 Conference on Precision Electromagnetic Measurements 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA A.Eichenberger H.Baumann B.Jeanneret B.Jeckelmann article SeitzMJJS2010 Electrochimica Acta 2010 55 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 6323-6331 Metrological traceability; Electrolytic conductivity; Purified water; Electrolytic double layer; Adsorption processes iMERA-Plus: Call 2007 Health English 1 59 NA S.Seitz A.Manzin H. D.Jensen P. T.Jakobsen P.Spitzer article JitaruGVF2010 Analytica Chimica Acta 2010 657 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 100-107 Human serum; Speciation analysis; Selenoaminoacids and selenoproteins; High performance liquid chromatography coupled to inductively coupled plasma-mass spectrometry; Species-specific isotope dilution iMERA-Plus: Call 2007 Health English 1 59 NA PetruJitaru HeidiGoenaga-Infante SophieVaslin-Reimann proceedings JiangTKSPRFJLMMCB2010 Proceedings of TGSMM2010 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram Absolute gravimetry, relative gravimetry, ICAG, RGC, BIPM, Key comparison iMERA-Plus: Call 2007 SI and Fundamental Metrology Saint-Petersburg, Russia IAG Sypposium on Terrestrial Gravimetry: Static and Mobile Measurements (TG-SMM2010) 22 - 25 June 2010 English 1 59 NA Z.Jiang L.Tisserand K. U.Kessler-Schulz H. R.Schulz V.Palinkas C.Rothleitner O.Francis P.Jousset D.Lequin S.Merlet J.Mäkinen A.Coulomb M.Becker proceedings BielsaEGJG2010 Proceedings of the 2010 Conference on Precision Electromagnetic Measurements 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA F.Bielsa A.Eichenberger O.Gilbert P.Juncar G.Genevès proceedings BielsaEGJG2010_2 2010 Conference on Precision Electromagnetic Measurements (CPEM) 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA F.Bielsa A.Eichenberger O.Gilbert P.Juncar G.Genevès proceedings GenevesBEGJVDMPBP2010 2010 Conference on Precision Electromagnetic Measurements (CPEM) 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA G.Genevès F.Bielsa A.Eichenberger O.Gilbert P.Juncar F.Villar G.D'Agostino S.Merlet P.Pinot H.Baumann F.Pereira Dos Santos article KargerJPK2010 Physics in Medicine and Biology 2010 55 21 T2.J07: EBCT: External Beam Cancer Therapy R193-R234 iMERA-Plus: Call 2007 Health English 1 59 NA C. P.Karger O.Jäkel H.Palmans T.Kanai proceedings JenderkaHDK2010 Proceedings: DAGA 2010: 36. Jahrestagung für Akustik 2010 T2.J07: EBCT: External Beam Cancer Therapy 1035-1036 iMERA-Plus: Call 2007 Health Berlin, Germany DAGA 2010: 36. Jahrestagung für Akustik 15 - 18 March 2010 German 978-3-9808659-8-2 1 59 NA K.-V.Jenderka J.Haller S.Dencks C.Koch proceedings JenderkaHDK2010_2 Proceedings: DAGA 2010: 36. Jahrestagung für Akustik 2010 T2.J07: EBCT: External Beam Cancer Therapy 1037-1038 iMERA-Plus: Call 2007 Health Berlin, Germany DAGA 2010: 36. Jahrestagung für Akustik 15 - 18 March 2010 German 1 59 NA J.Haller K.-V.Jenderka S.Dencks C.Koch proceedings SipilaJKON2010 Proceedings IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry 2010 T2.J07: EBCT: External Beam Cancer Therapy 459 iMERA-Plus: Call 2007 Health Vienna, Austria IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry 09-12 November 2010 English 1 59 NA P.Sipilä H.Järvinen A.Kosunen J.Ojala J.Niemelä article JitaruRBVF2010 Accreditation and Quality Assurance 2010 15 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 343-350 iMERA-Plus: Call 2007 Health English 1 59 NA PetruJitaru MarcoRoman C.Barbante SophieVaslin-Reimann PaolaFisicaro article EichenbergerBJJRB2010 Metrologia 2010 48 3 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram 133-141 iMERA-Plus: Call 2007 SI and Fundamental Metrology 1 59 NA AliEichenberger H.Baumann BlaiseJeanneret BeatJeckelmann PhilippeRichard WalterBeer article JentschelKM2009 European Physical Journal Special Topics 2009 6 172 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram molar Planck constant, Laue-diffraction, gamma radiation iMERA-Plus: Call 2007 SI and Fundamental Metrology English 1 59 NA M.Jentschel J.Krempel P.Mutti article vanderMeulenPMKHWJH2009 Nano Letters 2009 1 9 1 T4.J02: NanoSpin: Nanomagnetism and Spintronics No pdf received FIELD-EFFECT TRANSISTORS; GERMANIUM NANOWIRES; MAGNETIC-PROPERTIES; SURFACE-CHEMISTRY; GE NANOWIRES; NANOCRYSTALS; NANOPARTICLES; MN3O4; FERROMAGNETISM; SEMICONDUCTORS iMERA-Plus: Call 2007 Electricity and Magnetism English 10.1021/nl802114x 1 59 NA M. I.van der Meulen N.Petkov M. A.Morris O.Kazakova X. H.Han K. L.Wang A. P.Jacob J. D.Holmes article JeanneretOCMR2009 IEEE Transactions on Instrumentation and Measurement 2009 58 4 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 791-796 AC measurements; Josephson devices; Josephson voltage standard; waveform synthesizer iMERA-Plus: Call 2007 Electricity and Magnetism English 0018-9456 1 59 NA B.Jeanneret F.Overney L.Callegaro A.Mortara A.Rufenacht proceedings JeanneretORN2009 2010 Conference on Precision Electromagnetic Measurements digest 2009 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 54-55 iMERA-Plus: Call 2007 Electricity and Magnetism Daejeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13-18 June, 2010 English 1 59 NA B.Jeanneret F.Overney A.Rüfenacht J.Nissilä article JuskoBNSP2009 Key Engineering Materials 2009 437 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin 150-154 pdf not available Form Measurement, Pressure Measurement, Size Measurement iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.4028/www.scientific.net/KEM.437.150 1 59 NA OttoJusko DirkBastam MichaelNeugebauer WladimirSabuga TasaneePriruenrom proceedings JenderkaBH2009 Proceedings of the NAG/DAGA 2009 : International Conference on Acoustics 2009 T2.J07: EBCT: External Beam Cancer Therapy 325-327 iMERA-Plus: Call 2007 Health Rotterdam, Netherlands International Conference on Acoustics 23 - 26 March 2009 English 1 59 NA K.-V.Jenderka K.Beißner J.Haller proceedings JenderkaB2009 Proceedings: 9th International Symposium On Therapeutic Ultrasound ISTU 2009 2009 1215 T2.J07: EBCT: External Beam Cancer Therapy 207-210 iMERA-Plus: Call 2007 Health Aix-en-Provence, France 24 - 26 September 2009 English 1 59 NA K.-V.Jenderka K.Beißner article JitaruRCFB2009 Microchim Acta 2009 166 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 319,327 Speciation analysis - Human serum selenoproteins - Microbore affinity chromatography - Inductively coupled plasma-sector field mass spectrometry - On-line isotope dilution iMERA-Plus: Call 2007 Health English 10.1007/s00604-009-0208-5 1 59 NA PetruJitaru MarcoRoman GiulioCozzi PaolaFisicaro C.Barbante proceedings SchraderMJDK2009 Proceedings of the International Symposium on Electromagnetic Compatibility 2009 T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive 166-170 http://ieeexplore.ieee.org/xpl/freeabs_all.jsp?arnumber=5284583 iMERA-Plus: Call 2007 Electricity and Magnetism Austin, Tex., USA International Symposium on Electromagnetic Compatibility 17 - 21 August 2009 English 1 59 NA T.Schrader K.Münter C.Jastrow A.Daneschnejad T.Kleine-Ostmann article WrightBGTPJHAJNR20100 Physical Review Letters B 2008 78 233311 T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere 1-4 iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1103/PhysRevB.78.233311 1 59 NA S. J.Wright M. D.Blumenthal GodfreyGumbs A. L.Thorn M.Pepper T. J. B. M.Janssen S. N.Holmes D.Anderson G. A. C.Jones C. A.Nicoll D. A.Ritchie proceedings JuskoNRSP2008 Proceedings I-CIMMEC, 1st International Congress on Mechanical Metrology 2008 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin pressure metrology, Boltzmann constant, dimensional metrology iMERA-Plus: Call 2007 SI and Fundamental Metrology Rio de Janeiro, Brazil I-CIMMEC, 1st International Congress on Mechanical Metrology 8 - 10 October 2008 English 1 59 NA OttoJusko MichaelNeugebauer HelgeReimann WladimirSabuga TasaneePriruenrom proceedings JuskoNRDFG2008 Proceedings Fifth International Symposium on Instrumentation Science and Technology 2008 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin form measurement, optical probe, tactile probe, scanning CMM iMERA-Plus: Call 2007 SI and Fundamental Metrology Shenyang, China 5th International Symposium on Instrumentation Science and Technology 15-18 September 2008 English 1 59 NA OttoJusko MichaelNeugebauer HelgeReimann P.Drabarek M.Fleischer T.Gnausch miscellaneous JiangPSHHMDOMPG 2554 ISH 2021 19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes Voltage Divider, RCR Divider, Capacitor EMPIR 2019: Pre-Co-Normative ISH 2021 NA https://zenodo.org/record/6073729 H.Jiang O.Pischler U.Schichler J.Havunen J.Hällström A.Merev S.Dedeoğlu S.Özer J.Meisner S.Passon F.Gerdinand miscellaneous JaksicODPCMTSSDKHLDMGF 1462 17FUN06: SIQUST: Single-photon sources as new quantum standards Diamond, leadleadColor Centerssingle-Photon sourceion Implantationphotoluminescence https://zenodo.org/record/3711266#.Xnh2CEBFz8c EMPIR 2017: Fundamental 197 NA M.Jakšić P.Olivero I.P.Degiovanni S.Pezzagna F.Celegato E.Moreva P.Traina M.Signorile S.Santonocito A.Damin J.Kuepper T.Herzig T.Luehmann T.Ditalia J.Meijer P.M.Genovese J.Forneris miscellaneous NaydenovDAEBGJSMTDFJO 1463 17FUN06: SIQUST: Single-photon sources as new quantum standards Crystal defectsQuantum Information with hybrid SystemsQuantum sensingelemantal semiconductorsNitrogen vacancy centers in Diamondwide band gap Systemsoptically detected magnetic resonance https://zenodo.org/record/3711403#.Xnh5L0BFz8d EMPIR 2017: Fundamental 30 NA B.Naydenov I.P.Degiovanni G.Amato E.Enrico F.Bosia V.Grilj M.Jakšić N.Skukan E.Moreva P.Traina T.Ditalia J.Forneris F.Jelezko P.Olivero miscellaneous JostTPBGKDSFKGKKBRLSH 1982 Not applicable Not applic 15SIB07: PhotoLED: Future photometry based on solid-state lighting products 2 LED, light emitting diode, SSL, solid-state lighting, spectrum, spectral power distribution, illuminant, colorimetry, photometry https://doi.org/10.1088/1681-7575/aacae7 EMPIR 2015: SI Broader Scope PhotoLED

photoled.aalto.fi

Not applicable 10.1088/1681-7575/aacae7 NA S.Jost A.Thorseth T.Poikonen P.Blattner T.Gerloff A.Kokka P.Dekker M.Smid A.Ferrero T.Kübarsepp P.Gal S.Källberg A.Klej G.Brida T.Reiners K.Ludwig M.Schneider L.Hui miscellaneous FletcherJLSGFRBKK 2652 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements single-electron wave packet, tomography, single-electron quantum optics EMPIR 2017: Fundamental NA https://doi.org/10.5281/zenodo.3533120 J.D.Fletcher N.Johnson E.Locane P.See J.P.Griffiths I.Farrer D.A.Ritchie P.W.Brouwer V.Kashcheyevs M.Kataoka miscellaneous KlauiJPDGVCCK 1350 Zenodo N/A 17FUN08: TOPS: Metrology for topological spin structures N/A skyrmion, AFM, manipulation, nanomagnetism EMPIR 2017: Fundamental Zenodo 197 N/A NA https://zenodo.org/record/3601425 M.Kläui G.Jakob M.Pasquale G.Durin F.Garcia-Sanchez M.Vafaee H.Corte-León A.Casiraghi O.Kazakova miscellaneous GarberoglioHJ 2449 The Journal of Chemical Physics 155 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 234103 third dielectric virial coefficient, helium-4, neon-20, argon-40 EMPIR 2018: SI Broader Scope NA https://doi.org/10.5281/zenodo.5849080 G.Garberoglio A.Harvey B.Jeziorski miscellaneous AssoulineJBWTJGKRPR 2631 Nature Physics 17 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 1369-1374 Graphene, p-n junction, interferometer, magnons https://doi.org/10.5281/zenodo.6500310 EMPIR 2017: Fundamental Springer Science and Business Media LLC

Dordrecht, GX, Netherlands

1 1745-2473, 1745-2481 10.1038/s41567-021-01411-z NA A.Assouline M.Jo P.Brasseur K.Watanabe T.Taniguchi Th.Jolicoeur D. C.Glattli N.Kumada P.Roche F. D.Parmentier P.Roulleau miscellaneous FuchsJKMB 2629 17FUN06: SIQUST: Single-photon sources as new quantum standards color centers, tin vacancy center, optical antenna, diamond nanophotonics, single photons EMPIR 2017: Fundamental NA https://zenodo.org/record/5055763 P.Fuchs T.Jung M.Kieschnick J.Meijer C.Becher