% % This file was created by the TYPO3 extension % bib % --- Timezone: CEST % Creation date: 2022-08-11 % Creation time: 02-23-05 % --- Number of references % 1177 % @Article { PuertoHMM2022, subid = {2792}, title = {Methodology to Evaluate the Performance of Portable Photogrammetry for Large-Volume Metrology}, journal = {Metrology}, year = {2022}, month = {6}, day = {28}, volume = {2}, number = {3}, number2 = {20IND02: DynaMITE: Dynamic applications of large volume metrology in industry of tomorrow environments}, pages = {320-334}, keywords = {large-volume metrology (LVM), portable photogrammetry, path planning, inline measurement, metrology}, web_url = {https://www.mdpi.com/2673-8244/2/3/20}, misc2 = {EMPIR 2020: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {2673-8244}, DOI = {10.3390/metrology2030020}, stag_bib_extends_levelofaccess = {NA}, author = {Puerto, P. and Heisselmann, D. and M{\"u}ller, S. and Mendikute, A.} } @Article { IrwinHSBSBSV2022, subid = {2623}, title = {Characterising the silver particle generator; a pathway towards standardising silver aerosol generation}, journal = {Journal of Aerosol Science}, year = {2022}, month = {6}, volume = {163}, number2 = {19ENV09: MetroPEMS: Improved vehicle exhaust quantification by portable emission measurement systems metrology}, pages = {105978}, keywords = {silver particle generator, calibration, reference aerosol, CPC calibration, DMA calibration}, web_url = {https://www.sciencedirect.com/science/article/pii/S002185022200026X?via\%3Dihub}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2022.105978}, stag_bib_extends_levelofaccess = {NA}, author = {Irwin, M. and Hammer, T. and Swanson, J. and Berger, V. and Sonkamble, U. and Boies, A. and Schulz, H. and Vasilatou, K.} } @Article { RadtkeGPEBHSKLK2022, subid = {2793}, title = {Measurements and Utilization of Consistent Gibbs Energies of Transfer of Single Ions: Towards a Unified Redox Potential Scale for All Solvents}, journal = {Chemistry – A European Journal}, year = {2022}, month = {5}, day = {31}, volume = {28}, number = {2022}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {14}, keywords = {Gibbs Energies of Transfer of Single Ionsunified pH}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {0947-6539, 1521-3765}, DOI = {10.1002/chem.202200509}, stag_bib_extends_levelofaccess = {NA}, author = {Radtke, V. and Gebel, N. and Priester, D. and Ermantraut, A. and B{\"a}uerle, M. and Himmel, D. and Stroh, R. and Koslowski, T. and Leito, I. and Krossing, I.} } @Article { HohlsKSWKS2022, subid = {2758}, title = {Controlling the error mechanism in a tunable-barrier nonadiabatic charge pump by dynamic gate compensation}, journal = {Physical Review B}, year = {2022}, month = {5}, day = {20}, volume = {105}, number = {20}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {205425}, keywords = {single electron pump, control scheme, error mechanism, current standard}, web_url = {https://arxiv.org/abs/2112.10713}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.105.205425}, stag_bib_extends_levelofaccess = {NA}, author = {Hohls, F. and Kashcheyevs, V. and Stein, F. and Wenz, T. and Kaestner, B. and Schumacher, H.W.} } @Article { RusantoSFH2022, subid = {2787}, title = {Primary measurement method for the characterisation of impedance standard in the m\(\Omega\) range}, journal = {Measurement Science and Technology}, year = {2022}, month = {5}, day = {18}, volume = {33}, number = {8}, number2 = {17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications}, pages = {085016}, keywords = {low impedance, impedance standard, primary measurement method, uncertainty,comparison}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/ac6a45}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac6a45}, stag_bib_extends_levelofaccess = {NA}, author = {Rusanto, B.H. and Seitz, S. and Funck, T. and Heinrich, M.} } @Article { RubenVogtRGDKMKKSBBMPFCRVSH2022, subid = {2751}, title = {PV Module Energy Rating Standard IEC 61853-3 Intercomparison and Best Practice Guidelines for Implementation and Validation}, journal = {IEEE Journal of Photovoltaics}, year = {2022}, month = {5}, volume = {12}, number = {3}, number2 = {19ENG01: Metro-PV: Metrology for emerging PV applications}, pages = {844-852}, keywords = {Standards, Meteorology, IEC Standards, Temperature measurement, Power measurement, Photovoltaic systems, Mathematical models}, web_url = {https://www.techrxiv.org/articles/preprint/PV_module_energy_rating_standard_IEC_61853-3_intercomparison_and_best_practice_guidelines_for_implementation_and_validation/19635333/1}, misc2 = {EMPIR 2019: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2021.3135258}, stag_bib_extends_levelofaccess = {NA}, author = {Ruben Vogt, M. and Riechelmann, S. and Gracia-Amillo, A.M. and Driesse, A. and Kokka, A. and Maham, K. and K{\"a}rh{\"a}, P. and Kenny, R. and Schinke, C. and Bothe, K. and Blakesley, J. and Music, E. and Plag, F. and Friesen, G. and Corbellini, G. and Riedel-Lyngskar, N. and Valckenborg, R. and Schweiger, M. and Herrmann, W.} } @Article { BriantKCLBWRMPCESTHPKKDZWMSNB2022, subid = {2714}, title = {Photonic and Optomechanical Thermometry}, journal = {Optics}, year = {2022}, month = {4}, day = {29}, volume = {3}, number = {2}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {159-176}, keywords = {thermometry; photonic; optomechanic; temperature sensors; photonic integrated circuit}, web_url = {https://doi.org/10.3390/opt3020017}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2673-3269}, DOI = {10.3390/opt3020017}, stag_bib_extends_levelofaccess = {NA}, author = {Briant, T. and Krenek, S. and Cupertino, A. and Loubar, F. and Braive, R. and Weituschat, L. and Ramos, D. and Martin, M.J. and Postigo, P.A. and Casas, A. and Eisermann, R. and Schmid, D. and Tabandeh, S. and Hahtela, O. and Pourjamal, S. and Kozlova, O. and Kroker, S. and Dickmann, W. and Zimmermann, L. and Winzer, G. and Martel, T. and Steeneken, P.G. and Norte, R.A. and Briaudeau, S.} } @Article { VolkovaHTBCMARERBPN2022, subid = {2712}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {color centers, optical quantum technology}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { VolkovaHTBCMARERBPN2022_2, subid = {2721}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { RaupachDGMHGGKL2022, subid = {2765}, title = {Detection rate dependence of the inherent detection efficiency in single-photon detectors based on avalanche diodes}, journal = {Physical Review A}, year = {2022}, month = {4}, day = {25}, volume = {105}, number = {4}, number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware}, pages = {042615}, keywords = {Single-photon counting, Metrology for quantum technologies, QKD implementation security, standardisation}, web_url = {https://journals.aps.org/pra/pdf/10.1103/PhysRevA.105.042615}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.105.042615}, stag_bib_extends_levelofaccess = {NA}, author = {Raupach, S.M.F. and Degiovanni, I.P. and Georgieva, H. and Meda, A. and Hofer, H. and Gramegna, M. and Genovese, M. and K{\"u}ck, S. and L{\'o}pez, M.} } @Article { HoflingBHRHWTJBGR2022, subid = {2713}, title = {Numerical optimization of single-mode fiber-coupled single-photon sources based on semiconductor quantum dots}, journal = {Optics Express}, year = {2022}, month = {4}, day = {25}, volume = {30}, number = {10}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {15913}, keywords = {single photon source; optical quantum technology}, web_url = {https://arxiv.org/abs/2202.09562}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Optica Publishing Group}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.456777}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}fling, S. and Burger, S. and Herkommer, Al. and Rodt, S. and Huber, T. and Weber, K. and Thiele, S. and Jimenez, C. and Bremer, L. and Giessen, H. and Reitzenstein, S.} } @Article { RubinSZHFABKLZA2022, subid = {2709}, title = {Thermodynamic effects in a gas modulated Invar-based dual Fabry–P{\'e}rot cavity refractometer}, journal = {Metrologia}, year = {2022}, month = {4}, day = {14}, volume = {59}, number = {3}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {035003}, keywords = {quantumpascal, GAMOR, optical pressure standard, gas refractometry, pV-work, Invar-based}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac5ef9}, stag_bib_extends_levelofaccess = {NA}, author = {Rubin, T. and Silander, I. and Zakrisson, J. and Hao, M. and Forss{\'e}n, C. and Asbahr, P. and Bernien, M. and Kussicke, A. and Liu, K. and Zelan, M. and Axner, O.} } @Article { KranzerSBHPLLP2022, subid = {2662}, title = {Response of diamond detectors in ultra-high dose-per-pulse electron beams for dosimetry at FLASH radiotherapy}, journal = {Physics in Medicine \& Biology}, year = {2022}, month = {3}, day = {21}, volume = {67}, number = {7}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {075002}, keywords = {dosimetry, FLASH radiotherapy, ultra-high dose-per-pulse, microDiamond}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac594e}, stag_bib_extends_levelofaccess = {NA}, author = {Kranzer, R. and Sch{\"u}ller, A. and Bourgouin, A. and Hackel, T. and Poppinga, D. and Lapp, M. and Looe, H.K. and Poppe, B.} } @Article { GogneauCSCLTHJTH2022, subid = {2666}, title = {Electromechanical conversion efficiency of GaN NWs: critical influence of the NW stiffness, the Schottky nano-contact and the surface charge effects}, journal = {Nanoscale}, year = {2022}, month = {3}, day = {17}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, keywords = {piezoelectric nanowires, NW, AFM, stiffness, GaN, energy, harvesting}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2022/NR/D1NR07863A}, misc2 = {EMPIR 2019: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/d1nr07863a}, stag_bib_extends_levelofaccess = {NA}, author = {Gogneau, N. and Chr{\'e}tien, P. and Sodhi, T. and Couraud, L. and Leroy, L. and Travers, L. and Harmand, J-C. and Julien, F.H. and Tchernycheva, M. and Houz{\'e}, F.} } @Article { HuynhDDLBW2022, subid = {2681}, title = {Candidate High-Resolution Mass Spectrometry-Based Reference Method for the Quantification of Procalcitonin in Human Serum Using a Characterized Recombinant Protein as a Primary Calibrator}, journal = {Analytical Chemistry}, year = {2022}, month = {3}, volume = {94}, number = {10}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {4146-4154}, keywords = {High-Resolution Mass Spectrometry, Procalcitonin, Primary Calibrator}, web_url = {https://doi.org/10.1021/acs.analchem.1c03061}, misc2 = {EMPIR 2018: Health}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0003-2700, 1520-6882}, DOI = {10.1021/acs.analchem.1c03061}, stag_bib_extends_levelofaccess = {NA}, author = {Huynh, H-H. and Delatour, V. and Derbez-Morin, M. and Liu, Q. and Boeuf, A. and Webster, W.} } @Article { WarneckeKOKCBBHHU2022, subid = {2574}, title = {New metrological capabilities for measurements of dynamic liquid flows}, journal = {Metrologia}, year = {2022}, month = {2}, day = {17}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {dynamic liquid flow rates, test rigs with dynamic measurement capabilities, validation through inter-facility intercomparison}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac566e}, stag_bib_extends_levelofaccess = {NA}, author = {Warnecke, H. and Kroner, C. and Ogheard, F. and Kondrup, J.B. and Christoffersen, N. and Benkova, M. and B{\"u}ker, O. and Haack, S. and Huovinen, M. and Unsal, B.} } @Proceedings { BircherMKBEKHHL2022, subid = {2585}, title = {Traceable determination of non-static XCT machine geometry: New developments and case studies}, journal = {Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022,}, year = {2022}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {traceability, Dimensional metrology, XCT machine geometry, calibrated reference standards, radiographic XCT geometry determination, stage error motion, CFD/FE simulations, image quality metric based methods}, web_url = {https://www.ndt.net/search/docs.php3?id=26614}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {11th Conference on Industrial Computed Tomography (iCT) 2022}, event_date = {08-02-2022 to 11-02-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id209.pdf}, author = {Bircher, B. and Meli, F. and K{\"u}ng, A. and Bellon, C. and Evsevleev, S. and Katić, M. and Heikkinen, V. and Hemming, B. and Lassila, A.} } @Article { ZutzBKHR2022, subid = {2630}, title = {DEVELOPMENT OF A EUROPEAN METROLOGY NETWORK FOR RELIABLE RADIATION PROTECTION: PULSED HIGH ENERGY PHOTON REFERENCE FIELD AS A METROLOGICAL GAP IN RADIATION PROTECTION}, journal = {Physica Medica}, year = {2022}, month = {2}, volume = {94}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, pages = {S113}, keywords = {high energy pulsed fields, European Metrology Network for Radiation Protection, photon reference field, metrological gaps, supportBSS}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/S1120-1797(22)01699-4}, stag_bib_extends_levelofaccess = {NA}, author = {Zutz, H. and Busse, J. and Khanbabaee, B. and Hupe, O. and R{\"o}ttger, A.} } @Article { WeingartnerHVVROKMD2022, subid = {2519}, title = {Comparing black-carbon- and aerosol-absorption-measuring instruments – a new system using lab-generated soot coated with controlled amounts of secondary organic matter}, journal = {Atmospheric Measurement Techniques}, year = {2022}, month = {2}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, keywords = {soot , black carbon, absorption photometer, photo-thermal interferometer, calibration}, misc2 = {EMPIR 2018: Health}, language = {30}, DOI = {10.5194/amt-15-561-2022}, stag_bib_extends_levelofaccess = {NA}, author = {Weingartner, E. and Hyv{\"a}rinen, A-P. and Vasilatou, K. and Visser, B. and R{\"o}rhbein, J. and Oscity, M. and Kalbermatter, D. and Močnik, G. and Drinovec, L.} } @Article { MarinelliFGGGHPPVVVV2022, subid = {2659}, title = {Design, realization, and characterization of a novel diamond detector prototype for FLASH radiotherapy dosimetry}, journal = {Medical Physics}, year = {2022}, month = {1}, day = {31}, volume = {49}, number = {3}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {1902-1910}, keywords = {diamond detector, dosimetry, FLASH radiotherapy}, misc2 = {EMPIR 2018: Health}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.15473}, stag_bib_extends_levelofaccess = {NA}, author = {Marinelli, M. and Felici, G. and Galante, F. and Gasparini, A. and Giuliano, L. and Heinrich, S. and Pacitti, M. and Prestopino, G. and Vanreusel, V. and Verellen, D. and Verona, C. and Verona Rinati, G.} } @Article { KuckLHGCRPSGBFLTTCMDTRR2022, subid = {2486}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Single photon sources, quantum radiometry, quantum metrology}, web_url = {https://doi.org/10.1007/s00340-021-07734-2}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { KuckLHGCRPSGBFLTTCMDTRR2022_2, subid = {2752}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, keywords = {Single-photon sources, quantum radiometry, calibration, single photon detectors. defect centres, (nano-)diamonds, molecule semiconductor quantum dots, photon flux, single-photon purity, spectral power distribution}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { TongBKRGGGCHC2022, subid = {2570}, title = {Cathodoluminescence mapping of electron concentration in MBE-grown GaAs:Te nanowires}, journal = {Nanotechnology}, year = {2022}, month = {1}, day = {22}, volume = {33}, number = {18}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {185704}, keywords = {nanowires, GaAs, doping, cathodoluminescence}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/ac4d58}, misc2 = {EMPIR 2019: Energy}, publisher = {IOP}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://hal.archives-ouvertes.fr/hal-03539939}, author = {Tong, C. and Bidaud, T. and Koivusalo, E. and Rizzo Piton, M. and Guina, M. and Galeti, H. and Galvao Gobato, Y. and Cattoni, A. and Hakkarainen, T. and Collin, S.} } @Article { DeVisMHMSB2022, subid = {2536}, title = {Ancillary Data Uncertainties within the SeaDAS Uncertainty Budget for Ocean Colour Retrievals}, journal = {Remote Sensing}, year = {2022}, month = {1}, day = {21}, volume = {14}, number = {3}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {497}, keywords = {Ocean Colour, Atmospheric correction, uncertainty, ancillary parameters}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs14030497}, stag_bib_extends_levelofaccess = {NA}, author = {De Vis, P. and M{\'e}lin, F. and Hunt, S.E. and Morrone, R. and Sinclair, M. and Bell, B.} } @Article { DeVisMHMSB2022_2, subid = {2590}, title = {Ancillary Data Uncertainties within the SeaDAS Uncertainty Budget for Ocean Colour Retrievals}, journal = {Remote Sensing}, year = {2022}, month = {1}, day = {21}, volume = {14}, number = {3}, number2 = {19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system}, pages = {497}, keywords = {ocean colour, atmospheric correction, uncertainty, ancillary parameters}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs14030497}, stag_bib_extends_levelofaccess = {NA}, author = {De Vis, P. and M{\'e}lin, F. and Hunt, S.E. and Morrone, R. and Sinclair, M. and Bell, B.} } @Article { KellerSKFCVCOBHMMNORBCNCDDGLVWZK2022, subid = {2778}, title = {RNA reference materials with defined viral RNA loads of SARS-CoV-2—A useful tool towards a better PCR assay harmonization}, journal = {PLOS ONE}, year = {2022}, month = {1}, day = {20}, volume = {17}, number = {1}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {e0262656}, keywords = {SARS-CoV-2, RNA, PCR}, misc2 = {EMPIR 2018: Health}, publisher = {Public Library of Science (PLoS)}, language = {30}, ISSN = {1932-6203}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6637818}, author = {Keller, T. and Schellenberg, I. and Kummrow, A. and Falak, S. and Cleveland, M.H. and Vallone, P.M. and Cowen, S. and O’Sullivan, D. and Busby, E. and Huggett, J. and Mielke, M. and Michel, J. and Nitsche, A. and Obermeier, M. and Rabenau, H.F. and Berger, A. and Ciesek, S. and Niemeyer, D. and Corman, V. and Duehring, U. and Drosten, C. and Grunert, H-P. and Lindig, V. and Vierbaum, L. and Wojtalewicz, N. and Zeichhardt, H. and Kammel, M.} } @Article { HansenJJH2022, subid = {2518}, title = {Enhanced Measurement Accuracy for Nanostructures Using Hybrid Metrology}, journal = {Frontiers in Physics}, year = {2022}, month = {1}, day = {19}, volume = {9}, number2 = {20FUN02: POLight: Pushing boundaries of nano-dimensional metrology by light}, pages = {791459}, keywords = {metrology, Mueller ellipsometry, inverse modelling, scatterometry, nanostructures}, web_url = {https://www.frontiersin.org/articles/10.3389/fphy.2021.791459/full}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2021.791459}, stag_bib_extends_levelofaccess = {NA}, author = {Hansen, P-E. and Johannsen, S.R. and Jensen, S.A. and Hansen, P.} } @Article { BeckhoffURHTHE2022, subid = {2463}, title = {Investigating Membrane‐Mediated Antimicrobial Peptide Interactions with Synchrotron Radiation Far‐Infrared Spectroscopy}, journal = {ChemPhysChem}, year = {2022}, month = {1}, day = {14}, number2 = {HLT10: BiOrigin: Metrology for biomolecular origin of disease}, pages = {1-11}, keywords = {antimicrobialpeptides, electrostatic interactions, IR spectroscopy, phospholipid membranes, protein folding}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley}, language = {30}, ISSN = {1439-4235, 1439-7641}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1002/cphc.202100815}, author = {Beckhoff, B. and Ulm, G. and Ryadnov, M.G. and Hoehl, A. and Tiersch, B. and Hornemann, A. and Eichert, D.M.} } @Article { ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022, subid = {2567}, title = {2022 roadmap on neuromorphic computing and engineering}, journal = {Neuromorphic Computing and Engineering}, year = {2022}, month = {1}, day = {12}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, keywords = {neuromorphic computing, neuromorphic engineering}, web_url = {https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2634-4386}, DOI = {10.1088/2634-4386/ac4a83}, stag_bib_extends_levelofaccess = {NA}, author = {Christensen, D.V. and Dittmann, R. and Linares-Barranco, B. and Sebastian, A. and Le Gallo, M. and Redaelli, A. and Slesazeck, S. and Mikolajick, T. and Spiga, S. and Menzel, S. and Valov, I. and Milano, G. and Ricciardi, C. and Liang, S-J. and Miao, F. and Lanza, M. and Quill, T.J. and Keene, S.T. and Salleo, A. and Grollier, J. and Markovic, D. and Mizrahi, A. and Yao, P. and Yang, J.J. and Indiveri, G. and Strachan, J.P. and Datta, S. and Vianello, E. and Valentian, A. and Feldmann, J. and Li, X. and Pernice, W.H.P. and Bhaskaran, H. and Furber, S. and Neftci, E. and Scherr, F. and Maass, W. and Ramaswamy, S. and Tapson, J. and Panda, P. and Kim, Y. and Tanaka, G. and Thorpe, S. and Bartolozzi, C. and Cleland, T.A. and Posch, C. and Liu, S-C. and Panuccio, G. and Mahmud, M. and Mazumder, A.N. and Hosseini, M. and Mohsenin, T. and Donati, E. and Tolu, S. and Galeazzi, R. and Christensen, M.E. and Holm, S. and Ielmini, D. and Pryds, N.} } @Article { ChristinckRLGHGK2022, subid = {2506}, title = {Comparison of back focal plane imaging of nitrogen vacancy centers in nanodiamond and core-shell CdSe/CdS quantum dots}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {012014}, keywords = {nitrogen vacancy center, nanodiamond, CdSe/CdS quantum dots, back focal imaging}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/2149/1/012014}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/2149/1/012014}, stag_bib_extends_levelofaccess = {NA}, author = {Christinck, J. and Rodiek, B. and L{\'o}pez, M. and Georgieva, H. and Hofer, H. and G{\"o}tzinger, S. and K{\"u}ck, S.} } @Proceedings { HulsenGPGKF2022, subid = {2416}, title = {Angular responsivity of ground and space-based direct solar irradiance radiometers}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {2149}, number2 = {19ENV04: MAPP: Metrology for aerosol optical properties}, pages = {1-7}, keywords = {Radiometry, field of view, angular responsivity}, web_url = {https://iopscience.iop.org/issue/1742-6596/2149/1}, misc2 = {EMPIR 2019: Environment}, publisher = {IOP Publishing Limited}, event_place = {Boulder}, event_name = {14th International Conference on New Developments and Applications in Optical Radiometry (NEWRAD 2021)}, event_date = {21-06-2021 to 24-06-2021}, language = {30}, DOI = {10.1088/1742-6596/2149/1/012001}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"u}lsen, G. and Gr{\"o}bner, J. and Pfiffner, D. and Gyo, M. and Kouremeti, N. and F{\"o}ller, J.} } @Article { ChavelSLSHO2022, subid = {2684}, title = {Advocating a statistical definition for the BRDF}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {1}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {012013}, keywords = {BRDF, metrology, spectrophotometry, speckle}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/2149/1/012013}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/2149/1/012013}, stag_bib_extends_levelofaccess = {NA}, author = {Chavel, P. and Sortais, Y. and Labardens, T. and Simonot, L. and Hebert, M. and Obein, G.} } @Article { SantourianQTHS2022, subid = {2420}, title = {Novel LED-based radiation source and its application in diffuse reflectometry and polarization measurements}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149 (2022}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {1-8}, keywords = {Source based radiometry, BRDF, Spectral radiance factor, LED sphere radiator, polarisation, diffuse reflection}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {NEWRAD 2021 - IOP Publishing}, language = {30}, ISSN = {1742-6588}, DOI = {10.1088/1742-6596/2149/1/012010}, stag_bib_extends_levelofaccess = {NA}, author = { Santourian, I. and Quast, T. and Teichert, S. and Hauer, K-O. and Schirmacher, A.} } @Article { SchaudeGH2022, subid = {2443}, title = {Effect of a Misidentified Centre of a Type ASG Material Measure on the Determined Topographic Spatial Resolution of an Optical Point Sensor}, journal = {Metrology}, year = {2022}, month = {1}, volume = {2}, number = {1}, number2 = {20IND07: TracOptic: Traceable industrial 3D roughness and dimensional measurement using optical 3D microscopy and optical distance sensors}, pages = {19-32}, keywords = {surface metrology, topographic spatial resolution, lateral period limit, type ASG materialmeasure, Siemens star, confocal sensor, nano measuring machine}, web_url = {https://www.mdpi.com/2673-8244/2/1/2}, misc2 = {EMPIR 2020: Industry}, publisher = {MDPI}, language = {30}, DOI = {10.3390/metrology2010002}, stag_bib_extends_levelofaccess = {NA}, author = {Schaude, J. and Gr{\"o}schl, A. and Hausotte, T. } } @Article { HrabinaHRCPZLC2022, subid = {2785}, title = {Absolute frequencies of H13C14N hydrogen cyanide hyper-fine transitions in 1,5 \(\mu\)m region with saturated spectroscopy and sub-kHz scanning laser}, journal = {Optics Letters}, year = {2022}, volume = {TBD}, number = {TBD}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, pages = {TBD}, keywords = {saturated spectroscopy, hydrogen cyanide, scanning laser}, misc2 = {EMPIR 2017: Industry}, publisher = {Optica}, language = {30}, ISSN = {1539-4794}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2206.09232}, author = {Hrabina, J. and Hošek, M. and Rerucha, S. and Č{\'i}žek, M. and Pilat, Z. and Zucco, M. and Lazar, J. and Č{\'i}p, O.} } @Article { MelinCDH2022, subid = {2591}, title = {Sensitivity of Ocean Color Atmospheric Correction to Uncertainties in Ancillary Data: A Global Analysis with SeaWiFS Data}, journal = {IEEE Transactions on Geoscience and Remote Sensing}, year = {2022}, number2 = {19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system}, pages = {1-1}, keywords = {Ocean color, uncertainties, SeaWiFS,Image color analysis, Sensitivity, Remote sensing, Distributed databases, Satellites, Aerosols}, misc2 = {EMPIR 2019: Environment}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0196-2892, 1558-0644}, DOI = {10.1109/TGRS.2022.3150400}, stag_bib_extends_levelofaccess = {NA}, author = {M{\'e}lin, F. and Colandrea, P. and De Vis, P. and Hunt, S.E.} } @Article { MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022, subid = {2764}, title = {Versailles project on advanced materials and standards (VAMAS) interlaboratory study on measuring the number concentration of colloidal gold nanoparticles}, journal = {Nanoscale}, year = {2022}, volume = {14}, number = {12}, number2 = {18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration}, pages = {4690-4704}, keywords = {nanoparticle, concentration, standardization, VAMAS, interlaboratory}, misc2 = {EMPIR 2018: Support for Impact}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/D1NR07775A}, stag_bib_extends_levelofaccess = {NA}, author = {Minelli, C. and Wywijas, M. and Bartczak, D. and Cuello-Nu{\~n}ez, S. and Infante, H.G. and Deumer, J. and Gollwitzer, C. and Krumrey, M. and Murphy, K.E. and Johnson, M.E. and Montoro Bustos, A.R. and Strenge, I.H. and Faure, B. and H{\o}gh{\o}j, P. and Tong, V. and Burr, L. and Norling, K. and H{\"o}{\"o}k, F. and Roesslein, M. and Kocic, J. and Hendriks, L. and Kestens, V. and Ramaye, Y. and Contreras Lopez, M.C. and Auclair, G. and Mehn, D. and Gilliland, D. and Potthoff, A. and Oelschl{\"a}gel, K. and Tentschert, J. and Jungnickel, H. and Krause, B.C. and Hachenberger, Y.U. and Reichardt, P. and Luch, A. and Whittaker, T.E. and Stevens, M.M. and Gupta, S. and Singh, A. and Lin, F-h. and Liu, Y-H. and Costa, A.L. and Baldisserri, C. and Jawad, R. and Andaloussi, S.E.L. and Holme, M.N. and Lee, T.G. and Kwak, M. and Kim, J. and Ziebel, J. and Guignard, C. and Cambier, S. and Contal, S. and Gutleb, A.C. and “Kuba” Tatarkiewicz, J. and Jankiewicz, B.J. and Bartosewicz, B. and Wu, X. and Fagan, J.A. and Elje, E. and Rund{\'e}n-Pran, E. and Dusinska, M. and Kaur, I.P. and Price, D. and Nesbitt, I. and O\(\prime\) Reilly, S. and Peters, R.J.B. and Bucher, G. and Coleman, D. and Harrison, A.J. and Ghanem, A. and Gering, A. and McCarron, E. and Fitzgerald, N. and Cornelis, G. and Tuoriniemi, J. and Sakai, M. and Tsuchida, H. and Maguire, C. and Prina-Mello, A. and Lawlor, A.J. and Adams, J. and Schultz, C.L. and Constantin, D. and Thanh, N.T.K. and Tung, L.D. and Panariello, L. and Damilos, S. and Gavriilidis, A. and Lynch, I. and Fryer, B. and Carrazco Quevedo, A. and Guggenheim, E. and Briffa, S. and Valsami-Jones, E. and Huang, Y. and Keller, A.A. and Kinnunen, V-T. and Per{\"a}m{\"a}ki, S. and Krpetic, Z. and Greenwood, M. and Shard, A.G.} } @Article { DieudonneSHCL2021, subid = {2400}, title = {A Study of Experiment-based Radio Frequency Electromagnetic Field Exposure Evidence on Stochastic Nature of A Massive MIMO System}, journal = {A Study of Experiment-based Radio Frequency Electromagnetic Field}, year = {2021}, month = {12}, day = {17}, volume = {1}, number = {1}, number2 = {18SIP02: 5GRFEX: Metrology for RF exposure from massive MIMO 5G base station: Impact on 5G network deployment}, pages = {1-5}, keywords = {exposure, radiofrequency, electromagnetic field, massive mimo, stochastic nature, measurements.}, web_url = {https://arxiv.org/abs/2112.09637}, misc2 = {EMPIR 2018: Support for Impact}, publisher = {Tian Hong Loh}, language = {30}, ISSN = {arXiv:2112.09637v1}, DOI = {10.23919/EuCAP51087.2021.9411325}, stag_bib_extends_levelofaccess = {NA}, author = {Dieudonne, M. and Sunday, A. and Heliot, F. and Cheadle, D. and Loh, T.} } @Article { GarberoglioHJ2021, subid = {2399}, title = {Path-integral calculation of the third dielectric virial coefficient of noble gases}, journal = {The Journal of Chemical Physics}, year = {2021}, month = {12}, day = {15}, volume = {155}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {234103}, keywords = {Third dielectric virial coefficient, Path Integral Monte Carlo, Ab-initio calculation}, web_url = {https://arxiv.org/abs/2111.02691}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {1089-7690}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {10.1063/5.0077684}, author = {Garberoglio, G. and Harvey, A. and Jeziorski, B.} } @Article { HutzschenreuterMLK2021, subid = {2415}, title = {Validation of SI-based digital data of measurement the TraCIM system}, journal = {Journal of Sensors and Sensor Systems}, year = {2021}, month = {12}, day = {13}, volume = {10}, number = {2}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, pages = {289-295}, keywords = {Digital Transformation, TraCIM, XML, D-SI, Online Validation}, misc2 = {EMPIR 2017: Industry}, language = {30}, DOI = {10.5194/jsss-10-289-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Hutzschenreuter, D. and Muller, B. and Loewe, J.H. and Klobucar, R.} } @Article { KayserOHB2021, subid = {2485}, title = {Reliable compositional analysis of airborne particulate matter beyond the quantification limits of total reflection X-ray fluorescence.}, journal = {Analytica Chimica Acta}, year = {2021}, month = {12}, day = {12}, volume = {1192}, number = {1}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {339367}, keywords = {Total reflection X-ray fluorescence, Grazing incidence X-ray fluorescence, Aerosols, Airborne particulate matter, Air pollution, Cascade impactors}, web_url = {https://www.sciencedirect.com/journal/analytica-chimica-acta\&\#10;http://www.aerometprojectii.com/}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier B.V.}, language = {30}, ISSN = {0003-2670}, DOI = {10.1016/j.aca.2021.339367}, stag_bib_extends_levelofaccess = {NA}, author = {Kayser, Y. and Os{\'a}n, J. and Honicke, P. and Beckhoff, B.} } @Article { GollwitzerDSTCMPDFCH2021, subid = {2389}, title = {Correlative Analysis of the Dimensional Properties of Bipyramidal Titania Nanoparticles by Complementing Electron Microscopy with Other Methods}, journal = {Nanomaterials}, year = {2021}, month = {12}, day = {10}, volume = {11}, number = {12}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {3359}, keywords = {nanoparticle; complex‐shape; bipyramid; electron microscopy; atomic force microscopy;size measurements; TKD; STEM‐in‐SEM; SAXS; nanoparticle concentration; correlative analysis}, web_url = {https://www.mdpi.com/2079-4991/11/12/3359}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11123359}, stag_bib_extends_levelofaccess = {NA}, author = {Gollwitzer, C. and Deumer, J. and Salzmann, C. and Tokarski, T. and Cios, G. and Maurino, V. and Pellegrino, F. and Delvall{\'e}e, A. and Feltin, N. and Crouzier, L. and Hodoroaba, V-D.} } @Article { HirtCHRK2021, subid = {2505}, title = {Sample fabrication and metrological characterization of single-photon emitters based on nitrogen vacancy centers in nanodiamonds}, journal = {Engineering Research Express}, year = {2021}, month = {12}, volume = {3}, number = {4}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {045038}, keywords = {nitrogen vacancy center, nanodiamond, single-photon source, fabrication}, web_url = {https://iopscience.iop.org/article/10.1088/2631-8695/ac34c2}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2631-8695}, DOI = {10.1088/2631-8695/ac34c2}, stag_bib_extends_levelofaccess = {NA}, author = {Hirt, F. and Christinck, J. and Hofer, H. and Rodiek, B. and K{\"u}ck, S.} } @Article { OlbrichHLvBOS2021, subid = {2175}, title = {Comparing temporal characteristics of slug flow from tomography measurements and video observations}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {100222}, keywords = {slug flow, interface dynamics, tomography, video observation}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001859}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100222}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and Hunt, A. and Leonard, T. and van Putten, D.S. and B{\"a}r, M. and Oberleithner, K. and Schmelter, S.} } @Article { ZelenkaAHKPZM2021, subid = {2205}, title = {Why and how to improve the subdivision technique in mass metrology}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {19RPT02: RealMass: Improvement of the realisation of the mass scale}, pages = {100228}, keywords = {Mass scale, Weights, Kilogram, Multiples and submultiples, Subdivision, OIML R111}, misc2 = {EMPIR 2019: Research Potential}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100228}, stag_bib_extends_levelofaccess = {NA}, author = {Zelenka, Z. and Alisic, S. and Hanrahan, R. and Kolozinsky, I. and Popa, G. and Zůda, J. and Malengo, A.} } @Article { MelinCGFLHFP2021, subid = {2306}, title = {Metrological references for person ability in memory tests}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {100289}, keywords = {Alzheimer's, Cognition, Construct specification equations, Memory metrology, Rasch, Person ability}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100289}, stag_bib_extends_levelofaccess = {NA}, author = {Melin, J. and Cano, S.J. and G{\"o}schel, L. and Fillmer, A. and Lehmann, S. and Hirtz, C. and Fl{\"o}el, A. and Pendrill, L.R.} } @Article { MertesKHKSWRRWW2021, subid = {2423}, title = {Ion implantation of 226Ra for a primary 222Rn emanation standard}, journal = {Applied Radiation and Isotopes}, year = {2021}, month = {12}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {Ion implantation222Rn emanationLaser ionizationDefined solid-angle alpha-particle spectrometry}, misc2 = {EMPIR 2019: Environment}, language = {30}, DOI = {10.1016/j.apradiso.2021.110093}, stag_bib_extends_levelofaccess = {NA}, author = {Mertes, F. and Kneip, N. and Heinke, R. and Kieck, T. and Studer, D. and Weber, F. and R{\"o}ttger, S. and R{\"o}ttger, A. and Wendt, K. and Walther, C.} } @Article { Hiti2021, subid = {2670}, title = {Compensation of synchronization error effect in testing machine calibration}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services}, pages = {100132}, keywords = {Force calibration, Data synchronization; Continuous loading; Material testing machines}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421000957}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100132}, stag_bib_extends_levelofaccess = {NA}, author = {Hiti, M.} } @Article { Hiti2021_2, subid = {2672}, title = {Analysis of loading profile effect on testing machine calibration results}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services}, pages = {100131}, keywords = {Force calibration; Loading profile; Measurement uncertainty; Continuous loading; Material testing machines}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421000945}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100131}, stag_bib_extends_levelofaccess = {NA}, author = {Hiti, M.} } @Article { NugrohoHPRYIKPWS2021, subid = {2473}, title = {Vertically Aligned n-Type Silicon Nanowire Array as a Free-Standing Anode for Lithium-Ion Batteries}, journal = {Nanomaterials}, year = {2021}, month = {11}, day = {20}, volume = {11}, number = {11}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {3137}, keywords = {silicon nanowire, nanowire array, silicon anode, n-type silicon anode, Li-ion battery}, misc2 = {EMPIR 2019: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11113137}, stag_bib_extends_levelofaccess = {NA}, author = {Nugroho, A.P. and Hawari, N.H. and Prakoso, B. and Refino, A.D. and Yulianto, N. and Iskandar, F. and Kartini, E. and Peiner, E. and Wasisto, H.S. and Sumboja, A.} } @Article { PellegrinoOMSMH2021, subid = {2347}, title = {Customizing New Titanium Dioxide Nanoparticles with Controlled Particle Size and Shape Distribution – A Feasibility Study towards Reference Materials for Quality Assurance of Non‐Spherical Nanoparticle Characterization}, journal = {Advanced Engineering Materials}, year = {2021}, month = {11}, day = {13}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, keywords = {nanoparticles, titanium dioxide, reference materials, standardization, particle size and shape distribution}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/adem.202101347}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Wiley}, language = {30}, ISSN = {1438-1656, 1527-2648}, DOI = {10.1002/adem.202101347}, stag_bib_extends_levelofaccess = {NA}, author = {Pellegrino, F. and Ortel, E. and Mielke, J. and Schmidt, R. and Maurino, V. and Hodoroaba, V-D.} } @Article { RazoukBHH2021, subid = {2324}, title = {Towards accurate measurements of specific heat of solids by drop calorimetry up to 3000 \(^{\circ}\)C}, journal = {Thermal Science and Engineering Progress}, year = {2021}, month = {11}, volume = {26}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, pages = {101130}, keywords = {Drop calorimetry, Specific heat, High temperature, Metrology}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {2451-9049}, DOI = {10.1016/j.tsep.2021.101130}, stag_bib_extends_levelofaccess = {NA}, author = {Razouk, R. and Beaumont, O. and Hameury, J. and Hay, B.} } @Article { FarooquiMWWHPWS2021, subid = {2284}, title = {Development of High Temperature Multi-Layer Laser Flash Artefacts}, journal = {International Journal of Thermophysics}, year = {2021}, month = {11}, volume = {43}, number = {1}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Hafnium, Isotropic graphite, Laser flash analysis, Multi-layer systems, Partial de-bonding, Reference artefacts}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-021-02928-4}, stag_bib_extends_levelofaccess = {NA}, author = {Farooqui, A. and Morrell, R. and Wu, J. and Wright, L. and Hay, B. and Pekris, M. and Whiting, M.J. and Saunders, T.} } @Article { HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021, subid = {2336}, title = {Frequency drift in MR spectroscopy at 3T}, journal = {NeuroImage}, year = {2021}, month = {11}, volume = {241}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {118430}, keywords = {Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2021.118430}, stag_bib_extends_levelofaccess = {NA}, author = {Hui, S.C.N. and Mikkelsen, M. and Z{\"o}llner, H.J. and Ahluwalia, V. and Alcauter, S. and Baltusis, L. and Barany, D.A. and Barlow, L.R. and Becker, R. and Berman, J.I. and Berrington, A. and Bhattacharyya, P.K. and Blicher, J.U. and Bogner, W. and Brown, M.S. and Calhoun, V.D. and Castillo, R. and Cecil, K.M. and Choi, Y.B. and Chu, W.C.W. and Clarke, W.T. and Craven, A.R. and Cuypers, K. and Dacko, M. and de la Fuente-Sandoval, C. and Desmond, P. and Domagalik, A. and Dumont, J. and Duncan, N.W. and Dydak, U. and Dyke, K. and Edmondson, D.A. and Ende, G. and Ersland, L. and Evans, C.J. and Fermin, A.S.R. and Ferretti, A. and Fillmer, A. and Gong, T. and Greenhouse, I. and Grist, J.T. and Gu, M. and Harris, A.D. and Hat, K. and Heba, S. and Heckova, E. and Hegarty, J.P. and Heise, K-F. and Honda, S. and Jacobson, A. and Jansen, J.F.A. and Jenkins, C.W. and Johnston, S.J. and Juchem, C. and Kangarlu, A. and Kerr, A.B. and Landheer, K. and Lange, T. and Lee, P. and Levendovszky, S.R. and Limperopoulos, C. and Liu, F. and Lloyd, W. and Lythgoe, D.J. and Machizawa, M.G. and MacMillan, E.L. and Maddock, R.J. and Manzhurtsev, A.V. and Martinez-Gudino, M.L. and Miller, J.J. and Mirzakhanian, H. and Moreno-Ortega, M. and Mullins, P.G. and Nakajima, S. and Near, J. and Noeske, R. and Nordh{\o}y, W. and Oeltzschner, G. and Osorio-Duran, R. and Otaduy, M.C.G. and Pasaye, E.H. and Peeters, R. and Peltier, S.J. and Pilatus, U. and Polomac, N. and Porges, E.C. and Pradhan, S. and Prisciandaro, J.J. and Puts, N.A. and Rae, C.D. and Reyes-Madrigal, F. and Roberts, T.P.L. and Robertson, C.E. and Rosenberg, J.T. and Rotaru, D-G. and O'Gorman Tuura, R.L. and Saleh, M.G. and Sandberg, K. and Sangill, R. and Schembri, K. and Schrantee, A. and Semenova, N.A. and Singel, D. and Sitnikov, R. and Smith, J. and Song, Y. and Stark, C. and Stoffers, D. and Swinnen, S.P. and Tain, R. and Tanase, C. and Tapper, S. and Tegenthoff, M. and Thiel, T. and Thioux, M. and Truong, P. and van Dijk, P. and Vella, N. and Vidyasagar, R. and Vovk, A. and Wang, G. and Westlye, L.T. and Wilbur, T.K. and Willoughby, W.R. and Wilson, M. and Wittsack, H-J. and Woods, A.J. and Wu, Y-C. and Xu, J. and Lopez, M.Y. and Yeung, D.K.W. and Zhao, Q. and Zhou, X. and Zupan, G. and Edden, R.A.E.} } @Article { LehmannHP2021, subid = {2651}, title = {Three-Dimensional Transfer Functions of Interference Microscopes}, journal = {Metrology}, year = {2021}, month = {11}, volume = {1}, number = {2}, number2 = {20IND07: TracOptic: Traceable industrial 3D roughness and dimensional measurement using optical 3D microscopy and optical distance sensors}, pages = {122-141}, keywords = {interference microscopy, coherence scanning interferometry, three-dimensional transfer function}, web_url = {https://www.mdpi.com/2673-8244/1/2/9/htm}, misc2 = {EMPIR 2020: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {2673-8244}, DOI = {10.3390/metrology1020009}, stag_bib_extends_levelofaccess = {NA}, author = {Lehmann, P. and Hagemeier, S. and Pahl, T.} } @Article { ZeichhardtFDBHSHIVHVMCGSOEBHK2021, subid = {2777}, title = {The Dangers of Using Cq to Quantify Nucleic Acid in Biological Samples: A Lesson From COVID-19}, journal = {Clinical Chemistry}, year = {2021}, month = {10}, day = {22}, volume = {68}, number = {1}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {153-162}, keywords = {SARS-CoV-2, RT-qPC, EQA}, web_url = {https://academic.oup.com/clinchem/article/68/1/153/6385233\#325300656\&\#10;https://zenodo.org/record/6637873/files/18HLT03\%20Septimet\%20Supplementary\%20Funding\%20Acknowledgement\%20CLIN\%20CHEM.pdf?download=1}, misc2 = {EMPIR 2018: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0009-9147, 1530-8561}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6637873}, author = {Zeichhardt, H. and Foy, C.A. and D{\"u}hring, U. and Bae, Y-K. and Hingley-Wilson, S. and Storey, N. and Hong, K.H. and In, J. and Vandesompele, J. and Harris, K. and Verwilt, J. and Moran-Gilad, J. and Cowen, S. and Grunert, H-P. and Stewart, G. and O’Sullivan, D.M. and Evans, D. and Braybrook, J. and Huggett, Ji.F. and Kammel, M.} } @Proceedings { HosekRHCC2021, subid = {2703}, title = {Measurement of the Hydrogen Cyanide Absorption Lines' Centers with the Potential for Mise en Pratique}, journal = {Conference IEEE EFTF IFCS 2021}, year = {2021}, month = {10}, day = {19}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, keywords = {hydrogen cyanide, linear absorption spectroscopy, optical frequency comb, frequency reference, frequency stabilized lasers, SI unit meter}, web_url = {https://zenodo.org/record/6497486}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE Service Center}, event_place = {Online}, event_name = {Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {07-07-2021 to 17-07-2021}, language = {30}, ISBN = {978-1-6654-3935-0}, ISSN = {2327-1949}, DOI = {10.1109/EFTF/IFCS52194.2021.9604261}, stag_bib_extends_levelofaccess = {NA}, author = {Hošek, M. and Rerucha, S. and Hrabina, J. and Č{\'i}žek, M. and Č{\'i}p, O.} } @Proceedings { HrabinaHRPLCP2021, subid = {2704}, title = {Saturated Spectroscopy of HCN}, journal = {Conference IEEE EFTF IFCS 2021}, year = {2021}, month = {10}, day = {19}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, keywords = {saturated spectroscopy, optical frequency standard, hydrogen cyanide}, web_url = {https://zenodo.org/record/6497501}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE Service Center}, event_place = {Online}, event_name = {Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {07-07-2021 to 17-07-2021}, language = {30}, ISBN = {978-1-6654-3935-0}, ISSN = {2327-1949}, DOI = {10.1109/EFTF/IFCS52194.2021.9604272}, stag_bib_extends_levelofaccess = {NA}, author = {Hrabina, J. and Hošek, M. and Rerucha, S. and Pravdova, L. and Lazar, J. and Č{\'i}p, O. and Pilat, Z.} } @Article { DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021, subid = {2365}, title = {A Comprehensive Description of Multi-Term LSM for Applying Multiple a Priori Constraints in Problems of Atmospheric Remote Sensing: GRASP Algorithm, Concept, and Applications}, journal = {Frontiers in Remote Sensing}, year = {2021}, month = {10}, day = {19}, volume = {2}, number2 = {19ENV04: MAPP: Metrology for aerosol optical properties}, keywords = {GRASP, Radiative Transfer, Inversion model}, web_url = {https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full}, misc2 = {EMPIR 2019: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-6187}, DOI = {10.3389/frsen.2021.706851}, stag_bib_extends_levelofaccess = {NA}, author = {Dubovik, O. and Fuertes, D. and Litvinov, P. and Lopatin, A. and Lapyonok, T. and Doubovik, I. and Xu, F. and Ducos, F. and Chen, C. and Torres, B. and Derimian, Y. and Li, L. and Herreras-Giralda, M. and Herrera, M. and Karol, Y. and Matar, C. and Schuster, G.L. and Espinosa, R. and Puthukkudy, A. and Li, Z. and Fischer, J. and Preusker, R. and Cuesta, J. and Kreuter, A. and Cede, A. and Aspetsberger, M. and Marth, D. and Bindreiter, L. and Hangler, A. and Lanzinger, V. and Holter, C. and Federspiel, C.} } @Article { HayBFFGRDH2021, subid = {2250}, title = {Uncertainty Assessment for Very High Temperature Thermal Diffusivity Measurements on Molybdenum, Tungsten and Isotropic Graphite}, journal = {International Journal of Thermophysics}, year = {2021}, month = {10}, day = {17}, volume = {43}, number = {1}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {High temperature, Isotropic graphite, Molybdenum, Thermal diffusivity, Tungsten, Uncertainty}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-021-02926-6}, stag_bib_extends_levelofaccess = {NA}, author = {Hay, B. and Beaumont, O. and Failleau, G. and Fleurence, N. and Grelard, M. and Razouk, R. and Dav{\'e}e, G. and Hameury, J.} } @Article { RefinoYSNHSKIVSPW2021, subid = {2474}, title = {Versatilely tuned vertical silicon nanowire arrays by cryogenic reactive ion etching as a lithium-ion battery anode}, journal = {Scientific Reports}, year = {2021}, month = {10}, volume = {11}, number = {1}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, keywords = {high-aspect-ratio silicon (Si), nanowire array, lithium ion batteries, ICP-RIE}, web_url = {https://www.nature.com/articles/s41598-021-99173-4}, misc2 = {EMPIR 2019: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-99173-4}, stag_bib_extends_levelofaccess = {NA}, author = {Refino, A.D. and Yulianto, N. and Syamsu, I. and Nugroho, A.P. and Hawari, N.H. and Syring, A. and Kartini, E. and Iskandar, F. and Voss, T. and Sumboja, A. and Peiner, E. and Wasisto, H.S.} } @Article { MilanoPMRHBIR2021, subid = {2676}, title = {In materia reservoir computing with a fully memristive architecture based on self-organizing nanowire networks}, journal = {Nature Materials}, year = {2021}, month = {10}, volume = {21}, number = {2}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {195-202}, keywords = {memristive devices, memristive networks, nanowire networks, reservoir computing, physical computing}, web_url = {https://iris.polito.it/retrieve/handle/11583/2936403/537201/05_Manuscript.pdf}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1476-1122, 1476-4660}, DOI = {10.1038/s41563-021-01099-9}, stag_bib_extends_levelofaccess = {NA}, author = {Milano, G. and Pedretti, G. and Montano, K. and Ricci, S. and Hashemkhani, S. and Boarino, L. and Ielmini, D. and Ricciardi, C.} } @Article { RottgerRGVCOHCCBIRKCAYFMM2021, subid = {2224}, title = {New metrology for radon at the environmental level}, journal = {Measurement Science and Technology}, year = {2021}, month = {9}, day = {23}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {radon, metrology, tracer, environmental measurements}, misc2 = {EMPIR 2019: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac298d}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and R{\"o}ttger, S. and Grossi, C. and Vargas, A. and Curcoll, R. and Ot{\'a}hal, P. and Hern{\'a}ndez-Ceballos, M.{\'A}. and Cinelli, G. and Chambers, S. and Barbosa, S.A. and Ioan, M-R. and Radulescu, I. and Kikaj, D. and Chung, E. and Arnold, T. and Yver Kwok, C. and Fuente, M. and Mertes, F. and Morosh, V.} } @Article { ArduiniMSEH2021, subid = {2199}, title = {Development and Evaluation of an Improved Apparatus for Measuring the Emissivity at High Temperatures}, journal = {Sensors}, year = {2021}, month = {9}, day = {17}, volume = {21}, number = {18}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, pages = {6252}, keywords = {emissivity, reflectivity, infrared radiation, high temperature, FTIR-spectrometer, blackbody,uncertainty, X-point, inductive heating, direct radiative method}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21186252}, stag_bib_extends_levelofaccess = {NA}, author = {Arduini, M. and Manara, J. and Stark, T. and Ebert, H-P. and Hartmann, J.} } @Article { TangSJHCMT2021, subid = {2730}, title = {Cavity-immune spectral features in the pulsed superradiant crossover regime}, journal = {Physical Review Research}, year = {2021}, month = {9}, day = {17}, volume = {3}, number = {3}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {superradiance}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.3.033258}, stag_bib_extends_levelofaccess = {NA}, author = {Tang, M. and Sch{\"a}ffer, S.A. and J{\o}rgensen, A.A. and Henriksen, M.R. and Christensen, B.T.R. and M{\"u}ller, J.H. and Thomsen, J.W.} } @Article { LainelaLHCACS2021, subid = {2180}, title = {Toward Unified pH of Saline Solutions}, journal = {Water}, year = {2021}, month = {9}, day = {15}, volume = {13}, number = {18}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {2522}, keywords = {acidity;seawater;pH scales; unified scaleabsolute pHdifferential potentiometric measurementsminimization of liquid junction potential ionic liquid salt bridgesresidual liquid junction potential}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4441}, DOI = {10.3390/w13182522}, stag_bib_extends_levelofaccess = {NA}, author = {Lainela, S. and Leito, I. and Heering, A. and Capitaine, G. and Anes, B. and Cam{\~o}es, F. and Stoica, D.} } @Article { LainelaLHCACS2021_2, subid = {2288}, title = {Toward Unified pH of Saline Solutions}, journal = {Water}, year = {2021}, month = {9}, day = {15}, volume = {13}, number = {18}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {2522}, keywords = {acidity; seawater; pH scales; unified scale; absolute pH; differential potentiometric measurements; minimization of liquid junction potential; ionic liquid salt bridges; residual liquid junction potential}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4441}, DOI = {10.3390/w13182522}, stag_bib_extends_levelofaccess = {NA}, author = {Lainela, S. and Leito, I. and Heering, A. and Capitaine, G. and Anes, B. and Cam{\~o}es, F. and Stoica, D.} } @Article { BuonacorsiSSTKHHRWB2021, subid = {2168}, title = {Non-adiabatic single-electron pumps in a dopant-free GaAs/AlGaAs 2DEG}, journal = {Applied Physics Letters}, year = {2021}, month = {9}, day = {13}, volume = {119}, number = {11}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {114001}, keywords = {Single electron transport, quantum dot, dopant-free GaAs/AlGaAs system, quantum transport, single electron pump}, web_url = {https://arxiv.org/abs/2102.13320}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0062486}, stag_bib_extends_levelofaccess = {NA}, author = {Buonacorsi, B. and Sfigakis, F. and Shetty, A. and Tam, M.C. and Kim, H.S. and Harrigan, S.R. and Hohls, F. and Reimer, M.E. and Wasilewski, Z.R. and Baugh, J.} } @Article { StoreyBPOHWBH2021, subid = {2597}, title = {Single base mutations in the nucleocapsid gene of SARS-CoV-2 affects amplification efficiency of sequence variants and may lead to assay failure}, journal = {Journal of Clinical Virology Plus}, year = {2021}, month = {9}, volume = {1}, number = {3}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {100037}, keywords = {SARS-CoV-2, Nucleocapsid, Mutations, PCR, Failure, Silico}, web_url = {https://www.sciencedirect.com/science/article/pii/S2667038021000296}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2667-0380}, DOI = {10.1016/j.jcvp.2021.100037}, stag_bib_extends_levelofaccess = {NA}, author = {Storey, N. and Brown, J.R. and Pereira, R.P.A. and O'Sullivan, D.M. and Huggett, J.F. and Williams, R. and Breuer, J. and Harris, K.A.} } @Article { TeirLWHBFPL2021, subid = {2254}, title = {In-Line Measurement of the Surface Texture of Rolls Using Long Slender Piezoresistive Microprobes}, journal = {Sensors}, year = {2021}, month = {9}, volume = {21}, number = {17}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {5955}, keywords = {silicon microprobe, high speed, roughness, paper machine roll, metrology}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21175955}, stag_bib_extends_levelofaccess = {NA}, author = {Teir, L. and Lindstedt, T. and Widmaier, T. and Hemming, B. and Brand, U. and Fahrbach, M. and Peiner, E. and Lassila, A.} } @Article { VasilatouWKHISSSWA2021, subid = {2082}, title = {Calibration of optical particle size spectrometers against a primary standard: Counting efficiency profile of the TSI Model 3330 OPS and Grimm 11-D monitor in the particle size range from 300 nm to 10 \(\mu\)m}, journal = {Journal of Aerosol Science}, year = {2021}, month = {9}, volume = {157}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {105818}, keywords = {calibration, aerosol spectrometers, PSL particles, primary standard, particle number concentration}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2021.105818}, stag_bib_extends_levelofaccess = {NA}, author = {Vasilatou, K. and W{\"a}lchli, C. and Koust, S. and Horender, S. and Iida, K. and Sakurai, H. and Schneider, F. and Spielvogel, J. and Wu, T.Y. and Auderset, K.} } @Article { FerreroBCVHYACMT2021, subid = {2146}, title = {Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes}, journal = {Nanomaterials}, year = {2021}, month = {8}, day = {25}, volume = {11}, number = {9}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {2179}, keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11092179}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Barrera, G. and Celegato, F. and Vicentini, M. and H{\"u}seyin, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.} } @Article { SmithHKWPSDS2021, subid = {2242}, title = {High precision integrated photonic thermometry enabled by a transfer printed diamond resonator on GaN waveguide chip}, journal = {Optics Express}, year = {2021}, month = {8}, day = {25}, volume = {29}, number = {18}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {29095}, keywords = {photonic thermometer, diamond micro-disk resonator}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.433607}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, J.A. and Hill, P. and Klitis, C. and Weituschat, L. and Postigo, P.A. and Sorel, M. and Dawson, M.D. and Strain, M.J.} } @Article { SilemekSPHPSRIW2021, subid = {2173}, title = {Rapid safety assessment and mitigation of radiofrequency induced implant heating using small root mean square sensors and the sensor matrix Q s}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {8}, day = {16}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {magnetic resonance imaging, MR safety, implant safety, parallel transmission, sensor-equipped implants, rms sensors}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/mrm.28968}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28968}, stag_bib_extends_levelofaccess = {NA}, author = {Silemek, B. and Seifert, F. and Petzold, J. and Hoffmann, W. and Pfeiffer, H. and Speck, O. and Rose, G. and Ittermann, B. and Winter, L.} } @Article { HodoroabaHPMDT2021, subid = {2142}, title = {Nanoparticle size, shape, and concentration measurement at once – two VAMAS pre-standardization projects ready to start}, journal = {Microscopy and Microanalysis}, year = {2021}, month = {7}, day = {30}, volume = {27}, number = {S1}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {2250-2251}, keywords = {Electron microscopy, Inter-laboratory comparison, Nanoparticles, SiO2, TiO2, VAMAS}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press (CUP)}, language = {30}, ISSN = {1431-9276, 1435-8115}, DOI = {10.1017/S1431927621008126}, stag_bib_extends_levelofaccess = {NA}, author = {Hodoroaba, V-D. and H{\"o}renz, C. and Pellegrino, F. and Maurino, V. and Durand, B. and Tache, O.} } @Article { RadtkeCKLSDAHNVRQLDBUL2021, subid = {2285}, title = {A unified pH scale for all solvents: part I – intention and reasoning (IUPAC Technical Report)}, journal = {Pure and Applied Chemistry}, year = {2021}, month = {7}, day = {30}, volume = {93}, number = {9}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1049-1060}, keywords = {Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {0033-4545, 1365-3075}, DOI = {10.1515/pac-2019-0504}, stag_bib_extends_levelofaccess = {NA}, author = {Radtke, V. and Cam{\~o}es, F. and Krossing, I. and Leito, I. and Stoica, D. and Deleebeeck, L. and Anes, B. and Heering, A. and N{\"a}ykki, T. and Veltz{\'e}, S. and Rozikov{\'a}, M. and Quendera, R. and Liv, L. and D{\'a}niel, N. and Bastkowski, F. and Uysal, E. and Lawrence, N.} } @Article { TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021, subid = {2260}, title = {A multicentre and multi-national evaluation of the accuracy of quantitative Lu-177 SPECT/CT imaging performed within the MRTDosimetry project}, journal = {EJNMMI Physics}, year = {2021}, month = {7}, day = {23}, volume = {8}, number = {1}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, keywords = {Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2197-7364}, DOI = {10.1186/s40658-021-00397-0}, stag_bib_extends_levelofaccess = {NA}, author = {Tran-Gia, J. and Denis-Bacelar, A.M. and Ferreira, K.M. and Robinson, A.P. and Calvert, N. and Fenwick, A.J. and Finocchiaro, D. and Fioroni, F. and Grassi, E. and Heetun, W. and Jewitt, S.J. and Kotzassarlidou, M. and Ljungberg, M. and McGowan, D.R. and Scott, N. and Scuffham, J. and Gleisner, K.S. and Tipping, J. and Wevrett, J. and Bardi{\`e}s, M. and Berenato, S. and Bilas, I. and Bobin, C. and Capogni, M. and Chauvin, M. and COLLINS, S. and Cox, M. and Dabin, J. and D’Arienzo, M. and Gustafsson, J. and Hallam, A. and Kalathas, T. and Kayal, G. and Lorusso, G. and Maringer, F-J. and Morgan, D. and Smyth, V. and Solc, J. and Štemberkov{\'a}, L. and Struelens, L. and Vergara-Gil, A. and Wiedner, H. and Lassmann, M.} } @Article { tenHaveAHPMSL2021, subid = {2120}, title = {Estimation of Static Energy Meter Interference in Waveforms Obtained in On-Site Scenarios}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2021}, month = {7}, day = {12}, volume = {1}, number = {1}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {1-8}, keywords = {Electromagnetic interference (EMI), nonlinear waveforms, on-site survey, static energy meters, time domain.}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2021.3089877}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Azpurua, M.A. and Hartman, T. and Pous, M. and Moonen, N. and Silva, F. and Leferink, F.} } @Article { GeorgievaLHKKRRK2021, subid = {2504}, title = {Absolute calibration of a single-photon avalanche detector using a bright triggered single-photon source based on an InGaAs quantum dot}, journal = {Optics Express}, year = {2021}, month = {7}, volume = {29}, number = {15}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {23500}, keywords = {calibration, single-photon avalanche detector, triggered single-photon source, InGaAs quantum dot}, web_url = {https://opg.optica.org/oe/fulltext.cfm?uri=oe-29-15-23500\&id=453180}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.430680}, stag_bib_extends_levelofaccess = {NA}, author = {Georgieva, H. and L{\'o}pez, M. and Hofer, H. and Kanold, N. and Kaganskiy, A. and Rodt, S. and Reitzenstein, S. and K{\"u}ck, S.} } @Article { CrouzierDDASH2021, subid = {2045}, title = {Influence of electron landing energy on the measurement of the dimensional properties of nanoparticle populations imaged by SEM}, journal = {Ultramicroscopy}, year = {2021}, month = {7}, volume = {226}, number = {July}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {113300}, keywords = {SEMElectron landing energyNanoparticlesDimensional propertiesMetrology}, web_url = {https://reader.elsevier.com/reader/sd/pii/S0304399121000875?token=909C79CE3C3F38B3A66DB9C19F03753326F07A8C27AA6D2752B29C970B6044F466C12F79E394D396CE7598E6F1497E2E\&originRegion=eu-west-1\&originCreation=20210517160957}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2021.113300}, stag_bib_extends_levelofaccess = {NA}, author = {Crouzier, L. and Delvall{\'e}e, A. and Devoille, L. and Artous, S. and Saint-Antonin, F. and Feltin, N.} } @Article { TrimMH2021, subid = {2112}, title = {Spectroradiometer spectral calibration, ISRF shapes, and related uncertainties}, journal = {Applied Optics}, year = {2021}, month = {6}, day = {16}, volume = {60}, number = {18}, number2 = {19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system}, pages = {5405}, keywords = {Spectroradiometer, spectral calibration, ISRF Shapes, Instrument line shape, slit function}, misc2 = {EMPIR 2019: Environment}, publisher = {The Optical Society}, language = {30}, ISSN = {1559-128X, 2155-3165}, DOI = {10.1364/AO.425676}, stag_bib_extends_levelofaccess = {NA}, author = {Trim, S.A. and Mason, K. and Hueni, A.} } @Article { GajjelaHDSSKBMBK2021, subid = {2614}, title = {Structural and compositional analysis of (InGa)(AsSb)/GaAs/GaP Stranski–Krastanov quantum dots}, journal = {Light: Science \& Applications}, year = {2021}, month = {6}, day = {15}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {125}, keywords = {Ga)(AsSb)/GaAs/GaP, Stranski–Krastanov, quantum dots}, web_url = {https://www.nature.com/articles/s41377-021-00564-z}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/s41377-021-00564-z}, stag_bib_extends_levelofaccess = {NA}, author = {Gajjela, R.S.R. and Hendriks, A.L. and Douglas, J.O. and Sala, E.M. and Steindl, P. and Klenovsk{\'y}, P. and Bagot, P.A.J. and Moody, M.P. and Bimberg, D. and Koenraad, P.M.} } @Proceedings { ThompsonRSEHL2021, subid = {2410}, title = {Calibration of X-ray computed tomography for surface topography measurement using metrological characteristics}, journal = {Proceedings 21st euspen International Conference and Exhibition}, year = {2021}, month = {6}, day = {10}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {Metrology, surface topography, metrological characteristics, X-ray computed tomography}, misc2 = {EMPIR 2017: Industry}, event_place = {Online Conference}, event_name = {21st euspen International Conference and Exhibition}, event_date = {07-06-2021 to 10-06-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE21165.pdf}, author = {Thompson, A. and Rodr{\'i}guez-S{\'a}nchez, {\'A}. and Senin, N. and Eifler, M. and Hering, J. and Leach, R.} } @Article { euchaHSHOiL2021, subid = {1981}, title = {Compact differential plane interferometer with in-axis mirror tilt detection}, journal = {Optics and Lasers in Engineering}, year = {2021}, month = {6}, volume = {141}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, pages = {106568}, keywords = {Laser interferometryOptical metrologyDimensional measurementCommon path interferometerDifferential interferometerTilt compensationLarge volume metrology}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0143-8166}, DOI = {10.1016/j.optlaseng.2021.106568}, stag_bib_extends_levelofaccess = {NA}, author = {Rerucha, S. and Hola, M. and Sarbort, M. and Hrabina, J. and Oulehla, J. and Č{\'i}p, O. and Lazar, J.} } @Article { DorosinskiySHL2021, subid = {2121}, title = {Effect of the in-plane field component on the response of the magneto optical indicator film sensors}, journal = {Journal of Magnetism and Magnetic Materials}, year = {2021}, month = {6}, volume = {527}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {167725}, keywords = {Magneto-opticsLocal magnetic field measurementsMetrology}, web_url = {https://www.sciencedirect.com/science/article/pii/S0304885321000019}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-8853}, DOI = {10.1016/j.jmmm.2021.167725}, stag_bib_extends_levelofaccess = {NA}, author = {Dorosinskiy, L. and Sievers, S. and Hu, X. and Lindner, M.} } @Article { QuNLWH2021, subid = {2094}, title = {Measurements of N2, CO2, Ar, O2 and Air Pressure Broadening Coefficients of the HCl P(5) Line in the 1–0 Band Using an Interband Cascade Laser}, journal = {Applied Sciences}, year = {2021}, month = {6}, volume = {11}, number = {11}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, pages = {5190}, keywords = {HCl; hydrogen chloride; collisional broadening; laser spectroscopy; TDLAS}, web_url = {https://www.mdpi.com/2076-3417/11/11/5190}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11115190}, stag_bib_extends_levelofaccess = {NA}, author = {Qu, Z. and Nwaboh, J.A. and Li, G. and Werhahn, O. and Hensey, G.} } @Article { DeleebeeckSNSRVHBLQCS2021, subid = {2183}, title = {Unified pH Measurements of Ethanol, Methanol, and Acetonitrile, and Their Mixtures with Water}, journal = {Sensors}, year = {2021}, month = {6}, volume = {21}, number = {11}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {3935}, keywords = {pHabs; ionic liquid salt bridge; commercial glass electrodes; water–alcohol mixture;non-aqueous pH}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21113935}, stag_bib_extends_levelofaccess = {NA}, author = {Deleebeeck, L. and Snedden, A. and Nagy, D. and Szil{\'a}gyi Nagyn{\'e}, Z. and Rozikov{\'a}, M. and Vičarov{\'a}, M. and Heering, A. and Bastkowski, F. and Leito, I. and Quendera, R. and Cabral, V. and Stoica, D.} } @Proceedings { SchodelKMTHWSPP2021, subid = {2106}, title = {Design and manufacture of a reference interferometer for long-range distance metrology}, journal = {Proceedings of the euspen 21st International Conference \& Exhibition}, year = {2021}, month = {6}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {511-512}, keywords = {Geodetic length instrumentation, closed-frame design, thermal and long-term stability, manual positioning system, precision assembly}, misc2 = {EMPIR 2018: SI Broader Scope}, event_place = {Copenhagen, DK}, event_name = {euspen 21st International Conference \& Exhibition}, event_date = {07-06-2021 to 11-06-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE21222.pdf}, author = {Sch{\"o}del, R. and K{\"o}chert, P. and Meyer, T. and Truong, D. and Huismann, J. and Weinrich, S. and Schmaljohann, F. and Pilarski, F. and Pollinger, F.} } @Article { KnotekBCKHUKS2021, subid = {2369}, title = {Measurements of water consumption for the development of new test regimes for domestic water meters}, journal = {Flow Measurement and Instrumentation}, year = {2021}, month = {6}, volume = {79}, number = {-}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, pages = {101963}, keywords = {water consumption, consumption measurement, water meters, dynamic loads, billing}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2021.101963}, stag_bib_extends_levelofaccess = {NA}, author = {Knotek, S. and Benkova, M. and Christophersen, N. and Kondrup, J.B. and Haack, S. and Unsal, B. and Kroner, C. and Schumann, D.} } @Techreport { QuintanillaCrespoZHMMDHW2021, subid = {2027}, title = {Report on the technical requirements for the electrical power measurements and definition of the measurands for nacelle test benches}, journal = {Zenodo}, year = {2021}, month = {5}, number2 = {19ENG08: WindEFCY: Traceable mechanical and electrical power measurement for efficiency determination of wind turbines}, pages = {1-25}, keywords = {WindEFCY, EMPIR, Horizon2020, 10ENG08, Nacelle efficiency, Electrical power measurement}, web_url = {https://zenodo.org/record/4726089\#.YJjxR6FCRmE}, misc2 = {EMPIR 2019: Energy}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.4726089}, stag_bib_extends_levelofaccess = {NA}, author = {Quintanilla Crespo, J. and Zweiffel, M. and Heller, M. and Mester, C. and Mohns, E. and Dubowik, A. and H{\"a}llstr{\"o}m, J. and Weidinger, P.} } @Article { KazemipourHWHRSAGZ2021, subid = {2048}, title = {Standard Load Method: A New Calibration Technique for Material Characterization at Terahertz Frequencies}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, month = {5}, volume = {70}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1007310}, keywords = {Material characterization, measurement uncertainty, parameter extraction, standard load, vector network analyzer (VNA) time gating}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2021.3077660}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Hudlicka, M. and R{\"u}fenacht, J. and Stalder, D. and Allal, D. and G{\"a}umann, G. and Zeier, M.} } @Article { GeorgievaMRHGDGLK2021, subid = {2092}, title = {Detection of ultra-weak laser pulses by free-running single-photon detectors: Modeling dead time and dark counts effects}, journal = {Applied Physics Letters}, year = {2021}, month = {4}, day = {26}, volume = {118}, number = {17}, number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware}, pages = {174002}, keywords = {Quantum commutation, QKD, Non-Classical Light Emitters, Single-Photon Detectors, RadiometryMetrology for Quantum Technologies}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0046014}, stag_bib_extends_levelofaccess = {NA}, author = {Georgieva, H. and Meda, A. and Raupach, S.M.F. and Hofer, H. and Gramegna, M. and Degiovanni, I.P. and Genovese, M. and L{\'o}pez, M. and K{\"u}ck, S.} } @Article { FleischerHSPZH2021, subid = {2431}, title = {Absolute ¹³C/¹²C isotope amount ratio for Vienna PeeDee Belemnite from infrared absorption spectroscopy}, journal = {Nature Physics}, year = {2021}, month = {4}, day = {26}, volume = {17}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {889-893}, keywords = {Characterization and analytical techniques, Near-infrared spectroscopy}, web_url = {https://discovery.ucl.ac.uk/id/eprint/10131639/}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2481}, DOI = {10.1038/s41567-021-01226-y}, stag_bib_extends_levelofaccess = {NA}, author = {Fleischer, A.J. and Hongming, Y. and Srivastava, A. and Polyansky, O. and Zobov, N.F. and Hodges, J.T.} } @Article { GanikiRJKH2021, subid = {2034}, title = {Validating an Evaporative Calibrator for Gaseous Oxidized Mercury}, journal = {Sensors}, year = {2021}, month = {4}, volume = {21}, number = {7}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {2501}, keywords = {Gaseous oxidized mercury, calibration, traceability, 197-Hg}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21072501}, stag_bib_extends_levelofaccess = {NA}, author = {Gačnik, J. and Živković, I. and Ribeiro Guevara, S. and Jaćimović, R. and Kotnik, J. and Horvat, M.} } @Article { HartmanGML2021, subid = {2083}, title = {Electromagnetic Compatible Energy Measurements Using the Orthogonality of Nonfundamental Power Components}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2021}, month = {4}, volume = {63}, number = {2}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {598-605}, keywords = {Conducted immunity and emissions, EMC measurements, low frequency EMC, power electronics, powerquality}, tags = {SEG}, web_url = {https://research.utwente.nl/en/publications/electromagnetic-compatible-energy-measurements-using-the-orthogon}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2020.3019974}, stag_bib_extends_levelofaccess = {NA}, author = {Hartman, T. and Grootjans, R. and Moonen, N. and Leferink, F.} } @Article { deKromBZMBiGFKHE2021, subid = {2071}, title = {Comparability of calibration strategies for measuring mercury concentrations in gas emission sources and the atmosphere}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {3}, day = {25}, volume = {14}, number = {3}, number2 = {19NRM03: SI-Hg: Metrology for traceable protocols for elemental and oxidised mercury concentrations}, pages = {2317-2326}, keywords = {Mercury, Metrology, Calibration, SI-traceability, Environmental}, web_url = {https://amt.copernicus.org/articles/14/2317/2021/amt-14-2317-2021.html}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-2317-2021}, stag_bib_extends_levelofaccess = {NA}, author = {de Krom, I. and Bavius, W. and Ziel, R. and McGhee, E.A. and Brown, R.J.C. and Živković, I. and Gačnik, J. and Fajon, V. and Kotnik, J. and Horvat, M. and Ent, H.} } @Article { SchmidtGNBvZMBSHWR2021, subid = {2616}, title = {Bimodal behavior of microlasers investigated with a two-channel photon-number-resolving transition-edge sensor system}, journal = {Physical Review Research}, year = {2021}, month = {3}, day = {19}, volume = {3}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {013263}, keywords = {microlaser, transition-edge sensor, photon statistics, photon counting, nanophotonics}, web_url = {https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.3.013263}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.3.013263}, stag_bib_extends_levelofaccess = {NA}, author = {Schmidt, M. and Grothe, I.H. and Neumeier, S. and Bremer, L. and von Helversen, M. and Zent, W. and Melcher, B. and Beyer, J. and Schneider, C. and H{\"o}fling, S. and Wiersig, J. and Reitzenstein, S.} } @Article { CliffordMFHHKPRSP2021, subid = {2013}, title = {The importance of international standards for the graphene community}, journal = {Nature Reviews Physics}, year = {2021}, month = {3}, day = {15}, volume = {3}, number = {4}, number2 = {19NRM04: ISO-G-SCoPe: Standardisation of structural and chemical properties of graphene}, pages = {233-235}, keywords = {graphene, standards, ISO, IEC, 2D materials, standardisation}, web_url = {https://www.nature.com/articles/s42254-021-00278-6.epdf?sharing_token=_RIs5V6Xm7w_YnHU36ykhtRgN0jAjWel9jnR3ZoTv0NPpzni0dDHfaSDxkLVCOVw58FsyO6wELZUo5O32Eh0l-PBSDtirSTDnDrgEzBq40IQw69h7pcwLtLVCw2MuYIUVmHN0-WNNYkKy_jgkRmTZPKe2I2wUTrJd-QYBiq-ZrQ\%3D}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2522-5820}, DOI = {dx.doi.org/10.1038/s42254-021-00278-6}, stag_bib_extends_levelofaccess = {NA}, author = {Clifford, C.A. and Martins Ferreira, E.H. and Fujimoto, T. and Herrmann, J. and Hight Walker, A.R. and Koltsov, D. and Punckt, C. and Ren, L. and Smallwood, G.J. and Pollard, A.J.} } @Article { GarberoglioH2021, subid = {1991}, title = {Path-integral calculation of the fourth virial coefficient of helium isotopes}, journal = {The Journal of Chemical Physics}, year = {2021}, month = {3}, day = {14}, volume = {154}, number = {10}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {104107}, keywords = {helium; virial coefficient; path integral}, web_url = {https://arxiv.org/abs/2101.02624}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-9606, 1089-7690}, DOI = {10.1063/5.0043446}, stag_bib_extends_levelofaccess = {NA}, author = {Garberoglio, G. and Harvey, A.H.} } @Proceedings { LoslerEH2021, subid = {2405}, title = {On the Impact of the Coordinate Representation onto the Estimates in Least-Squares Adjustment}, journal = {Proceedings of the 25th European VLBI for Geodesy and Astrometry (EVGA) Working Meeting}, year = {2021}, month = {3}, day = {14}, volume = {2021}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {49-55}, keywords = {Paraboloid, Least-Squares Adjustment, Sequential Quadratic Programming, Surface Analysis, Cartesian Coordinates, Polar Coordinates, GeoMetre}, web_url = {https://zenodo.org/record/5811948}, misc2 = {EMPIR 2018: SI Broader Scope}, event_place = {Gothenburg, Sweden}, event_name = {25th European VLBI for Geodesy and Astrometry (EVGA) Working Meeting}, event_date = {14-03-2021 to 18-03-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.5811948}, author = {L{\"o}sler, M. and Eschelbach, C. and Holst, C} } @Article { FailleauFBRHH2021, subid = {1993}, title = {Metal-carbon eutectic high temperature fixed points for in-situ calibration of radiation thermometers}, journal = {High Temperatures-High Pressures}, year = {2021}, month = {3}, volume = {50}, number = {2}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, pages = {149-165}, keywords = {Thermal Diffusivity, High Temperature, Radiation Thermometry, Fixed-Point}, web_url = {https://www.oldcitypublishing.com/journals/hthp-home/hthp-issue-contents/hthp-volume-50-number-2-2021/19302-2/}, misc2 = {EMPIR 2017: Industry}, publisher = {Old City Publishing}, language = {30}, ISSN = {1472-3441}, DOI = {10.32908/hthp.v50.1013}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Fleurence, N. and Beaumont, O. and Razouk, R. and Hameury, J. and Hay, B.} } @Article { HuggettML2021, subid = {2682}, title = {COVID-19 new diagnostics development: novel detection methods for SARS-CoV-2 infection and considerations for their translation to routine use}, journal = {Current Opinion in Pulmonary Medicine}, year = {2021}, month = {3}, volume = {27}, number = {3}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {155-162}, keywords = {accuracy, diagnosis, diagnostics, point of care, SARS-CoV-2}, web_url = {https://journals.lww.com/co-pulmonarymedicine/Fulltext/2021/05000/COVID_19_new_diagnostics_development__novel.4.aspx}, misc2 = {EMPIR 2018: Health}, publisher = {Ovid Technologies (Wolters Kluwer Health)}, language = {30}, ISSN = {1070-5287, 1531-6971}, DOI = {10.1097/MCP.0000000000000768}, stag_bib_extends_levelofaccess = {NA}, author = {Huggett, J.F. and Moran-Gilad, J. and Lee, J.E.} } @Article { RuhleKH2021, subid = {2046}, title = {Workflow towards automated segmentation of agglomerated, non-spherical particles from electron microscopy images using artificial neural networks}, journal = {Scientific Reports}, year = {2021}, month = {3}, volume = {11}, number = {1}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {10}, keywords = {Artificial intelligence;Automated image analysis;Electron microscopy;Image segmentation;Neural networks}, web_url = {https://www.nature.com/articles/s41598-021-84287-6.pdf}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-84287-6}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"u}hle, B. and Krumrey, J.F. and Hodoroaba, V-D.} } @Article { HaveML2021, subid = {2087}, title = {Time Domain Analysis of Current Transducer Responses Using Impulsive Signals}, journal = {IEEE Letters on Electromagnetic Compatibility Practice and Applications}, year = {2021}, month = {3}, volume = {3}, number = {1}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {19-23}, keywords = {Current transducer, Impulsive signals, Nonlinear behavior, Time domain parameters, Wide-band}, web_url = {https://research.utwente.nl/en/publications/time-domain-analysis-of-current-transducer-responses-using-impuls}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2637-6423}, DOI = {10.1109/LEMCPA.2020.3031986}, stag_bib_extends_levelofaccess = {NA}, author = {Have, B. t. and Moonen, N. and Leferink, F.} } @Manual { BrunaRomeroPLHFCBAZZG2021, subid = {1907}, title = {Best practice guide for the assessment of EMF exposure from vehicle Wireless Power Transfer systems}, year = {2021}, month = {2}, day = {17}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, keywords = {Dosimetry, Guidelines, Magnetic field measurements, Magnetic field calculation, Numerical models, Uncertainty, Wireless Power Transfer, Electric Vehicle}, web_url = {https://www.micev.eu/theme/inrim/assets/doc/BPG_Micev_2021.pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {INRIM}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISBN: 978-88-945324-1-8}, author = {Bruna Romero, J. and Pichon, L. and Laporta, E. and Harmon, S. and Freschi, F. and Clarke, B. and Bottauscio, O. and Ankarson, P. and Zilberti, L. and Zucca, M. and Guilizzoni, R.} } @Article { FernandezScarioniBCSHALRCKS2021, subid = {2055}, title = {Thermoelectric Signature of Individual Skyrmions}, journal = {Physical Review Letters}, year = {2021}, month = {2}, day = {16}, volume = {126}, number = {7}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {1-6/077202}, keywords = {Magnetism, Nernst effect, Skyrmions, Thermomagnetic effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.077202}, stag_bib_extends_levelofaccess = {NA}, author = {Fern{\'a}ndez Scarioni, A. and Barton, C. and Corte-Le{\'o}n, H. and Sievers, S. and Hu, X. and Ajejas, F. and Legrand, W. and Reyren, N. and Cros, V. and Kazakova, O. and Schumacher, H.W.} } @Article { HorenderAQSNDSWAKGV2021, subid = {1901}, title = {Facility for production of ambient-like model aerosols (PALMA) in the laboratory: application in the intercomparison of automated PM monitors with the reference gravimetric method}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {2}, day = {16}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, keywords = {ambient-like aerosols, particulate matter, calibration , PM monitors}, web_url = {https://amt.copernicus.org/articles/14/1225/2021/amt-14-1225-2021.html}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.5194/amt-14-1225-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Horender, S. and Auderset, K. and Quincey, P. and Seeger, S. and Nielsen Skov, S. and Dirscherl, K. and Smith, T.O.M. and Williams, K. and Aegerter, C.C. and Kalbermatter, D.M. and Gaie-Levrel, F. and Vasilatou, K.} } @Article { LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021, subid = {2093}, title = {Roadmap on quantum nanotechnologies}, journal = {Nanotechnology}, year = {2021}, month = {2}, volume = {32}, number = {16}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {162003}, keywords = {Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/abb333}, stag_bib_extends_levelofaccess = {NA}, author = {Laucht, A. and Hohls, F. and Ubbelohde, N. and Fernando Gonzalez-Zalba, M. and Reilly, D.J. and Stobbe, S. and Schr{\"o}der, T. and Scarlino, P. and Koski, J.V. and Dzurak, A. and Yang, C-H. and Yoneda, J. and Kuemmeth, F. and Bluhm, H. and Pla, J. and Hill, C. and Salfi, J. and Oiwa, A. and Muhonen, J.T. and Verhagen, E. and LaHaye, M.D. and Kim, H.H. and Tsen, A.W. and Culcer, D. and Geresdi, A. and Mol, J.A. and Mohan, V. and Jain, P.K. and Baugh, J.} } @Article { ModiniCBIBPFEHMLMG2021, subid = {2010}, title = {Detailed characterization of the CAPS single-scattering albedo monitor (CAPS PMssa) as a field-deployable instrument for measuring aerosol light absorption with the extinction-minus-scattering method}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {2}, volume = {14}, number = {2}, number2 = {16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols}, pages = {819-851}, keywords = {miniCAST 5201 black carbon (BC) generator; particle morphology; nanostructure; optical properties; photoacoustic absorption coefficient}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-819-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Modini, R.L. and Corbin, J.C. and Brem, B.T. and Irwin, M. and Bert{\`o}, M. and Pileci, R.E. and Fetfatzis, P. and Eleftheriadis, K. and Henzing, B. and Moerman, M.M. and Liu, F. and M{\"u}ller, T. and Gysel-Beer, M.} } @Article { ChenSDOLHCC2021, subid = {2425}, title = {Quantitative Assessment of Carrier Density by Cathodoluminescence. I. GaAs thin films and modeling}, journal = {Phys. Rev. Applied}, year = {2021}, month = {2}, volume = {15}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {024006}, keywords = {GaAs, thin films, CL, doping, nanostructures}, misc2 = {EMPIR 2019: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1909.05598}, author = {Chen, H.-L. and Scaccabarozzi, A. and De L{\'e}pinau, R. and Oehler, F. and Lemaıtre, A. and Harmand, J.-C. and Cattoni, A. and Collin, S.} } @Article { ChenDSOHCC2021, subid = {2475}, title = {Quantitative Assessment of Carrier Density by Cathodoluminescence. II. GaAs nanowires}, journal = {Phys. Rev. Applied}, year = {2021}, month = {2}, volume = {15}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {024007}, keywords = {GaAs nanowires, high-resolution cathodoluminescence (CL) mapping}, web_url = {https://journals.aps.org/prapplied/pdf/10.1103/PhysRevApplied.15.024007}, misc2 = {EMPIR 2019: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1909.05602}, author = {Chen, H.-L. and De L{\'e}pinau, R. and Scaccabarozzi, A. and Oehler, F. and Harmand, J.-C. and Cattoni, A. and Collin, S.} } @Article { SobanskiTSLKIPHE2021, subid = {1916}, title = {Advances in High-Precision NO2 Measurement by Quantum Cascade Laser Absorption Spectroscopy}, journal = {Applied Sciences}, year = {2021}, month = {1}, day = {29}, volume = {11}, number = {3}, number2 = {16ENV05: MetNO2: Metrology for nitrogen dioxide}, pages = {1222}, keywords = {air pollution; trace gas; nitrogen dioxide; laser spectroscopy; mid-infrared; quantum cascade laser; selective detection}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11031222}, stag_bib_extends_levelofaccess = {NA}, author = {Sobanski, N. and Tuzson, B. and Scheidegger, P. and Looser, H. and Kupferschmid, A. and Iturrate, M. and Pascale, C. and H{\"u}glin, C. and Emmenegger, L.} } @Article { ArduinoZHZBCB2021, subid = {1867}, title = {Heating of hip joint implants in MRI: The combined effect of RF and switched‐gradient fields}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {1}, day = {22}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {gradient coil heating, hip prosthesis, MRI safety, numerical simulation, radiofrequency heating}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28666}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Zanovello, U. and Hand, J. and Zilberti, L. and Br{\"u}hl, R. and Chiampi, M. and Bottauscio, O.} } @Article { SmithHEPNMWP2021, subid = {1900}, title = {Traceability of the Sentinel-3 SLSTR Level-1 Infrared Radiometric Processing}, journal = {Remote Sensing}, year = {2021}, month = {1}, day = {22}, volume = {13}, number = {3}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {374}, keywords = {calibration, uncertainty, traceability, SLSTR, Sentinel-3, temperature, blackbody, radiometer, data processing, Earth observation, metrology}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs13030374}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, D. and Hunt, S.E. and Etxaluze, M. and Peters, D. and Nightingale, T. and Mittaz, J. and Woolliams, E.R. and Polehampton, E.} } @Proceedings { SimonotHSCLO2021, subid = {2396}, title = {Study and simulations of speckle effects on BRDF measurements at very high angular resolution}, journal = {Electronic Imaging}, year = {2021}, month = {1}, day = {18}, volume = {2021}, number = {140-1-140-}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {1-6}, keywords = {BRDF MeasurementsSpeckleBRDF SimulationsMetrology of appearanceGloss}, web_url = {https://www.ingentaconnect.com/content/ist/ei/2021/00002021/00000005/art00006}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Society for Imaging Science and Technology}, event_place = {Electronic Imaging 2021}, event_name = {Electronic Imaging 2021}, event_date = {16-01-2021 to 29-01-2021}, language = {30}, ISSN = {2470-1173}, stag_bib_extends_levelofaccess = {NA}, author = {Simonot, L. and Hebert, M. and Sortais, Y. and Chavel, P. and Labardens, T. and Obein, G.} } @Article { PoppeLHWSKP2021, subid = {1843}, title = {Ion collection efficiency of ionization chambers in ultra‐high dose‐per‐pulse electron beams}, journal = {Medical Physics}, year = {2021}, month = {1}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, FLASH radiation therapy, ionization chambers, ion collection efficiency}, misc2 = {EMPIR 2018: Health}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.14620}, stag_bib_extends_levelofaccess = {NA}, author = {Poppe, B. and Looe, H.K. and Hackel, T. and Weidner, J. and Sch{\"u}ller, A. and Kranzer, R. and Poppinga, D.} } @Article { DorscherHSLBLSPL2021, subid = {1846}, title = {Optical frequency ratio of a 171Yb+ single-ion clock and a 87Sr lattice clock}, journal = {Metrologia}, year = {2021}, month = {1}, volume = {58}, number = {1}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {015005}, keywords = {optical clock, ion clock, ytterbium, optical lattice clock, strontium, optical clock comparison, frequency ratio}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abc86f}, stag_bib_extends_levelofaccess = {NA}, author = {D{\"o}rscher, S. and Huntemann, N. and Schwarz, R. and Lange, R. and Benkler, E. and Lipphardt, B. and Sterr, U. and Peik, E. and Lisdat, C.} } @Article { LangeHRSSLTWP2021, subid = {1854}, title = {Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons}, journal = {Physical Review Letters}, year = {2021}, month = {1}, volume = {126}, number = {1}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {011102}, keywords = {Optical clocks, Tests of fundamental principles, Time \& frequency standards, Quantum metrology}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.011102}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Rahm, J.M. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Weyers, S. and Peik, E.} } @Article { LangeHRSSLTWP20210, subid = {1854}, title = {Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons}, journal = {Physical Review Letters}, year = {2021}, month = {1}, volume = {126}, number = {1}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {011102}, keywords = {Optical clocks, Tests of fundamental principles, Time \& frequency standards, Quantum metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.011102}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Rahm, J.M. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Weyers, S. and Peik, E.} } @Article { BagherRENWMZDHBL2021, subid = {1796}, title = {Crosstalk between Mast Cells and Lung Fibroblasts Is Modified by Alveolar Extracellular Matrix and Influences Epithelial Migration}, journal = {International Journal of Molecular Sciences}, year = {2021}, month = {1}, volume = {22}, number = {2}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, pages = {506}, keywords = {lung fibroblasts, mast cells, epithelial cells, extracellular matrix, IL-6; tryptase, vascular endothelial growth factor, hepatocyte growth factor, idiopathic pulmonary fibrosis}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {1422-0067}, DOI = {10.3390/ijms22020506}, stag_bib_extends_levelofaccess = {NA}, author = {Bagher, M. and Rosmark, O. and Elowsson Rendin, L. and Nybom, A. and Wasserstrom, S. and M{\"u}ller, C. and Zhou, X-H. and Dellgren, G. and Hallgren, O. and Bjermer, L. and Larsson-Callerfelt, A-K.} } @Article { HaoLG2021, subid = {2060}, title = {Coupled Resonator Calorimeter for Particle Detection}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, volume = {70}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {1-6}, keywords = {Resonant frequency, Electromagnetic heating, Temperature dependence, Permittivity, Dielectrics, Temperature distribution, Crystals}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2021.3062171}, stag_bib_extends_levelofaccess = {NA}, author = {Hao, L. and Lorusso, G. and Gallop, J.} } @Proceedings { JiangPSHHMDOMPG2021, subid = {2553}, title = {Prequalification of Capacitors for High-Precision Voltage Dividers}, journal = {ISH 2021}, year = {2021}, number2 = {19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes}, keywords = {Voltage Divider, RCR Divider, Capacitor}, tags = {SEG}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {ISH 2021}, event_place = {online}, event_name = {22nd International Symposium on High Voltage Engineering}, event_date = {21-11-2021 to 25-11-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6073729}, author = {Jiang, H. and Pischler, O. and Schichler, U. and Havunen, J. and H{\"a}llstr{\"o}m, J. and Merev, A. and Dedeoğlu, S. and {\"O}zer, S. and Meisner, J. and Passon, S. and Gerdinand, F.} } @Article { TiainenVHH2021, subid = {2075}, title = {Analysis of total rotor runout components with multi-probe roundness measurement method}, journal = {Measurement}, year = {2021}, volume = {179}, number = {109422}, number2 = {19ENG07: Met4Wind: Metrology for enhanced reliability and efficiency of wind energy systems}, pages = {109422}, keywords = {Relative shaft displacement,Runout, Roundness, Shaft geometry, Electrical runout,Mechanical runout, Multi-probe roundness}, web_url = {https://www.sciencedirect.com/science/article/pii/S0263224121004115}, misc2 = {EMPIR 2019: Energy}, publisher = {Elsevier}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2021.109422}, stag_bib_extends_levelofaccess = {NA}, author = {Tiainen, T. and Viitala, R. and Holopainen, T.P. and Hemming, B.} } @Article { VentonHSSA2021, subid = {2249}, title = {Robustness of convolutional neural networks to physiological electrocardiogram noise}, journal = {Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences}, year = {2021}, volume = {379}, number = {2212}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {-}, keywords = {electrocardiogram, physiological noise, robustness, deep learning, convolutional neural network, symmetric projection attractor reconstruction}, web_url = {https://royalsocietypublishing.org/doi/10.1098/rsta.2020.0262}, misc2 = {EMPIR 2018: Health}, publisher = {Royal Society Publishing}, language = {30}, ISSN = {-}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1098/rsta.2020.0262}, author = {Venton, J. and Harris, P.M. and Sundar, A. and Smith, N.A.S. and Aston, P.J. } } @Article { BehrEBGHKKLPPS2020, subid = {1857}, title = {A four-terminal-pair Josephson impedance bridge combined with a graphene quantized Hall resistance}, journal = {Measurement Science and Technology}, year = {2021}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, keywords = {impedance measurement,quantized Hall resistor,coaxial impedance bridge,graphene,Josephson arbitrary waveform synthesizer}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/abcff3/pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abcff3}, stag_bib_extends_levelofaccess = {NA}, author = {Bauer, S. and Elmquist, R. and Behr, R. and Goetz, M. and Herick, J. and Kieler, O.F. and Kruskopf, M. and Lee, J. and Palafox, L. and Pimsut, Y. and Schurr, J.} } @Article { HaveAHPMSL2021, subid = {2088}, title = {Waveform Model to Characterize Time-Domain Pulses Resulting in EMI on Static Energy Meters}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2021}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {1-8}, keywords = {Electromagnetic interference (EMI), metering errors, nonlinear, static energy meters, time-domain, waveformmodel}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2021.3062948}, stag_bib_extends_levelofaccess = {NA}, author = {Have, B.t. and Azpurua, M.A. and Hartman, T. and Pous, M. and Moonen, N. and Silva, F. and Leferink, F.} } @Proceedings { KhanbabaeeRBRFHZTLdBGGCA2021, subid = {2377}, title = {SUPPORT FOR A EUROPEAN METROLOGY NETWORK ON RELIABLE RADIATION PROTECTION: GAPS IN RADIATION PROTECTION AND RELATED METROLOGY}, journal = {RAD Conference Proceedings}, year = {2021}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {Activity standards, new operational quantities in radiation protection, type testing, calibration, radon,reference field, pulsed radiation, dosimetry, standards, radiological emergency response}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {RAD Centre}, event_place = {Herceg Novi, Montenegro}, event_name = {9th international conference on Radiation in various fields of research}, event_date = {14-06-2021 to 18-06-2021}, language = {30}, DOI = {10.21175/RadProc.2021.04}, stag_bib_extends_levelofaccess = {NA}, author = {Khanbabaee, B. and R{\"o}ttger, A. and Behrens, R. and R{\"o}ttger, S. and Feige, S. and Hupe, O. and Zutz, H. and Toroi, P. and Leonard, P. and de la Fuente Rosales, L. and Burgess, P. and Gressier, V. and Guti{\'e}rrez Villanueva, J–L. and Cruz Su{\'a}rez, R. and Arnold, D.} } @Article { FergusonFLBHPR2021, subid = {2378}, title = {Metrology and Standardization of High Speed Pluggable Optical Interconnects}, journal = {Proceedings of the 9th International Conference on Photonics, Optics and Laser Technology}, year = {2021}, volume = {PHOTOPTICS}, number = {PHOTOPTICS}, number2 = {19SIP05: TTPWC: Technology Transfer of Photonic Waveguide Characterisation}, pages = {63-67}, keywords = {Electro Optical Circuit Board (EOCB), Polymer Waveguides, Attenuation, Encircled Flux, BER.}, web_url = {https://zenodo.org/record/5777190}, misc2 = {EMPIR 2019: Support for Impact}, publisher = {SCITEPRESS - Science and Technology Publications}, language = {30}, ISSN = {2184-4364}, DOI = {10.5220/0010171900630067}, stag_bib_extends_levelofaccess = {NA}, author = {Ferguson, R. and Fatadin, I. and Liu, K-M. and Barbeito, I. and Hart, C. and Pitwon, R. and Robinson, D.} } @Article { ForssenSSJBHAZ2020, subid = {1786}, title = {A transportable refractometer for assessment of pressure in the kPa range with ppm level precision}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {287-292}, keywords = {Refractometry; Pressure; Gas Modulation, GAMOR; Transportable}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-59}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.986}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Szabo, D. and J{\"o}nsson, G. and Bjerling, M. and Hausmaninger, T. and Axner, O. and Zelan, M.} } @Article { ZelenkaASHKPPDZCM2020, subid = {2108}, title = {Improvement of the realisation of the mass scale}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {19RPT02: RealMass: Improvement of the realisation of the mass scale}, pages = {4}, keywords = {Mass realisation, kilogram, multiplies and sub-multiplies, subdivision and multiplication, OIML R111}, web_url = {https://acta.imeko.org/index.php/acta-imeko/index}, misc2 = {EMPIR 2019: Research Potential}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.928}, stag_bib_extends_levelofaccess = {NA}, author = {Zelenka, Z. and Alisic, S. and Stoilkovska, B. and Hanrahan, R. and Kolozinsky, I. and Popa, G. and Pantic, D. and Dikov, V. and Zůda, J. and Coenegrachts, M. and Malengo, A.} } @Article { ChouhanJHBGSBH2020, subid = {2033}, title = {Emerging tri‐s‐triazine‐based graphitic carbon nitride: A potential signal‐transducing nanostructured material for sensor applications}, journal = {Nano Select}, year = {2020}, month = {12}, day = {30}, volume = {2}, number = {4}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {712-743}, keywords = {sorbent traps, tri‐s‐triazine‐based graphitic carbon nitride, nanostructured material, sonsors, mercury}, misc2 = {EMPIR 2016: Environment}, publisher = {Wiley}, language = {30}, ISSN = {2688-4011, 2688-4011}, DOI = {10.1002/nano.202000228}, stag_bib_extends_levelofaccess = {NA}, author = {Chouhan, R.S. and Jerman, I. and Heath, D. and Bohm, S. and Gandhi, S. and Sadhu, V. and Baker, S. and Horvat, M.} } @Article { FerreroFSSSCH2020, subid = {1778}, title = {Fundamental scattering quantities for the determination of reflectance and transmittance}, journal = {Optics Express}, year = {2020}, month = {12}, day = {22}, volume = {29}, number = {1}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {219}, keywords = {BRDF, BSSRDF, reflectance, transmittance}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.410225}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Frisvad, J.R. and Simonot, L. and Santaf{\'e}, P. and Schirmacher, A. and Campos, J. and Hebert, M.} } @Article { BowdenVHSH2020, subid = {2729}, title = {Improving the Q Factor of an Optical Atomic Clock Using Quantum Nondemolition Measurement}, journal = {Physical Review X}, year = {2020}, month = {12}, day = {15}, volume = {10}, number = {4}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Atomic and Molecular Physics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2160-3308}, DOI = {10.1103/PhysRevX.10.041052}, stag_bib_extends_levelofaccess = {NA}, author = {Bowden, W. and Vianello, A. and Hill, I.R. and Schioppo, M. and Hobson, R.} } @Proceedings { ElgGAMMHHLMPMSV2020, subid = {2062}, title = {Research Project EMPIR 19ENG02 Future Energy}, journal = {VDE High Voltage Technology 2020; ETG-Symposium}, year = {2020}, month = {12}, volume = {N/A}, number = {N/A}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {N/A}, keywords = {UHVDC, traceability, Lightning Impulse, linearity, voltage dependence, HVAC, DC partial discharge, GIS Partial discharge}, tags = {SEG}, web_url = {https://ieeexplore.ieee.org/servlet/opac?punumber=9275417}, misc2 = {EMPIR 2019: Energy}, publisher = {VDE}, event_place = {Berlin, Germany}, event_name = {VDE High Voltage Technology 2020; ETG-Symposium}, event_date = {09-11-2020 to 11-11-2020}, language = {30}, ISBN = {978-3-8007-5353-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4769653}, author = {Elg, A-P. and Garnacho, F. and Agazar, M. and Meisner, J. and Merev, A. and Houtzager, E. and H{\"a}llstr{\"o}m, J. and Lahti, K. and Mier Escurra, C. and Platinero, C. and Micand, T. and Steiner, T. and Voss, A.} } @Article { MarschallHWHRKE2020, subid = {1801}, title = {Compressed FTIR spectroscopy using low-rank matrix reconstruction}, journal = {Optics Express}, year = {2020}, month = {12}, volume = {28}, number = {26}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {38762}, keywords = {Fourier transform infrared; FTIR spectroscopy; low-rank matrix reconstruction}, web_url = {https://www.osapublishing.org/oe/fulltext.cfm?uri=oe-28-26-38762\&id=444648}, misc2 = {EMPIR 2018: Health}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.404959}, stag_bib_extends_levelofaccess = {NA}, author = {Marschall, M. and Hornemann, A. and W{\"u}bbeler, G. and Hoehl, A. and Ruhl, E. and K{\"a}stner, B. and Elster, C.} } @Article { SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020, subid = {1841}, title = {The European Joint Research Project UHDpulse – Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, journal = {Physica Medica}, year = {2020}, month = {12}, volume = {80}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {134-150}, keywords = {Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2020.09.020}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}ller, A. and Heinrich, S. and Fouillade, C. and Subiel, A. and De Marzi, L. and Romano, F. and Peier, P. and Trachsel, M. and Fleta, C. and Kranzer, R. and Caresana, M. and Salvador, S. and Busold, S. and Sch{\"o}nfeld, A. and McEwen, M. and Gomez, F. and Solc, J. and Bailat, C. and Linhart, V. and Jakubek, J. and Pawelke, J. and Borghesi, M. and Kapsch, R-P. and Knyziak, A. and Boso, A. and Olsovcova, V. and Kottler, C. and Poppinga, D. and Ambrozova, I. and Schmitzer, C-S. and Rossomme, S. and Vozenin, M-C.} } @Article { HancockDBLBTDBHBM2020, subid = {1894}, title = {Arbitrarily large tomography with iterative algorithms on multiple GPUs using the TIGRE toolbox}, journal = {Journal of Parallel and Distributed Computing}, year = {2020}, month = {12}, volume = {146}, number = {1}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {52-63}, keywords = {Computed TomographyIterative reconstructionSoftwaremulti-GPU}, web_url = {https://arxiv.org/abs/1905.03748}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0743-7315}, DOI = {10.1016/j.jpdc.2020.07.004}, stag_bib_extends_levelofaccess = {NA}, author = {Hancock, S. and Dosanjh, M. and Biguri, A. and Lindroos, R. and Bryll, R. and Towsyfyan, H. and Deyhle, H. and Blumensath, T. and Harrane, I.E.K. and Boardman, R. and Mavrogordato, M.} } @Article { MeddingsHOLRNSHRGP2020, subid = {1986}, title = {Application of electrochemical impedance spectroscopy to commercial Li-ion cells: A review}, journal = {Journal of Power Sources}, year = {2020}, month = {12}, volume = {480}, number2 = {17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications}, pages = {228742}, keywords = {Lithium-ion batteryEISInterpretationValidationMetrologyDegradation}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0378-7753}, DOI = {10.1016/j.jpowsour.2020.228742}, stag_bib_extends_levelofaccess = {NA}, author = {Meddings, N. and Heinrich, M. and Overney, F. and Lee, J-S. and Ruiz, V. and Napolitano, E. and Seitz, S. and Hinds, G. and Raccichini, R. and Gaberšček, M. and Park, J.} } @Article { SchulteLSSH2020, subid = {2776}, title = {Prospects and challenges for squeezing-enhanced optical atomic clocks}, journal = {Nature Communications}, year = {2020}, month = {11}, day = {24}, volume = {11}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {5955}, keywords = {entanglement, spin squeezing, optical clocks}, web_url = {https://www.nature.com/articles/s41467-020-19403-7}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-020-19403-7}, stag_bib_extends_levelofaccess = {NA}, author = {Schulte, M. and Lisdat, C. and Schmidt, P.O. and Sterr, U. and Hammerer, K.} } @Article { SchulteLSSH2020_2, subid = {2776}, title = {Prospects and challenges for squeezing-enhanced optical atomic clocks}, journal = {Nature Communications}, year = {2020}, month = {11}, day = {24}, volume = {11}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {5955}, keywords = {entanglement, spin squeezing, optical clocks}, web_url = {https://www.nature.com/articles/s41467-020-19403-7}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-020-19403-7}, stag_bib_extends_levelofaccess = {NA}, author = {Schulte, M. and Lisdat, C. and Schmidt, P.O. and Sterr, U. and Hammerer, K.} } @Article { FinizioWMHLBBMR2020, subid = {2380}, title = {Time-resolved visualization of the magnetization canting induced by field-like spin–orbit torques}, journal = {Applied Physics Letters}, year = {2020}, month = {11}, day = {23}, volume = {117}, number = {21}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {212404}, keywords = {X-ray microscopy, Ferromagnetic materials, Time resolved imaging, Spin-orbit interactions, Spin Hall effect}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0029816}, stag_bib_extends_levelofaccess = {NA}, author = {Finizio, S. and Wintz, S. and Mayr, S. and Huxtable, A.J. and Langer, M. and Bailey, J. and Burnell, G. and Marrows, C.H. and Raabe, J.} } @Article { SachsePVSRBBHKSKH2020, subid = {1704}, title = {Assessing Optical and Electrical Properties of Highly Active IrOx Catalysts for the Electrochemical Oxygen Evolution Reaction via Spectroscopic Ellipsometry}, journal = {ACS Catalysis}, year = {2020}, month = {11}, day = {20}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {14210-14223}, keywords = {spectroscopic ellipsometry, electrocatalysis, oxygen evolution reaction, mesoporous iridium oxidefilms, non-destructive ambient analysis, intrinsic OER activity, complementary methodology and metrology}, misc2 = {EMPIR 2016: Energy}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2155-5435, 2155-5435}, DOI = {10.1021/acscatal.0c03800}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Pfl{\"u}ger, M. and Velasco-V{\'e}lez, J-J. and Sahre, M. and Radnik, J. and Bernicke, M. and Bernsmeier, D. and Hodoroaba, V-D. and Krumrey, M. and Strasser, P. and Kraehnert, R. and Hertwig, A.} } @Article { KokurewiczSBSKHMKJ2020, subid = {1842}, title = {Dosimetry for New Radiation Therapy Approaches Using High Energy Electron Accelerators}, journal = {Frontiers in Physics}, year = {2020}, month = {11}, day = {13}, volume = {8}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {Dosimetry, FLASH beams, Absorbed dose, ultra-high pulse dose rates, High Energy Electron Accelerators}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2020.568302}, stag_bib_extends_levelofaccess = {NA}, author = {Kokurewicz, K. and Sch{\"u}ller, A. and Brunetti, E. and Subiel, A. and Kranzer, R. and Hackel, T. and Meier, M. and Kapsch, R-P. and Jaroszynsk, D.A.} } @Proceedings { MeisnerGSHSEGRMLBOGS2020, subid = {1922}, title = {Support for standardisation of high voltage testing with composite and combined wave shapes}, journal = {VDE High Voltage Technology 2020, ETG-Symposium}, year = {2020}, month = {11}, day = {11}, number2 = {19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes}, keywords = {Electricity grids, high voltage testing, traceability, combined wave shapes, composite wave shapes, universal dividers, calibration}, tags = {SEG}, web_url = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {VDE}, event_place = {online}, event_name = {VDE High Voltage Technology 2020}, event_date = {09-11-2020 to 11-11-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215}, author = {Meisner, J. and Gockenbach, E. and Saadeddine, H. and Havunen, J. and Schichler, U. and Elg, A-P. and Garnacho, F. and Roccato, P.E. and Merev, A. and Lahti, K. and Backhaus, K. and Orrea, A. and Gamlin, M. and Steiner, T.} } @Article { HeeringBS2020, subid = {1699}, title = {Glass electrode half-cells for measuring unified pH in ethanol–water mixtures}, journal = {Journal of Sensors and Sensor Systems}, year = {2020}, month = {11}, day = {11}, volume = {9}, number = {2}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {383-389}, keywords = {unified pH, pHabs, water-ethanol mixtures, glass electrode half-cells, ionic liquid, [N2225][NTf2]}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-9-383-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, A. and Bastkowski, F. and Seitz, S.} } @Article { HeeringBS2020_2, subid = {2181}, title = {Glass electrode half-cells for measuring unified pH in ethanol–water mixtures}, journal = {Journal of Sensors and Sensor Systems}, year = {2020}, month = {11}, day = {11}, volume = {9}, number = {2}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {383-389}, keywords = {Glass electrode half-cells unified pHethanol–water mixtures}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-9-383-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, A. and Bastkowski, F. and Seitz, S.} } @Article { HonickeWWKB2020, subid = {1688}, title = {Towards a calibration of laboratory setups for grazing incidence and total-reflection X-ray fluorescence analysis}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {11}, volume = {174}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {106009}, keywords = {Gracing incidence X-ray fluorescenceLaboratory setupSolid angle characterization}, web_url = {https://arxiv.org/abs/2003.05192}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.106009}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Waldschl{\"a}ger, U. and Wiesner, T. and Kr{\"a}mer, M. and Beckhoff, B.} } @Article { PellegrinoIPSROMHM2020, subid = {1658}, title = {Machine learning approach for elucidating and predicting the role of synthesis parameters on the shape and size of TiO2 nanoparticles}, journal = {Scientific Reports}, year = {2020}, month = {11}, volume = {10}, number = {1}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {18910-1-11}, keywords = {nanoparticles, titanium dioxide, size, shape, machine learning, synthesis}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-75967-w}, stag_bib_extends_levelofaccess = {NA}, author = {Pellegrino, F. and Isopescu, R. and Pelluti{\`e}, L. and Sordello, F. and Rossi, A.M. and Ortel, E. and Martra, G. and Hodoroaba, V-D. and Maurino, V.} } @Article { BlakesleyKDHTMSA2020, subid = {1949}, title = {Effective Spectral Albedo from Satellite Data for Bifacial Gain Calculations of PV Systems}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {1292 - 1297}, keywords = {Albedo, Bificial PV Module}, web_url = {https://zenodo.org/record/4055920}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {3-936338-73-6}, author = {Blakesley, J.C. and Koutsourakis, G. and Douglas, S. and Holder, J.K.L. and Torry, J. and Mukadam, F. and Schmid, A. and Abrams, R.S.J.} } @Article { BourgouinSHKPKM2020, subid = {1840}, title = {Calorimeter for Real-Time Dosimetry of Pulsed Ultra-High Dose Rate Electron Beams}, journal = {Frontiers in Physics}, year = {2020}, month = {10}, day = {30}, volume = {8}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, FLASH radiation therapy, calorimetry}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2020.567340}, stag_bib_extends_levelofaccess = {NA}, author = {Bourgouin, A. and Sch{\"u}ller, A. and Hackel, T. and Kranzer, R. and Poppinga, D. and Kapsch, R-P. and McEwen, M. } } @Article { HuggettBBGHKKMMNPSSVVWZ2020, subid = {1862}, title = {Cautionary Note on Contamination of Reagents Used for Molecular Detection of SARS-CoV-2}, journal = {Clinical Chemistry}, year = {2020}, month = {10}, day = {30}, volume = {66}, number = {11}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {1369-1372}, keywords = {SARS-CoV-2, RT-qPCR, contamination, false positive, molecular diagnosis}, web_url = {https://academic.oup.com/clinchem/article/66/11/1369/5902447}, misc2 = {EMPIR 2018: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0009-9147, 1530-8561}, DOI = {10.1093/clinchem/hvaa214}, stag_bib_extends_levelofaccess = {NA}, author = {Huggett, J.F. and Benes, V. and Bustin, S.A. and Garson, J.A. and Harris, K. and Kammel, M. and Kubista, M. and McHugh, T.D. and Moran-Gilad, J. and Nolan, T. and Pfaffl, M.W. and Salit, M. and Shipley, G. and Vallone, P.M. and Vandesompele, J. and Wittwer, C. and Zeichhardt, H.} } @Proceedings { DurgutYHMU2020, subid = {1974}, title = {(50-400) MPa Aralığında İzlenebilir Dinamik Basın\c{c}{\"O}l\c{c}{\"u}mleri}, journal = {Academic Perspective Procedia}, year = {2020}, month = {10}, day = {25}, volume = {3}, number = {1}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {658-664}, keywords = {Dinamik, basın\c{c}, kalibrasyon, dinamik sens{\"o}r, k{\"u}tle d{\"u}ş{\"u}rmesli sistem}, misc2 = {EMPIR 2017: Industry}, publisher = {Academic Perspective}, event_place = {Bursa, Turkey}, event_name = {8th International Symposium on Innovative Technologies in Engineering and Science (ISITES2020)}, event_date = {23-10-2020 to 25-10-2020}, language = {126}, ISSN = {2667-5862}, DOI = {10.33793/acperpro.03.01.120}, stag_bib_extends_levelofaccess = {NA}, author = {Durgut, Y. and Yilmaz, R. and Hamarat, A. and Meral, İ. and Uslukılı\c{c}, U.} } @Article { HuntRSK2020, subid = {1692}, title = {High-speed density measurement for LNG and other cryogenic fluids using electrical capacitance tomography}, journal = {Cryogenics}, year = {2020}, month = {10}, day = {24}, volume = {113}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {103207}, keywords = {Liquefied natural gasLNGElectrical capacitance tomographyECTDensity measurement}, tags = {EnG}, web_url = {https://doi.org/10.1016/j.cryogenics.2020.103207}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0011-2275}, DOI = {10.1016/j.cryogenics.2020.103207}, stag_bib_extends_levelofaccess = {NA}, author = {Hunt, A. and Rusli, I. and Schakel, M. and Kenbar, A.} } @Article { DorscherABSHSL2020, subid = {1719}, title = {Dynamical decoupling of laser phase noise in compound atomic clocks}, journal = {Communications Physics}, year = {2020}, month = {10}, day = {20}, volume = {3}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {1-8}, keywords = {optical atomic clocks,dynamic decoupling,coherence time,decoherence}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-020-00452-9}, stag_bib_extends_levelofaccess = {NA}, author = {D{\"o}rscher, S. and Al-Masoudi, A. and Bober, M. and Schwarz, R. and Hobson, R. and Sterr, U. and Lisdat, C.} } @Article { HanZGPCSLHKSPLP2020, subid = {1868}, title = {Measurement of thermodynamic temperature between 5 K and 24.5 K with single-pressure refractive-index gas thermometry}, journal = {Metrologia}, year = {2020}, month = {10}, day = {19}, volume = {57}, number = {6}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {065006}, keywords = {SPRIGT, Cryostat, Resonator.thermodynamic temperature,}, tags = {SEG}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/ab84ca/pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab84ca}, stag_bib_extends_levelofaccess = {NA}, author = {Han, D. and Zhang, H. and Gao, B. and Pan, C. and Chen, H. and Song, Y. and Liu, W. and Hu, J. and Kong, X. and Sparasci, F. and Plimmer, M. and Luo, E. and Pitre, L.} } @Article { FurstYKKDLBHPM2020, subid = {1650}, title = {Coherent Excitation of the Highly Forbidden Electric Octupole Transition in Yb+172}, journal = {Physical Review Letters}, year = {2020}, month = {10}, day = {16}, volume = {125}, number = {16}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {163001}, keywords = {Atomic spectra, Optical clocks, Coherent control, Cooling \& trapping, Laser spectroscopy, Trapped Ions}, web_url = {https://link.aps.org/doi/10.1103/PhysRevLett.125.163001}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.163001}, stag_bib_extends_levelofaccess = {NA}, author = {F{\"u}rst, H.A. and Yeh, C.H. and Kalincev, D. and Kulosa, A.P. and Dreissen, L.S. and Lange, R. and Benkler, E. and Huntemann, N. and Peik, E. and Mehlst{\"a}ubler, T.E.} } @Article { MantouvalouJSMKWHWGBGD2020, subid = {1689}, title = {Laboratory grazing-incidence X-ray fluorescence spectroscopy as an analytical tool for the investigation of sub-nanometer CrSc multilayer water window optics}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {10}, day = {10}, volume = {174}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {105995}, keywords = {GIXRFMultilayer characterization}, web_url = {https://arxiv.org/abs/2006.12198}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.105995}, stag_bib_extends_levelofaccess = {NA}, author = {Mantouvalou, I. and Jonnard, P. and Szwedowski-Rammert, V. and Meltchakov, E. and Kanngie{\ss}er, B. and Wu, M. and Honicke, P. and Waldschl{\"a}ger, U. and Gross, A. and Baumann, J. and Goetzke, G. and Delmotte, F.} } @Article { SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI2020, subid = {1664}, title = {Intercontinental comparison of optical atomic clocks through very long baseline interferometry}, journal = {Nature Physics}, year = {2020}, month = {10}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology}, web_url = {http://hdl.handle.net/11696/64130}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-020-01038-6}, stag_bib_extends_levelofaccess = {NA}, author = {Sekido, M. and Takefuji, K. and Ujihara, H. and Hachisu, H. and Nemitz, N. and Tsutsumi, M. and Kondo, T. and Kawai, E. and Ichikawa, R. and Namba, K. and Okamoto, Y. and Takahashi, R. and Komuro, J. and Clivati, C. and Bregolin, F. and Barbieri, P. and Mura, A. and Cantoni, E. and Cerretto, G. and Levi, F. and Maccaferri, G. and Roma, M. and Bortolotti, C. and Negusini, M. and Ricci, R. and Zacchiroli, G. and Roda, J. and Leute, J. and Petit, G. and Perini, F. and Calonico, D. and Pizzocaro, M. and Ido, T.} } @Article { SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI20200, subid = {1664}, title = {Intercontinental comparison of optical atomic clocks through very long baseline interferometry}, journal = {Nature Physics}, year = {2020}, month = {10}, number2 = {17IND14: WRITE: Precision Time for Industry}, keywords = {Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology}, web_url = {http://hdl.handle.net/11696/64130}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-020-01038-6}, stag_bib_extends_levelofaccess = {NA}, author = {Sekido, M. and Takefuji, K. and Ujihara, H. and Hachisu, H. and Nemitz, N. and Tsutsumi, M. and Kondo, T. and Kawai, E. and Ichikawa, R. and Namba, K. and Okamoto, Y. and Takahashi, R. and Komuro, J. and Clivati, C. and Bregolin, F. and Barbieri, P. and Mura, A. and Cantoni, E. and Cerretto, G. and Levi, F. and Maccaferri, G. and Roma, M. and Bortolotti, C. and Negusini, M. and Ricci, R. and Zacchiroli, G. and Roda, J. and Leute, J. and Petit, G. and Perini, F. and Calonico, D. and Pizzocaro, M. and Ido, T.} } @Article { BremerWFTSKRHSPMGR2020, subid = {1803}, title = {Quantum dot single-photon emission coupled into single-mode fibers with 3D printed micro-objectives}, journal = {APL Photonics}, year = {2020}, month = {10}, volume = {5}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {106101}, keywords = {Quantum dot single-photon emission}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {2378-0967}, DOI = {10.1063/5.0014921}, stag_bib_extends_levelofaccess = {NA}, author = {Bremer, L. and Weber, K. and Fischbach, S. and Thiele, S. and Schmidt, M. and Kaganskiy, A. and Rodt, S. and Herkommer, A. and Sartison, M. and Portalupi, S.L. and Michler, P. and Giessen, H. and Reitzenstein, S.} } @Article { BergstrandJH2020, subid = {1643}, title = {Quantifying errors in GNSS antenna calibrations}, journal = {Journal of Geodesy}, year = {2020}, month = {10}, volume = {94}, number = {10}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {105}, keywords = {Antenna, Calibration, GNSS, Local tie, Phase center offset, Phase center variation, Terrestrial reference frame, PCC, PCO, PCV, TRF}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0949-7714, 1432-1394}, DOI = {10.1007/s00190-020-01433-0}, stag_bib_extends_levelofaccess = {NA}, author = {Bergstrand, S. and Jarlemark, P. and Herbertsson, M.} } @Article { SlaninaQDHW2020, subid = {1973}, title = {Comparing the adiabatic and isothermal pressure dependence of the index of refraction in a drop-weight apparatus}, journal = {Applied Physics B}, year = {2020}, month = {10}, volume = {126}, number = {11}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, keywords = {drop-weight, dynamic pressure, adiabatic compression, isothermal compression, liquids, index of refraction, calibration}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-020-07519-z}, stag_bib_extends_levelofaccess = {NA}, author = {Slanina, O. and Quabis, S. and Derksen, S. and Herbst, J. and Wynands, R.} } @Article { LangeHSSLTP2020, subid = {1671}, title = {Coherent Suppression of Tensor Frequency Shifts through Magnetic Field Rotation}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {second-rank tensor frequency shifts, atomic clocks}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.125.143201}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.143201}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Peik, E.} } @Article { LangeHSSLTP20200, subid = {1671}, title = {Coherent Suppression of Tensor Frequency Shifts through Magnetic Field Rotation}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {second-rank tensor frequency shifts, atomic clocks}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.125.143201}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.143201}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Peik, E.} } @Article { JandaGOPUHRSMRNCHWEACDMORONJKZ2020, subid = {1683}, title = {Magneto-Seebeck microscopy of domain switching in collinear antiferromagnet CuMnAs}, journal = {Physical Review Materials}, year = {2020}, month = {9}, day = {28}, volume = {4}, number = {9}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {094413-1 to 094413-9}, keywords = {-}, web_url = {https://arxiv.org/abs/2004.05460}, misc2 = {EMPIR 2016: Energy}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2475-9953}, DOI = {10.1103/PhysRevMaterials.4.094413}, stag_bib_extends_levelofaccess = {NA}, author = {Janda, T. and Godinho, J. and Ostatnicky, T. and Pfitzner, E. and Ulrich, G. and Hoehl, A. and Reimers, S. and Šob{\'a}ň, Z. and Metzger, T. and Reichlov{\'a}, H. and Nov{\'a}k, V. and Campion, R. P. and Heberle, J. and Wadley, P. and Edmonds, K. W. and Amin, O. J. and Chauhan, J. S. and Dhesi, S. S. and Maccherozzi, F. and Otxoa, R. M. and Roy, P. E. and Olejn{\'i}k, K. and Němec, P. and Jungwirth, T. and Kaestner, B. and Ziade, Francois} } @Article { SikorskyGHKGEMRDWBRSKSF2020, subid = {1642}, title = {Measurement of the Th229 Isomer Energy with a Magnetic Microcalorimeter}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {Th229 Isomer Energy, Magnetic Microcalorimeter}, web_url = {https://arxiv.org/abs/2005.13340}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.142503}, stag_bib_extends_levelofaccess = {NA}, author = {Sikorsky, T. and Geist, J. and Hengstler, D. and Kempf, S. and Gastaldo, L. and Enss, C. and Mokry, C. and Runke, J. and D{\"u}llmann, C.E. and Wobrauschek, P. and Beeks, K. and Rosecker, V. and Sterba, J.H. and Kazakov, G. and Schumm, T. and Fleischmann, A.} } @Article { WelshvBCHLLLvNTWWJ2020, subid = {1707}, title = {Towards defining reference materials for measuring extracellular vesicle refractive index, epitope abundance, size and concentration}, journal = {Journal of Extracellular Vesicles}, year = {2020}, month = {9}, day = {24}, volume = {9}, number = {1}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {1816641}, keywords = {Calibration; exosomes; extracellular vesicles; microvesicles; optical analysis; reference materials; standardization; quality control; validation}, misc2 = {EMPIR 2018: Health}, language = {30}, ISSN = {2001-3078}, DOI = {10.1080/20013078.2020.1816641}, stag_bib_extends_levelofaccess = {NA}, author = {Welsh, J.A. and van der Pol, E. and Bettin, B.A. and Carter, D.R.F. and Hendrix, A. and Lenassi, M. and Langlois, M-A. and Llorente, A. and van de Nes, A.S. and Nieuwland, R. and Tang, V. and Wang, L. and Witwer, K.W. and Jones, J.C. } } @Proceedings { tenHaveHML2020, subid = {2086}, title = {Unfairly Faulty Energy Meter Reading due to Inappropriate Use of the Blondel Theorem}, journal = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2020}, month = {9}, day = {23}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Blondel theorem, Distribution system, Energy measurement, Residual current device, Unbalance}, web_url = {https://research.utwente.nl/en/publications/unfairly-faulty-energy-meter-reading-due-to-inappropriate-use-of-}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Barcelona}, event_name = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {23-09-2020 to 25-09-2020}, language = {30}, DOI = {10.1109/EMCEUROPE48519.2020.9245714}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Hartman, T. and Moonen, N. and Leferink, F.} } @Proceedings { MoonenGHL2020, subid = {2089}, title = {Time-Domain EMI Measurements using a Low Cost Digitizer to Optimize the Total Measurement Time for a Test Receiver}, journal = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2020}, month = {9}, day = {23}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {-}, web_url = {https://research.utwente.nl/en/publications/time-domain-emi-measurements-using-a-low-cost-digitizer-to-optimi}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Rome}, event_name = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {23-09-2020 to 25-09-2020}, language = {30}, DOI = {10.1109/EMCEUROPE48519.2020.9245801}, stag_bib_extends_levelofaccess = {NA}, author = {Moonen, N. and Grootjans, R. and Hartman, T. and Leferink, F.} } @Article { deKromBZMBiGFKHE2020, subid = {2032}, title = {Comparability of calibration strategies for measuring mercury concentrations in gas emission sources and the atmosphere}, journal = {Atmospheric Measuremnt Techniques Discussion}, year = {2020}, month = {9}, day = {21}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {Mercury, emissions, calibration, traceability}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, DOI = {10.5194/amt-2020-314}, stag_bib_extends_levelofaccess = {NA}, author = {de Krom, I. and Bavius, W. and Ziel, R. and McGhee, E.A. and Brown, R.J.C. and Živković, I. and Gačnik, J. and Fajon, V. and Kotnik, J. and Horvat, M. and Ent, H.} } @Article { PellegrinoSMPMH2020, subid = {1609}, title = {Polyethylene Glycol as Shape and Size Controller for the Hydrothermal Synthesis of SrTiO3 Cubes and Polyhedra}, journal = {Nanomaterials}, year = {2020}, month = {9}, day = {21}, volume = {10}, number = {9}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {1892}, keywords = {polyethylene glycol, strontium titanate, controlled morphology, photoelectrochemistry}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano10091892}, stag_bib_extends_levelofaccess = {NA}, author = {Pellegrino, F. and Sordello, F. and Mino, L. and Prozzi, M. and Mansfeld, U. and Hodoroaba, V-D.} } @Article { ChristinckRLHGK2020, subid = {1880}, title = {Characterization of the angular-dependent emission of nitrogen-vacancy centers in nanodiamond}, journal = {Applied Physics B}, year = {2020}, month = {9}, day = {18}, volume = {126}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Single-photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-020-07508-2}, stag_bib_extends_levelofaccess = {NA}, author = {Christinck, J. and Rodiek, B. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and K{\"u}ck, S.} } @Article { WinterSVMRPKHLHDBBBBBBKSR2020, subid = {1950}, title = {Results of the Bifacial PV Cells and PV Modules Power Measurement Round Robin Activity of the PV-Enerate Project}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {9}, day = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {877 - 882}, keywords = {Testing, PV Module, Bifacial PV}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4055707}, author = {Winter, S. and Str{\"a}ter, H. and Vegas, A. and Molinero, R.R. and Riechelmann, S. and Pavanello, D. and Kenny, R. and Herrmann, W. and Lopez-Garcia, J. and Hinken, D. and Dittmann, S. and Bonilla, J. and Bliss, M. and Bothe, K. and Blakesley, J.C. and Betts, T.R. and Bellenda, G. and Koutsourakis, G. and Schmid, A. and Rauer, M.} } @Article { GaiserFH2020, subid = {1794}, title = {Thermodynamic-temperature data from 30 K to 200 K}, journal = {Metrologia}, year = {2020}, month = {9}, volume = {57}, number = {5}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {055003}, keywords = {thermodynamic temperature, primary thermometry, dielectric-constant gasthermometry, International temperature Scale, ITS-90}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab9683}, stag_bib_extends_levelofaccess = {NA}, author = {Gaiser, C. and Fellmuth, B. and Haft, N.} } @Article { GeorgievaLHCRSKHRRK2020, subid = {1881}, title = {Radiometric characterization of a triggered narrow-bandwidth single-photon source and its use for the calibration of silicon single-photon avalanche detectors}, journal = {Metrologia}, year = {2020}, month = {9}, volume = {57}, number = {5}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {055001}, keywords = {quantum radiometry, quantum metrology, single-photon source, single-photondetector, quantum dot}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab9db6}, stag_bib_extends_levelofaccess = {NA}, author = {Georgieva, H. and L{\'o}pez, M. and Hofer, H. and Christinck, J. and Rodiek, B. and Schnauber, P. and Kaganskiy, A. and Heindel, T. and Rodt, S. and Reitzenstein, S. and K{\"u}ck, S.} } @Article { GunkelDHLKRUBT2020, subid = {1684}, title = {Phonon‐Enhanced Near‐Field Spectroscopy to Extract the Local Electronic Properties of Buried 2D Electron Systems in Oxide Heterostructures}, journal = {Advanced Functional Materials}, year = {2020}, month = {9}, volume = {30}, number = {46}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {2004767}, keywords = {2D electron systems, electronic properties, LaAlO/SrTiO, near-field spectroscopy, oxide heterostructure}, misc2 = {EMPIR 2016: Energy}, publisher = {Wiley}, language = {30}, ISSN = {1616-301X, 1616-3028}, DOI = {10.1002/adfm.202004767}, stag_bib_extends_levelofaccess = {NA}, author = {Gunkel, F. and Dittmann, R. and Hoehl, A. and Lewin, M. and K{\"a}stner, B. and Rose, M‐A. and Ulrich, G. and Barnett, J. and Taubner, T.} } @Article { WangSRNDHW2020, subid = {1582}, title = {Material Measurements Using VNA-Based Material Characterization Kits Subject to Thru-Reflect-Line Calibration}, journal = {IEEE Transactions on Terahertz Science and Technology}, year = {2020}, month = {9}, volume = {10}, number = {5}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {466-473}, keywords = {Loss tangent, millimeter-wave measurements, relative permittivity, terahertz measurements, time-domain spectrometer (TDS), thru-reflect-line (TRL) calibration, vector network analyzer (VNA)}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-342X, 2156-3446}, DOI = {10.1109/TTHZ.2020.2999631}, stag_bib_extends_levelofaccess = {NA}, author = {Wang, Yi and Shang, Xiaobang and Ridler, Nick M. and Naftaly, Mira and Dimitriadis, Alexandros I. and Huang, Tongde and Wu, Wen} } @Article { BrabH2020, subid = {1763}, title = {Ab initio calculation of the electron capture spectrum of 163Ho: Auger–Meitner decay into continuum states}, journal = {New Journal of Physics}, year = {2020}, month = {9}, volume = {22}, number = {9}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {093018}, keywords = {electron capture spectrum,line width,continuum,Auger Meitner,163Ho}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Maurits W. Haverkort}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/abac72}, stag_bib_extends_levelofaccess = {NA}, author = {Bra\(\beta\), M. and Haverkort, M.W.} } @Article { HuntMSPYWD2020, subid = {2218}, title = {Comparison of the Sentinel-3A and B SLSTR Tandem Phase Data Using Metrological Principles}, journal = {Remote Sensing}, year = {2020}, month = {9}, volume = {12}, number = {18}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {2893}, keywords = {Sentinel-3A, Copernicus, Tandem-phase data, Earth Observation}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs12182893}, stag_bib_extends_levelofaccess = {NA}, author = {Hunt, S.E. and Mittaz, J.P.D. and Smith, D. and Polehampton, E. and Yemelyanova, R. and Woolliams, E.R. and Donlon, C.} } @Article { PfitznerUHLZSSHKMW2020, subid = {1800}, title = {Thermoelectric nanospectroscopy for the imaging of molecular fingerprints}, journal = {Nanophotonics}, year = {2020}, month = {8}, day = {21}, volume = {9}, number = {14}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {4347-4354}, keywords = {nanospectroscopy; photothermoelectric effect; s-SNOM}, web_url = {https://www.degruyter.com/view/journals/nanoph/ahead-of-print/article-10.1515-nanoph-2020-0316/article-10.1515-nanoph-2020-0316.xml?tab_body=fullHtml-79543}, misc2 = {EMPIR 2018: Health}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2192-8614, 2192-8606}, DOI = {10.1515/nanoph-2020-0316}, stag_bib_extends_levelofaccess = {NA}, author = {Pfitzner, E. and Ulrich, G. and Hoehl, A. and Liao, J-W. and Zadvorna, O. and Sirringhaus, H. and Schweicher, G. and Heberle, J. and K{\"a}stner, B. and Minutoli, D. and Wunderlich, J.} } @Article { MustapaaNHV2020, subid = {1670}, title = {Metrological Challenges in Collaborative Sensing: Applicability of Digital Calibration Certificates}, journal = {Sensors}, year = {2020}, month = {8}, day = {21}, volume = {20}, number = {17}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, pages = {4730}, keywords = {IoT-communication, sensor networks, smart agents, metrology, digital calibration certificate, traceability}, web_url = {https://www.mdpi.com/1424-8220/20/17/4730}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, address = {Basel CH-4005 Switzerland}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20174730}, stag_bib_extends_levelofaccess = {NA}, author = {Mustap{\"a}{\"a}, T. and Nikander, P. and Hutzschenreuter, D. and Viitala, R.} } @Article { SchinkePHWBKNW2020_2, subid = {1604}, title = {Calibrating spectrometers for measurements of the spectral irradiance caused by solar radiation}, journal = {Metrologia}, year = {2020}, month = {8}, day = {17}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {spectral irradiance, solar radiation, measurement uncertainty analysis, spectrometer, spectroradiometer, calibration, solar simulator}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abafc5}, stag_bib_extends_levelofaccess = {NA}, author = {Schinke, C. and Pollex, H. and Hinken, D. and Wolf, M. and Bothe, K. and Kroeger, I. and Nevas, S. and Winter, S.} } @Article { deKromBZEvvvvHvDCE2020, subid = {1994}, title = {Primary mercury gas standard for the calibration of mercury measurements}, journal = {Measurement}, year = {2020}, month = {8}, day = {16}, volume = {169}, number = {2021}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {108351}, keywords = {Mercury, Metrology, Primary gas standard, Calibration, SI-traceability, Environmental}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2020.108351}, stag_bib_extends_levelofaccess = {NA}, author = {de Krom, I. and Bavius, W. and Ziel, R. and Efremov, E. and van Meer, D. and van Otterloo, P. and van Andel, I. and van Osselen, D. and Heemskerk, M. and van der Veen, A.M.H. and Dexter, M.A. and Corns, W.T. and Ent, H.} } @Article { GomezCGSPHFPTMB2020, subid = {1698}, title = {Rapid three-dimensional multiparametric MRI with quantitative transient-state imaging}, journal = {Scientific Reports}, year = {2020}, month = {8}, day = {13}, volume = {10}, number = {1}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, keywords = {Magnetic Resonance Imaging (MRI)Quantitative MRIMagnetic Resonance Fingerprinting}, web_url = {https://www.nature.com/articles/s41598-020-70789-2}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-70789-2}, stag_bib_extends_levelofaccess = {NA}, author = {G{\'o}mez, P.A. and Cencini, M. and Golbabaee, M. and Schulte, R.F. and Pirkl, C. and Horvath, I. and Fallo, G. and Peretti, L. and Tosetti, M. and Menze, B.H. and Buonincontri, G.} } @Proceedings { vanLeeuwenvRHH2020, subid = {1943}, title = {Measuring the Voltage Dependence of Current Transformers}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Current measurement, current transformers, measurement standards, precision measurements}, tags = {SEG}, web_url = {https://www.techrxiv.org/articles/preprint/Measuring_the_Voltage_Dependence_of_Current_Transformers/13469673/1}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Denver, CO, USA}, event_name = {Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5898-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM49742.2020.9191845}, stag_bib_extends_levelofaccess = {NA}, author = {van Leeuwen, R. and van den Brom, H. and Rietveld, G. and Houtzager, E. and Hoogenboom, D.} } @Proceedings { KazemipourHWAHRSZ2020, subid = {1663}, title = {VNA-Based Material Characterization in THz Domain without Classic Calibration and Time-Gating}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, volume = {N/A}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1-2}, keywords = {Material characterization, parameter extraction, VNA time-gating, RF metrology, measurement uncertainty}, web_url = {https://doi.org/10.5281/zenodo.4243044}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Denver, CO, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5898-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM49742.2020.9191818}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Allal, D. and Hudlicka, M. and Ruefenacht, J. and Stalder, D. and Zeier, M.} } @Proceedings { vanVeghelSvHRvMK2020, subid = {2103}, title = {Towards improved standardization of electricity meter testing}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Energy measurement,electromagnetic compatibility,measurement errors,electricity meters}, tags = {SEG}, web_url = {https://www.techrxiv.org/articles/preprint/Towards_improved_standardization_of_electricity_meter_testing/13469622/1}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Bolder}, event_name = {Conference of Precession Electromagnetic MeasurementsPEM}, event_date = {01-08-2020 to 07-08-2020}, language = {30}, DOI = {10.1109/CPEM49742.2020.9191719}, stag_bib_extends_levelofaccess = {NA}, author = {van Veghel, M.G.A. and Sharma, S. and van den Brom, H.E. and Hoogenboom, D. and Rietveld, G. and van Leeuwen, R. and Marais, Z. and Kok, G.J.P.} } @Article { GarberoglioH2020, subid = {1594}, title = {Path-Integral Calculation of the Second Dielectric and Refractivity Virial Coefficients of Helium, Neon, and Argon}, journal = {Journal of Research of the National Institute of Standards and Technology}, year = {2020}, month = {8}, volume = {125}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, keywords = {second dielectric virial coefficient, helium, neon, argon, path integral}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {National Institute of Standards and Technology (NIST)}, language = {30}, ISSN = {2165-7254}, DOI = {10.6028/jres.125.022}, stag_bib_extends_levelofaccess = {NA}, author = {Garberoglio, G. and Harvey, A.H.} } @Article { RuutelYKSIDHHTBL2020, subid = {2185}, title = {Design, synthesis and application of carbazole macrocycles in anion sensors}, journal = {Beilstein Journal of Organic Chemistry}, year = {2020}, month = {8}, volume = {16}, number = {2020}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1901-1914}, keywords = {anion sensors; carboxylates;ionophores; acrocycles; sensor prototype}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Beilstein Institut}, language = {30}, ISSN = {1860-5397}, DOI = {10.3762/bjoc.16.157}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"u}{\"u}tel, A. and Yrj{\"a}n{\"a}, V. and Kadam, S.A. and Saar, I. and Ilisson, M. and Darnell, A. and Haav, K. and Haljasorg, T. and Toom, L. and Bobacka, J. and Leito, I.} } @Article { BiguriLBTDBMDHB2020, subid = {1885}, title = {Arbitrarily large iterative tomographic reconstruction on multiple GPUs using the TIGRE toolbox}, journal = {Journal of Parallel and Distributed Computing}, year = {2020}, month = {7}, day = {29}, volume = {146}, number = {2020}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {52-63}, keywords = {Computed Tomography, multi GPU computing, iterative reconstruction}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1905.03748}, author = {Biguri, A. and Lindroos, R. and Bryll, R. and Towsyfyan, H. and Deyhle, H. and Boardman, R. and Mavrogordato, M. and Dosanjh, M. and Hancock, S. and Blumensath, T.} } @Article { KazemipourWHHYRSGZ2020, subid = {1603}, title = {Analytical Uncertainty Evaluation of Material Parameter Measurements at THz Frequencies}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2020}, month = {7}, day = {24}, volume = {41}, number = {10}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1199 - 1217}, keywords = {Material characterization, Extraction method, THz domain, Sensitivity coefficient, Measurement uncertainty, RF metrology}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1866-6892, 1866-6906}, DOI = {10.1007/s10762-020-00723-0}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Wollensack, M. and Hoffmann, J. and Hudlicka, M. and Yee, S-K. and R{\"u}fenacht, J. and Stalder, D. and G{\"a}umann, G. and Zeier, M.} } @Article { ivkoviBKJH2020, subid = {2030}, title = {Traceable Determination of Atmospheric Mercury Using Iodinated Activated Carbon Traps}, journal = {Atmosphere}, year = {2020}, month = {7}, day = {24}, volume = {11}, number = {8}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {780}, keywords = {Mercury, sorbent traps, atmosphere, traceability}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4433}, DOI = {10.3390/atmos11080780}, stag_bib_extends_levelofaccess = {NA}, author = {Živković, I. and Berisha, S. and Kotnik, J. and Jagodic, M. and Horvat, Milena} } @Article { BodermannBZMKSDHDK2020, subid = {1559}, title = {Quasi-bound states in the continuum for deep subwavelength structural information retrieval for DUV nano-optical polarizers}, journal = {Optics Express}, year = {2020}, month = {7}, day = {20}, volume = {28}, number = {16}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {23122}, keywords = {quasi-bound states}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.396044}, stag_bib_extends_levelofaccess = {NA}, author = {Bodermann, B. and Burger, S. and Zeitner, U. and Meyer, J. and K{\"a}seberg, T. and Siefke, T. and Dickmann, W. and Hurtado, C.B.R. and Dickmann, J. and Kroker, S.} } @Article { IttermannSHPPSW2020, subid = {1535}, title = {Parallel transmission medical implant safety testbed: Real‐time mitigation of RF induced tip heating using time‐domain E‐field sensors}, journal = {Magnetic Resonance in Medicine}, year = {2020}, month = {7}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {implant safety, MR safety, interventional MRI, open source Hardware, orthogonal projection, parallel transmission}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28379}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, L. and Silemek, B. and Petzold, J. and Pfeiffer, H. and Hoffmann, W. and Seifert, F. and Ittermann, B.} } @Proceedings { DijkstraHML2020, subid = {2090}, title = {An AC Controlled-Current Load for Controllable Waveform Parameters to Quantify Static Energy Meter Errors}, journal = {2020 IEEE International Symposium on Electromagnetic Compatibility \& Signal/Power Integrity (EMCSI)}, year = {2020}, month = {7}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Static Meter, Energy Meter, Controlled-Current, AC Load, Waveform Parameters}, web_url = {https://research.utwente.nl/en/publications/an-ac-controlled-current-load-for-controllable-waveform-parameter}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Reno, NV, USA}, event_name = {2020 IEEE International Symposium on Electromagnetic Compatibility \& Signal/Power Integrity (EMCSI)}, event_date = {28-07-2020 to 28-08-2020}, language = {30}, DOI = {10.1109/EMCSI38923.2020.9191617}, stag_bib_extends_levelofaccess = {NA}, author = {Dijkstra, J. and Hartman, T. and Moonen, N. and Leferink, F.} } @Manual { SchonhalsHMHYS2020, subid = {1536}, title = {Good practice guides SmartCom validation}, year = {2020}, month = {7}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {D-SI validation, DCC validation, SmartCom, TraCIM system, online validation, data exchange format, metrology data}, web_url = {https://zenodo.org/record/3816696}, misc2 = {EMPIR 2017: Industry}, publisher = {SmartCom}, language = {30}, DOI = {10.5281/zenodo.3816696}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"o}nhals, S. and Hutzschenreuther, D. and Muller, B. and Heindorf, L. and Yuhui, L. and Smith, I.} } @Article { WuHRSW2020, subid = {1516}, title = {Characterization of Dielectric Materials at WR-15 Band (50–75 GHz) Using VNA-Based Technique}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2020}, month = {7}, volume = {69}, number = {7}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {4930-4939}, keywords = {Dielectric constant, dielectric measurements, free-space measurement, loss tangent, millimeter-wave measurements, vector network analyzer (VNA)}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2019.2954010}, stag_bib_extends_levelofaccess = {NA}, author = {Wang, Y. and Shang, X. and Ridler, N.M. and Huang, T. and Wu, W.} } @Article { HeeringSCANNQRBBNSLLURVSDRKL2020, subid = {1554}, title = {Symmetric Potentiometric Cells for the Measurement of Unified pH Values}, journal = {Symmetry}, year = {2020}, month = {7}, volume = {12}, number = {7}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1150}, keywords = {unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-8994}, DOI = {10.3390/sym12071150}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, Agnes and Stoica, Daniela and Cam{\~o}es, Filomena and Anes, B{\'a}rbara and Nagy, D{\'a}niel and Nagyn{\'e} Szil{\'a}gyi, Zs{\'o}fia and Quendera, Raquel and Ribeiro, Luis and Bastkowski, Frank and Born, Rasmus and Nerut, Jaak and Saame, Jaan and Lainela, Silvie and Liv, Lokman and Uysal, Emrah and Rozikov{\'a}, Matilda and Vičarov{\'a}, Martina and Snedden, Alan and Deleebeeck, Lisa and Radtke, Valentin and Krossing, Ingo and Leito, Ivo} } @Article { SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020, subid = {1522}, title = {Determination of consensus kQ values for megavoltage photon beams for the update of IAEA TRS-398}, journal = {Physics in Medicine and Biology}, year = {2020}, month = {6}, day = {22}, volume = {65}, number = {9}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {095011}, keywords = {TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Institute of Physics}, address = {London}, language = {30}, DOI = {10.5281/zenodo.3903294}, stag_bib_extends_levelofaccess = {NA}, author = {Seuntjens, J. and de Prez, L.A. and Pinto, M. and Pimpinella, M. and Oliver, C.P. and Ojala, J. and Muir, B. and Mirzakhanian, L. and Hanlon, M.D. and Francescon, P. and Delaunay, F. and Borbinha, J. and Ballester, F. and Andersen, C.E. and Vatnitsky, S. and McEwen, M. and Kapsch, R.P. and Burns, D.T. and Andreo, P. and Sommier, L. and Teles, P. and Tikkanen, J. and Vijande, J. and Zink, K.} } @Article { SixOMLLJHBBLHYTYM2020, subid = {1577}, title = {What can we learn from N2O isotope data? - Analytics, processes and modelling}, journal = {Rapid Communications in Mass Spectrometry}, year = {2020}, month = {6}, day = {16}, volume = {34}, number = {20}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {14/e8858}, keywords = {nitrous oxide, isotopic composition, isotope ratio mass spectrometry, laser spectroscopy}, web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa:22957}, misc2 = {EMPIR 2016: Environment}, publisher = {John Wiley \& Sons}, language = {30}, DOI = {10.1002/rcm.8858}, stag_bib_extends_levelofaccess = {NA}, author = {Yu, Longfei and Harris, Eliza and Lewicka‐Szczebak, Dominika and Barthel, Matti and Blomberg, Margareta and Harris, Stephen J. and Johnson, Matthew S. and Lehmann, Moritz F. and Liisberg, Jesper and M{\"u}ller, Christoph and Ostrom, Nathaniel E. and Six, Johan and Toyoda, Sakae and Yoshida, Naohiro and Mohn, Joachim} } @Article { SalminenSHH2020, subid = {1976}, title = {Advances in traceable calibration of cylinder pressure transducers}, journal = {Metrologia}, year = {2020}, month = {6}, day = {12}, volume = {57}, number = {4}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {045006}, keywords = {dynamic pressure, cylinder pressure, dynamic reference, pressure reference, pressurecalibration, dynamic calibration}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab8fb9}, stag_bib_extends_levelofaccess = {NA}, author = {Salminen, J. and Saxholm, S. and H{\"a}m{\"a}l{\"a}inen, J. and H{\"o}gstr{\"o}m, R.} } @Article { BlakesleyHMGFBH2020, subid = {1733}, title = {Accuracy, cost and sensitivity analysis of PV energy rating}, journal = {Solar Energy}, year = {2020}, month = {6}, volume = {203}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {91-100}, keywords = {Photovoltaics, Energy rating, Uncertainty}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2020.03.088}, stag_bib_extends_levelofaccess = {NA}, author = {Blakesley, J.C. and Huld, T. and M{\"u}llejans, H. and Gracia-Amillo, A. and Friesen, G. and Betts, T.R. and Hermann, W.} } @Article { HarmonFBAGBLZ2020, subid = {1514}, title = {Assessment of Exposure to Electric Vehicle Inductive Power Transfer Systems: Experimental Measurements and Numerical Dosimetry}, journal = {Sustainability}, year = {2020}, month = {6}, volume = {12}, number = {11}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {4573}, keywords = {basic restrictions; electric vehicle; exposure; guidelines; inductive power transfer (IPT); magnetic field measurements; numerical dosimetry}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2071-1050}, DOI = {10.3390/su12114573}, stag_bib_extends_levelofaccess = {NA}, author = {Liorni, I. and Bottauscio, O. and Guilizzoni, R. and Ankarson, P. and Bruna, J. and Fallahi, A. and Harmon, S. and Zucca, M.} } @Proceedings { ReuterRFPBHR2020, subid = {1653}, title = {Applications of Tactile Microprobes for Surface Metrology}, journal = {SMSI 2020 - Sensors and Instrumentation}, year = {2020}, month = {6}, volume = {Chapter A6}, number = {2020}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {87-88}, keywords = {piezoresistive cantilever, MEMS, atomic force microscopy, contact resonance, surfaceroughness}, misc2 = {EMPIR 2017: Industry}, publisher = {AMA Association for Sensors and Measurement}, event_place = {Nuremberg, Germany}, event_name = {SMSI 2020}, event_date = {22-06-2020 to 25-06-2020}, language = {30}, ISBN = {978-3-9819376-2-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ama-science.org/proceedings/details/3655}, author = {Reuter, C. and Reum, A. and Fahrbach, M. and Peiner, E. and Brand, U. and Hofmann, M. and Rangelow, I.} } @Article { HarrisLXWZYBWKCBSM2020, subid = {1578}, title = {N2O isotopocule measurements using laser spectroscopy: analyzer characterization and intercomparison}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {5}, day = {28}, volume = {13}, number = {-}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {2797–2831}, keywords = {nitrous oxide, isotopic composition, laser spectroscopy, spectral interference, matrix effect}, web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa\%3A22186}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus Gesellschaft mbH}, address = {G{\"o}ttingen}, language = {30}, DOI = {10.5194/amt-13-2797-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Harris, Stephen J. and Liisberg, Jesper and Xia, Longlong and Wei, Jing and Zeyer, Kerstin and Yu, Longfei and Barthel, Matti and Wolf, Benjamin and Kelly, Bryce F. J. and Cend{\'o}n, Dioni I. and Blunier, Thomas and Six, Johan and Mohn, Joachim} } @Article { RadtkePHK2020, subid = {1634}, title = {The Inverted Philosopher’s Stone: how to turn silver to a base metal}, journal = {Journal of Solid State Electrochemistry}, year = {2020}, month = {5}, day = {23}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, keywords = {Hydrogen electrode . Ionic liquid . Ion solvation . Protoelectric Potential Map}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1432-8488, 1433-0768}, DOI = {10.1007/s10008-020-04633-y}, stag_bib_extends_levelofaccess = {NA}, author = {Radtke, V. and P{\"u}tz, K. and Himmel, D. and Krossing, I.} } @Article { FinizioWMHLBBMR2020_2, subid = {2379}, title = {Current-induced dynamical tilting of chiral domain walls in curved microwires}, journal = {Applied Physics Letters}, year = {2020}, month = {5}, volume = {116}, number = {18}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {182404}, keywords = {domain wall, spin-orbit torque, x-ray microscopy}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0005186}, stag_bib_extends_levelofaccess = {NA}, author = {Finizio, S. and Wintz, S. and Mayr, S. and Huxtable, A.J. and Langer, M. and Bailey, J. and Burnell, G. and Marrows, C.H. and Raabe, J.} } @Article { OsanBCDGSH2020, subid = {1569}, title = {Experimental evaluation of the in-the-field capabilities of total-reflection X-ray fluorescence analysis to trace fine and ultrafine aerosol particles in populated areas}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {5}, volume = {167}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {105852}, keywords = {Atmospheric aerosols, Ultrafine particles, Cascade impactor, TXRF, Elemental size distribution}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, address = {Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.105852}, stag_bib_extends_levelofaccess = {NA}, author = {Os{\'a}n, J{\'a}nos and B{\"o}rcs{\"o}k, Endre and Cz{\"o}mp{\"o}ly, Ott{\'o} and Dian, Csenge and Groma, Veronika and Stabile, Luca and Hensey, Garry} } @Article { FrisvadJMCYGMH2020, subid = {1849}, title = {Survey of Models for Acquiring the Optical Properties of Translucent Materials}, journal = {Computer Graphics Forum}, year = {2020}, month = {5}, volume = {39}, number = {2}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {729-755}, keywords = {Appearance, graphics, BRDF, BTDF, BSSRDF,}, web_url = {https://diglib.eg.org/handle/10.1111/cgf14023}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Wiley}, language = {30}, ISSN = {0167-7055, 1467-8659}, DOI = {10.1111/cgf.14023}, stag_bib_extends_levelofaccess = {NA}, author = {Frisvad, J.R. and Jensen, S.A. and Madsen, J.S. and Correia, A. and Yang, L. and Gregersen, S.K.S. and Meuret, Y. and Hansen, P‐E.} } @Article { HuggettHMMZ2020, subid = {1863}, title = {Diagnostic tests for covid-19—improving accuracy and global harmonisation}, journal = {BMJ Opinion}, year = {2020}, month = {5}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, keywords = {SARS-CoV-2, RT-qPCR, molecular diagnosis}, web_url = {https://blogs.bmj.com/bmj/2020/05/06/diagnostic-tests-for-covid-19-improving-accuracy-and-global-harmonisation/}, misc2 = {EMPIR 2018: Health}, publisher = {BMJ Publishing Group Limited}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://blogs.bmj.com/bmj/2020/05/06/diagnostic-tests-for-covid-19-improving-accuracy-and-global-harmonisation/}, author = {Huggett, J. and Harris, K. and McHugh, T. and Moran-Gilad, J. and Zumla, A.} } @Article { MartinezABNVJHKVKL2020, subid = {1488}, title = {Step height standards based on self-assembly for 3D metrology of biological samples}, journal = {Measurement Science and Technology}, year = {2020}, month = {4}, day = {23}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {nanometrology, transfer standard, calibration, CSI, SWLI, AFM, traceability}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab8c6a}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, V. and Kassamakov, I. and Viitala, T. and J{\"a}rvinen, M. and Vainikka, T. and Nolvi, A. and Bermudez, C. and Artigas, R. and Martinez, P. and Korpelainen, V. and Lassila, A.} } @Article { GedRHO2020, subid = {1739}, title = {Assessing gloss under diffuse and specular lighting}, journal = {Color Research \& Application}, year = {2020}, month = {4}, day = {16}, volume = {45}, number = {4}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {591-602}, keywords = {Gloss, diffuse lighting, specular lighting, environmental effect, MLDS, Visual perception}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Wiley}, language = {30}, ISSN = {0361-2317, 1520-6378}, DOI = {10.1002/col.22510}, stag_bib_extends_levelofaccess = {NA}, author = {Ged, G. and Rabal‐Almazor, A‐M. and Himbert, M.E. and Obein, G.} } @Article { YacootKHDDRVN2020, subid = {1489}, title = {Multiple fibre interferometry setup for probe sample interaction measurements in atomic force microscopy}, journal = {Measurement Science and Technology}, year = {2020}, month = {4}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {atomic force microscopy, Fibre interferometry, probe sample interaction, nanometrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab85d8}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P. and Yacoot, A. and Hortv{\'i}k, V. and Duchoň, V. and Dongmo, H. and Rerucha, S. and Valtr, M. and Nečas, D.} } @Article { GeislerH2020, subid = {1567}, title = {Direct approach to determine the size setting error and size resolution of an optical particle counter}, journal = {Review of Scientific Instruments}, year = {2020}, month = {4}, volume = {91}, number = {4}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {045105}, keywords = {cleanroom, light scattering, airborne particle counters, particle contamination, quality assurance, size resolution, calibration}, misc2 = {EMPIR 2016: Environment}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5142907}, stag_bib_extends_levelofaccess = {NA}, author = {Geisler, Mathias and Hensey, Garry} } @Article { UbbelohdeHPWRGF2020, subid = {1470}, title = {Trapping and Counting Ballistic Nonequilibrium Electrons}, journal = {Physical Review Letters}, year = {2020}, month = {3}, day = {27}, volume = {124}, number = {12}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {127701}, keywords = {Ballistic transport, Electron relaxation, Semiconductor quantum optics, Full counting statistics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.124.127701}, stag_bib_extends_levelofaccess = {NA}, author = {Freise, L. and Gerster, T. and Reifert, D. and Weimann, T. and Pierz, K. and Hohls, F. and Ubbelohde, N.} } @Miscellaneous { vanderVeenHCPE, subid = {1459}, title = {EMUE-D2-1-Muticomponent Materials}, year = {2020}, month = {3}, day = {22}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Conformity assessment; Multicomponent material; Measurement uncertainty; Risk of false decision; Correlated test results}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3723507}, stag_bib_extends_levelofaccess = {NA}, author = {van der Veen, A.M.H and Harris, P and Cox, M.G and Pennecchi, F and Ellison, S.L.R} } @Article { KorpelainenXD2020, subid = {1476}, title = {Accurate tip characterization in critical dimension atomic force microscopy}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, day = {13}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {atomic force microscopy (AFM), critical dimension (CD), tip characterization, tip correction, morphological operation, dimensional nanometrology, 3D nanometrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab7fd2}, stag_bib_extends_levelofaccess = {NA}, author = {Dai, G. and Xu, L. and Hahm, K.} } @Article { LanevskiMVHKMAKI2020, subid = {1876}, title = {Determining the shape of reflectance reference samples for curved surface reflectors}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, volume = {31}, number = {5}, number2 = {16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials}, pages = {054010}, keywords = {reflectance, Monte-Carlo, reflective insulators, foil, curved surface, reference sample,additive manufacturing}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab68bf}, stag_bib_extends_levelofaccess = {NA}, author = {Lanevski, D. and Manoocheri, F. and Vaskuri, A. and Hameury, J. and Kersting, R. and Monte, C. and Adibekyan, A. and Kononogova, E. and Ikonen, E.} } @Article { LerouxHHJA2020, subid = {1483}, title = {Number-resolved imaging of 88 Sr atoms in a long working distance optical tweezer}, journal = {SciPost Physics}, year = {2020}, month = {3}, volume = {8}, number = {3}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {optical tweezers, atomic imaging}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Stichting SciPost}, language = {30}, ISSN = {2542-4653}, DOI = {10.21468/SciPostPhys.8.3.038}, stag_bib_extends_levelofaccess = {NA}, author = {Jackson, N. and Hanley, R. and Hill, M. and Leroux, F. and Adams, C.} } @Inbook { EschelbachLHG2020, subid = {1637}, title = {Untersuchung von Hauptreflektordeformationen an VGOS-Teleskopen mittels UAS}, year = {2020}, month = {3}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {pp. 411-424}, keywords = {VGOS, VLBI, Radioteleskop Reflektor, Paraboloid, Ring-Fokus-Paraboloid, Unmanned Aircraft System, Deformation, Photogrammetrie, GeoMetre, JRP 18SIB01}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Wichmann Verlag}, booktitle = {Ingenieurvermessung 20: Beitr{\"a}ge zum 19. Internationalen Ingenieurvermessungskurs}, language = {43}, ISBN = {978-3-87907-672-7}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://doi.org/10.5281/zenodo.4081146}, author = {Eschelbach, C. and L{\"o}sler, M. and Haas, R. and Greiwe, A.} } @Article { SalmiCVWVYKHS2020, subid = {1354}, title = {AlOx surface passivation of black silicon by spatial ALD: Stability under light soaking and damp heat exposure}, journal = {Journal of Vacuum Science \& Technology A}, year = {2020}, month = {3}, volume = {38}, number = {2}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {022401}, keywords = {Spatial Atomic Layer Deposition, aluminum oxide, surface passivation, light soaking, damp heat}, misc2 = {EMPIR 2016: Energy}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5133896}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, I.T.S. and Koutsourakis, G. and Virtanen, S. and Yli-Koski, M. and Wood, S. and V{\"a}h{\"a}nissi, V. and Salmi, E. and Castro, F.A. and Savin, H.} } @Article { RussellPavierPPDYHK2020, subid = {1477}, title = {Bringing real-time traceability to high-speed atomic force microscopy}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {Metrology, high-speed atomic force microscopy, traceability, nanometrology, nanotechnology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab7ca9}, stag_bib_extends_levelofaccess = {NA}, author = {Heaps, E. and Yacoot, A. and Dongmo, H. and Picco, L. and Payton, O.D. and Russell-Pavier, F.S and Klapetek, P} } @Article { LohHCF2020, subid = {1556}, title = {An Assessment of the Radio Frequency Electromagnetic Field Exposure from A Massive MIMO 5G Testbed}, journal = {2020 14th European Conference on Antennas and Propagation (EuCAP)}, year = {2020}, month = {3}, number2 = {18SIP02: 5GRFEX: Metrology for RF exposure from massive MIMO 5G base station: Impact on 5G network deployment}, pages = {1-5}, keywords = {radio frequency, electromagnetic fieldexposure, software defined radio, massive mimo, testbed}, web_url = {https://arxiv.org/abs/2008.04345}, misc2 = {EMPIR 2018: Support for Impact}, publisher = {IEEE}, language = {30}, DOI = {10.23919/EuCAP48036.2020.9135291}, stag_bib_extends_levelofaccess = {NA}, author = {Loh, T. H. and Heliot, F. and Cheadle, D. and Fielder, T.} } @Article { TxoperenaRLFERAPCCCCHMZK2020, subid = {1505}, title = {Towards standardisation of contact and contactless electrical measurements of CVD graphene at the macro-, micro- and nano-scale}, journal = {Scientific Reports}, year = {2020}, month = {2}, day = {21}, volume = {10}, number = {1}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, pages = {3223}, keywords = {Characterization and analytical techniques,Electronic properties and devices,Imaging techniques,Materials science,Nanoscience and technology,Physics,Graphene}, web_url = {https://www.nature.com/articles/s41598-020-59851-1}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-59851-1}, stag_bib_extends_levelofaccess = {NA}, author = {Melios, C. and Huang, N. and Callegaro, L. and Centeno, A. and Cultrera, A. and Cordon, A. and Panchal, V. and Arnedo, I. and Redo-Sanchez, A. and Etayo, D. and Fernandez, M. and Lopez, A. and Rozhko, S. and Txoperena, O. and Zurutuza, A. and Kazakova, O.} } @Article { PeralesMHV2020, subid = {1725}, title = {Evaluating the Graininess Attribute by Visual Scaling for Coatings with Special-Effect Pigments}, journal = {Coatings}, year = {2020}, month = {2}, day = {20}, volume = {10}, number = {316}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {1-10}, keywords = {special-effect pigments, graininess, psychophysical experiment, visual perception}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {MDPI}, address = {Basel (Switzerland)}, language = {30}, ISSN = {2079-6412}, DOI = {10.3390/coatings10040316}, stag_bib_extends_levelofaccess = {NA}, author = {Perales, E. and Mic{\'o}-Vicent, B. and Huraibat, K. and Viqueira, V.} } @Techreport { WeberHSRDBMHKMENHSW2020, subid = {1431}, title = {Document specifying rules for the secure use of DCC covering legal aspects of metrology}, journal = {Zenodo}, year = {2020}, month = {2}, day = {12}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {digital calibration certificate (DCC) cryptography minimum requirements data communication IoT-communication IoT-networking SmartCom}, web_url = {https://zenodo.org/record/3664211\#.XlO2QTFKhaR}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.3664211}, stag_bib_extends_levelofaccess = {NA}, author = {Weber, H. and Hutzschenreuter, D. and Smith, I. and Rhodes, S. and Dawkins, J. and Brown, C. and Maennel, O. and Hovhannisyan, K. and Kuosmanen, P. and Mustap{\"a}{\"a}, T. and Elo, T. and Nikander, P. and Heeren, W. and Sch{\"o}nhals, S. and Wiedenh{\"o}fer, Th.} } @Article { HuynhMOKABKI2020, subid = {1432}, title = {Measurement setup for differential spectral responsivity of solar cells}, journal = {Optical Review}, year = {2020}, month = {2}, day = {12}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Radiometry, Solar cell, Spectral responsivity, Efficacy, Electricity, Bifacial}, web_url = {https://link.springer.com/article/10.1007\%2Fs10043-020-00584-x}, misc2 = {EMPIR 2016: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1340-6000, 1349-9432}, DOI = {10.1007/s10043-020-00584-x}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}rh{\"a}, P. and Baumgartner, H. and Askola, J. and Kylm{\"a}nen, K. and Oksanen, B. and Maham, K. and Huynh, V. and Ikonen, E.} } @Article { CaraFFDTGSH2020, subid = {1568}, title = {Directed Self-Assembly of Polystyrene Nanospheres by Direct Laser-Writing Lithography}, journal = {Nanomaterials}, year = {2020}, month = {2}, volume = {10}, number = {2}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {280}, keywords = {directed self-assembly; nanospheres lithography; colloidal nanospheres; directlaser-writing}, web_url = {https://www.researchgate.net/publication/339105418_Directed_Self-Assembly_of_Polystyrene_Nanospheres_by_Direct_Laser-Writing_Lithography/link/5e3d9bbd458515072d88c1ab/download}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, address = {Postfach Basel CH-4005 Switzerland}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano10020280}, stag_bib_extends_levelofaccess = {NA}, author = {Cara, Eleonora and Ferrarese Lupi, Federico and Fretto, Matteo and De Leo, Natascia and Tortello, Mauro and Gonnelli, Renato and Sparnacci, Katia and Hensey, Garry} } @Article { HatanoMKTIGFTHGGB2020, subid = {1394}, title = {Spectroscopic investigations of negatively charged tin-vacancy centres in diamond}, journal = {New Journal of Physics}, year = {2020}, month = {1}, day = {23}, volume = {22}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {013048}, keywords = {colour centres, diamond, tin-vacancy centre, single photons,Fourier-limited Emission lines,electron–Phonon scattering}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab6631/pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab6631}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}rlitz, J. and Herrmann, D. and Thiering, G. and Fuchs, P. and Gandil, M. and Iwasaki, T. and Taniguchi, T. and Kieschnick, M. and Meijer, J. and Hatano, M. and Gali, A. and Becher, C.} } @Article { BurnellLRvHBNSRMHBFZM2020, subid = {1425}, title = {Diameter-independent skyrmion Hall angle observed in chiral magnetic multilayers}, journal = {Nature Communications}, year = {2020}, month = {1}, day = {22}, volume = {11}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {skyrmion motion, spin-orbit torque}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-14232-9}, stag_bib_extends_levelofaccess = {NA}, author = {Zeissler, K. and Finizio, S. and Barton, C. and Huxtable, A.J. and Massey, J. and Raabe, J. and Sadovnikov, A.V. and Nikitov, S.A. and Brearton, R. and Hesjedal, T. and van der Laan, G. and Rosamond, M.C. and Linfield, E.H. and Burnell, G. and Marrows, C.H.} } @Article { FortmeierSLMSHBBKSE2020, subid = {1374}, title = {Round robin comparison study on the form measurement of optical freeform surfaces}, journal = {Journal of the European Optical Society-Rapid Publications}, year = {2020}, month = {1}, volume = {16}, number = {1}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, keywords = {Freeform optical surfaces, Metrology, Interlaboratory comparison}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1990-2573}, DOI = {10.1186/s41476-019-0124-1}, stag_bib_extends_levelofaccess = {NA}, author = {Fortmeier, I. and Schachtschneider, R. and L{\'e}dl, V. and Matoušek, O. and Siepmann, J. and Harsch, A. and Beisswanger, R. and Bitou, Y. and Kondo, Y. and Schulz, M. and Elster, C.} } @Article { ChristensenJHTS2020, subid = {1498}, title = {Lasing on a narrow transition in a cold thermal strontium ensemble}, journal = {Physical Review A}, year = {2020}, month = {1}, volume = {101}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {superradiant laser, optical clock, ultra narrow laser}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.101.013819}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"a}ffer, S.A. and Tang, M. and Henriksen, M.R. and J{\o}rgensen, A.A. and Christensen, B.T.R.} } @Article { GuoPBGPKHU2020, subid = {1494}, title = {Interaction of nanoparticle properties and X-ray analytical techniques}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, volume = {35}, number = {5}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {1022-1033}, keywords = {X-ray Standing Wavefield, GIXRF, TXRF, NEXAFS, Core-Shell Nanoparticles}, web_url = {https://arxiv.org/abs/2004.02955}, misc2 = {EMPIR 2016: Environment}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/D0JA00049C}, stag_bib_extends_levelofaccess = {NA}, author = {Unterumsberger, R. and Honicke, P. and Kayser, Y. and Pollakowski-Herrmann, B. and Gholhaki, S. and Guo, Q. and Palmer, R.E. and Beckhoff, B.} } @Article { WanslebenVWBHBK2020, subid = {1685}, title = {Speciation of iron sulfide compounds by means of X-ray emission spectroscopy using a compact full-cylinder von Hamos spectrometer}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, volume = {35}, number = {11}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {2679-2685}, keywords = {-}, web_url = {https://arxiv.org/abs/2005.09509}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/D0JA00244E}, stag_bib_extends_levelofaccess = {NA}, author = {Wansleben, M. and Vinson, J. and W{\"a}hlisch, A. and Bzheumikhova, K. and Honicke, P. and Beckhoff, B. and Kayser, Y.} } @Article { CaraMSGRCDHKBMZCLBF2020, subid = {1829}, title = {Towards a traceable enhancement factor in surface-enhanced Raman spectroscopy}, journal = {Journal of Materials Chemistry C}, year = {2020}, volume = {8}, number = {46}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {16513-16519}, keywords = {Raman spectroscopy (SERS)}, misc2 = {EMPIR 2016: Environment}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2050-7526, 2050-7534}, DOI = {10.1039/D0TC04364H}, stag_bib_extends_levelofaccess = {NA}, author = {Cara, E. and Mandrile, L. and Sacco, A. and Giovannozzi, A.M. and Rossi, A.M. and Celegato, F. and De Leo, N. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Marchi, D. and Zoccante, A. and Cossi, M. and Laus, M. and Boarino, L. and Ferrarese Lupi, F.} } @Article { SachseBSHHKNL2020, subid = {2015}, title = {Colloidal bimetallic platinum–ruthenium nanoparticles in ordered mesoporous carbon films as highly active electrocatalysts for the hydrogen evolution reaction}, journal = {Catalysis Science \& Technology}, year = {2020}, volume = {10}, number = {7}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {2057-2068}, keywords = {Hydrogen, Nanoparticles, Hyrdrogen evolution reaction (HER)}, web_url = {https://pubs.rsc.org/en/content/articlelanding/2020/CY/C9CY02285F\#!divAbstract}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2044-4753, 2044-4761}, DOI = {10.1039/C9CY02285F}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Bernsmeier, D. and Schmack, R. and H{\"a}usler, I. and Hertwig, A. and Kraffert, K. and Nissen, J. and Lewis, H.} } @Article { BinkowskiBCHZB2020, subid = {1557}, title = {Quasinormal mode expansion of optical far-field quantities}, journal = {Physical Review B}, year = {2020}, volume = {102}, number = {3}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {035432}, keywords = {near field to far field transformation, numerical simulation}, web_url = {https://arxiv.org/abs/2003.11305}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.102.035432}, stag_bib_extends_levelofaccess = {NA}, author = {Binkowski, F. and Betz, F. and Colom, R. and Hammerschmidt, M. and Zschiedrich, L. and Burger, S.} } @Article { HodoroabaCTMOMPM2020, subid = {1717}, title = {Towards 3D Understanding of Non-spherical Nanoparticles by Transmission Kikuchi Diffraction (TKD) for Improved Particle Size Distribution by Electron Microscopy}, journal = {Microscopy and Microanalysis}, year = {2020}, volume = {26}, number = {S2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {260}, keywords = {nanoparticles, 3D, Transmission Kikuchi Diffraction (TKD), TiO2, electron microscopy, size, shape}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, address = {Cambridge}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927620013999}, stag_bib_extends_levelofaccess = {NA}, author = {Hodoroaba, V.-D. and Cios, G. and Tokarski, T. and Mansfeld, U. and Ortel, E. and Mielke, J. and Pellegrino, F. and Maurino, V.} } @Article { RuhleH2020, subid = {1718}, title = {Towards Automated Electron Microscopy Image Segmentation for Nanoparticles of Complex Shape by Convolutional Neural Networks}, journal = {Microscopy and Microanalysis}, year = {2020}, volume = {26}, number = {S2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {1188}, keywords = {nanoparticles, automation, particle size distribution, convolutional neural networks}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, address = {Cambridge}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927620017262}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"u}hle, B. and Hodoroaba, V-D.} } @Proceedings { YilmazDH2020, subid = {2257}, title = {Calibration of Digital Dynamic Pressure Sensors}, journal = {SMSI 2020 Conference – Sensor and Measurement Science International}, year = {2020}, volume = {SMSI 2020}, number = {-}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, pages = {376-377}, keywords = {Dynamic, pressure, calibration, digital, sensor, DTI}, web_url = {https://www.ama-science.org/proceedings/details/3805}, misc2 = {EMPIR 2017: Industry}, publisher = {AMA Association for Sensors and Measurement}, event_place = {-}, event_name = {SMSI 2020 Conference – Sensor and Measurement Science International}, event_date = {22-06-2020 to 25-06-2020}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {978-3-9819376-2-6}, author = {Yilmaz, R. and Durgut, Y. and Hamarat, A.} } @Article { AkoWHS2020, subid = {1673}, title = {Communication and validation of smart data in IoT-networks}, journal = {Advances in Production Engineering \& Management}, year = {2020}, volume = {15}, number = {Number 1}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, pages = {pp 107–117}, keywords = {Metrology; Measurement metadata; Information and communication technology (ICT); Smart Data; Data communication; IoT-communication; IoT-networking; Digital calibration certificate}, web_url = {http://apem-journal.org/Archives/2020/Abstract-APEM15-1_107-117.html}, misc2 = {EMPIR 2017: Industry}, publisher = {Advances in Production Engineering \& Management}, language = {30}, DOI = {10.14743/apem2020.1.353}, stag_bib_extends_levelofaccess = {NA}, author = {Acko, B. and Weber, H. and Hutzschenreuter, D. and Smith, I.} } @Article { HorenzTBNAGV2020, subid = {1716}, title = {A Study on the Analysis of Particle Size Distribution for Bimodal Model Nanoparticles by Electron Microscopy}, journal = {Microscopy and Microanalysis}, year = {2020}, volume = {26}, number = {S2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {2282}, keywords = {nanoparticles, size traceability, bi-modal distribution, silica, gold, electron microscoopy}, web_url = {https://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/study-on-the-analysis-of-particle-size-distribution-for-bimodal-model-nanoparticles-by-electron-microscopy/B9157A370AC198219A734770694340F3}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, address = {Cambridge}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927620021054}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}renz, C. and Tache, O. and Bartczak, D. and Nunez, S. and Abad Alvaro, I. and Goenaga-Infante, H. and Vasile-Dan Hodoroaba, V-D.} } @Article { LinYCWGCLXSHCFCTYC2020, subid = {1760}, title = {Perpendicular Magnetic Anisotropy and Dzyaloshinskii-Moriya Interaction at an Oxide/Ferromagnetic Metal Interface}, journal = {Physical Review Letters}, year = {2020}, volume = {124}, number = {21}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {217202}, keywords = {DMI, spin waves}, web_url = {https://arxiv.org/abs/2006.14268}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.124.217202}, stag_bib_extends_levelofaccess = {NA}, author = {Lin , W. and Yang, B. and Chen, A.P. and Wu, X. and Guo, R. and Chen, S. and Liu, L. and Xie, Q. and Shu, X. and Hui, Y. and Chow, G.M. and Feng, Y. and Carlotti, G. and Tacchi, S. and Yang, H. and Chen, J.} } @Proceedings { HahtelaKLMMPYBGKMMPP2020, subid = {1810}, title = {Coulomb Blockade Thermometry on a Wide Temperature Range}, journal = {Proceedings of 2020 Conference on Precision Electromagnetic Measurements (CPEM 2020)}, year = {2020}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, keywords = {Temperature measurement, thermometers, cryogenics, nanoelectronics, tunneling, single electron devices}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Denver (Aurora), CO, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM 2020)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2101.03932}, author = {Hahtela, O.M. and Kemppinen, A. and Lehtinen, J. and Manninen, A.J. and Mykk{\"a}nen, E. and Prunnila, M. and Yurttag{\"u}l, N. and Blanchet, F. and Gramich, M. and Karimi, B. and Mannila, E.T. and Muhojoki, J. and Peltonen, J.T. and Pekola, J.P.} } @Miscellaneous { GarberoglioH, subid = {1886}, title = {Calculated values of the second dielectric and refractivity virial coefficients of helium, neon, and argon.}, journal = {J Res Natl Inst Stan}, year = {2020}, volume = {125}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {125022}, keywords = {argon, dielectric virials, helium, neon, path-integral Monte Carlo, pressure, refractivity virials, thermometry.}, web_url = {https://doi.org/10.6028/jres.125.022}, misc2 = {EMPIR 2018: SI Broader Scope}, language = {1}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.18434/m32225}, author = {Garberoglio, G. and Harvey, A.} } @Article { HertwigNOYFGTC2020, subid = {2016}, title = {ALD-ZnMgO and absorber surface modifications to substitute CdS buffer layers in co-evaporated CIGSe solar cells}, journal = {EPJ Photovoltaics}, year = {2020}, volume = {11}, number = {12}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {12}, keywords = {Thin film solar cells Cu(In,Ga)Se2 bufferZnMgO ALDsurface treatment}, misc2 = {EMPIR 2016: Energy}, publisher = {EDP Sciences}, language = {30}, ISSN = {2105-0716}, DOI = {10.1051/epjpv/2020010}, stag_bib_extends_levelofaccess = {NA}, author = {Hertwig, R. and Nishiwaki, S. and Ochoa, M. and Yang, S-C. and Feurer, T. and Gilshtein, E. and Tiwari, A.N. and Carron, R.} } @Proceedings { ZhangHLBAJN2019, subid = {1422}, title = {Deep Learning Applied to Attractor Images Derived from ECG Signals for Detection of Genetic Mutation}, journal = {2019 Computing in Cardiology Conference (CinC)}, year = {2019}, month = {12}, day = {30}, volume = {46}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {097}, keywords = {Symmetric Projection Attractor Reconstruction, ECG signals, transfer learning}, web_url = {http://www.cinc.org/archives/2019/pdf/CinC2019-097.pdf}, misc2 = {EMPIR 2018: Health}, publisher = {Computing in Cardiology}, event_place = {Singapore}, event_name = {Computing in Cardiology}, event_date = {08-09-2019 to 11-09-2019}, language = {30}, ISSN = {2325-887X}, DOI = {10.22489/CinC.2019.097}, stag_bib_extends_levelofaccess = {NA}, author = {Aston, P. and Lyle, J. and Bonet-Luz, E. and Huang, C. and Zhang, Y. and Jeevaratnam, K. and Nandi, M.} } @Article { ArrheniusBBdHM2019, subid = {1820}, title = {Hydrogen Purity Analysis: Suitability of Sorbent Tubes for Trapping Hydrocarbons, Halogenated Hydrocarbons and Sulphur Compounds}, journal = {Applied Sciences}, year = {2019}, month = {12}, day = {23}, volume = {10}, number = {1}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {120}, keywords = {hydrogen; fuel cells; hydrogen vehicle; sorbent; thermal desorption; hydrogen quality}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app10010120}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, Karine and Bohlen, Haleh and B{\"u}ker, Oliver and de Krom, Iris and Heikens, Dita and Murugan, Arul} } @Article { KlenovskyCSRCLHR2019, subid = {1360}, title = {Single-particle-picture breakdown in laterally weakly confining GaAs quantum dots}, journal = {Physical Review B}, year = {2019}, month = {12}, day = {13}, volume = {100}, number = {23}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {GaAs, quantum dot}, web_url = {https://journals.aps.org/prb/pdf/10.1103/PhysRevB.100.235425}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.235425}, stag_bib_extends_levelofaccess = {NA}, author = {Huber, D. and Lehner, B.U. and Csontosov{\'a}, D. and Reindl, M. and Schuler, S. and Covre Da Silva, S.F. and Klenovsk{\'y}, P. and Rastelli, A.} } @Article { RodtHSSHKFSR2019, subid = {1359}, title = {Deterministically fabricated spectrally-tunable quantum dot based single-photon source}, journal = {Optical Materials Express}, year = {2019}, month = {12}, day = {10}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {76}, keywords = {quantum dot, single-photon source}, web_url = {https://arxiv.org/ftp/arxiv/papers/1805/1805.10623.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {2159-3930}, DOI = {10.1364/OME.10.000076}, stag_bib_extends_levelofaccess = {NA}, author = {Schmidt, R. and Schmidt, M. and Helversen, M.V. and Fischbach, S. and Kaganskiy, A. and Schliwa, A. and Heindel, T. and Rodt, S. and Reitzenstein, S.} } @Proceedings { KazemipourWHYRGHZ2019, subid = {1662}, title = {Material Parameter Extraction in THz Domain, Simplifications and Sensitivity Analysis}, journal = {2019 IEEE Asia-Pacific Microwave Conference (APMC)}, year = {2019}, month = {12}, volume = {N/A}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {276-278}, keywords = {material characterization, extraction method, THz domain, sensitivity coefficient, measurement uncertainty}, web_url = {https://doi.org/10.5281/zenodo.4243025}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Singapore}, event_name = {019 IEEE Asia-Pacific Microwave Conference (APMC)}, event_date = {10-12-2019 to 13-12-2019}, language = {30}, ISBN = {978-1-7281-3517-5}, ISSN = {N/A}, DOI = {10.1109/APMC46564.2019.9038523}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Wollensack, M. and Hoffmann, J. and Yee, S-K. and R{\"u}fenacht, J. and G{\"a}umann, G. and Hudlicka, M. and Zeier, M.} } @Article { LeviHVBH2019, subid = {1398}, title = {Cavity-enhanced non-destructive detection of atoms for an optical lattice clock}, journal = {Optics Express}, year = {2019}, month = {12}, volume = {27}, number = {26}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {37099}, keywords = {Non destructive measurement, Optical Lattice Clocks}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.037099}, stag_bib_extends_levelofaccess = {NA}, author = {Hobson, R. and Bowden, W. and Vianello, A. and Hill, I.R. and Gill, P.} } @Article { GomezFGLDBMFMMGARPABCDH2019, subid = {1260}, title = {Hydrogen fuel quality from two main production processes: Steam methane reforming and proton exchange membrane water electrolysis}, journal = {Journal of Power Sources}, year = {2019}, month = {12}, volume = {444}, number2 = {15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications}, pages = {227170}, keywords = {Fuel cell electrical vehicles, ISO14687, Gas analysis, Hydrogen production, Hydrogen quality}, web_url = {https://www.sciencedirect.com/science/article/pii/S0378775319311632}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0378-7753}, DOI = {10.1016/j.jpowsour.2019.227170}, stag_bib_extends_levelofaccess = {NA}, author = {Bacquart, T. and Arrhenius, K. and Persijn, S. and Rojo, A. and Aupr{\^e}tre, F. and Gozlan, B. and Moore, N. and Morris, A. and Fischer, A. and Murugan, A. and Bartlett, S. and Doucet, G. and Laridant, F. and Gernot, E. and Fern{\'a}ndez, T. E. and G{\'o}mez, C. and Carr{\'e}, M. and De Reals, G. and Haloua, F.} } @Article { FitzGeraldMSH2019, subid = {1547}, title = {Development of a new primary humidity measurement standard}, journal = {Measurement Science and Technology}, year = {2019}, month = {11}, day = {27}, volume = {31}, number = {2}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {024007}, keywords = {Development of a new primary humidity}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab4a54}, stag_bib_extends_levelofaccess = {NA}, author = {FitzGerald, C. and Mac Lochlainn, D. and Strnad, R. and Hodzic, N.} } @Article { HorenderSIDVA2019, subid = {1333}, title = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm−3}, journal = {Metrologia}, year = {2019}, month = {11}, day = {27}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, keywords = {aerosol, optical particle counter, calibration, clean room, counting efficiency}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, booktitle = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm\(^{−3}\)}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab5c84}, stag_bib_extends_levelofaccess = {NA}, author = {Vasilatou, Konstantina and Dirscherl, Kai and Iida, Kenjiro and Sakurai, Hiromu and Horender, Stefan and Auderset, Kevin} } @Article { GeislerNBHSRKWHTHMSU2019, subid = {1316}, title = {Determining the Thickness and Completeness of the Shell of Polymer Core–Shell Nanoparticles by X-ray Photoelectron Spectroscopy, Secondary Ion Mass Spectrometry, and Transmission Scanning Electron Microscopy}, journal = {The Journal of Physical Chemistry C}, year = {2019}, month = {11}, day = {26}, number2 = {17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses}, keywords = {Nanoparticles, core-shell, XPS, SIMS, T-SEM, polymer}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.9b09258}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, A. and Heinrich, T. and Tougaard, S. and Werner, W. S. M. and Hronek, M. and Kunz, V. and Radnik, J. and Stockmann, J. M. and Hodoroaba, V-D. and Benemann, S. and Nirmalananthan-Budau, N. and Gei{\ss}ler, D. and Sparnacci, K. and Unger, W. E. S } } @Article { BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019, subid = {2340}, title = {The Metrological Traceability, Performance and Precision of European Radon Calibration Facilities}, journal = {International Journal of Environmental Research and Public Health}, year = {2019}, month = {11}, day = {21}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, keywords = {radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.3390/ijerph182212150}, stag_bib_extends_levelofaccess = {NA}, author = {Beck, T.R. and Antohe, A. and Cardellini, F. and Cucoş, A. and Fialova, E. and Grossi, C. and Hening, K. and Jensen, J. and Kastratović, D. and Krivoš{\'i}k, M. and Lobner, P. and Luca, A. and Maringer, F.J. and Michielsen, N. and Otahal, P.P.S. and Quindos, L. and Rabago, D. and Sainz, C. and Sz{\"u}cs, L. and Teodorescu, T. and Tolinsson, C. and Tugulan, C.L. and Turtiainen, T. and Vargas, A. and Vosahlik, J. and Vukoslavovic, G. and Wiedner, H. and Wołoszczuk, K.} } @Article { SchneiderHHCFKRSTR2019, subid = {1362}, title = {Resolving the temporal evolution of line broadening in single quantum emitters}, journal = {Optics Express}, year = {2019}, month = {11}, day = {18}, volume = {27}, number = {24}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {35290}, keywords = {single quantum emitter, GaAs and In(Ga)As quantum dots}, web_url = {https://www.osapublishing.org/DirectPDFAccess/0872F4C8-F64C-1DD3-BF83A9359A9A78C7_423274/oe-27-24-35290.pdf?da=1\&id=423274\&seq=0\&mobile=no}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.035290}, stag_bib_extends_levelofaccess = {NA}, author = {Schimpf, C. and Reindl, M. and Klenovsk{\'y}, P. and Fromherz, T. and Covre Da Silva, S.F. and Hofer, J. and Schneider, C. and H{\"o}fling, S. and Trotta, R. and Rastelli, A.} } @Manual { SmithHWB2019, subid = {1448}, title = {Document describing a universal and flexible structure for digital calibration certificates (DCC)}, year = {2019}, month = {11}, day = {11}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {digital calibration certificate (DCC), data communication, IoT-communication, IoT-networking SmartCom, minimum requirements}, misc2 = {EMPIR 2017: Industry}, publisher = {SmartCom}, language = {30}, DOI = {10.5281/zenodo.3696567}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, I. and Hutzschenreuter, D. and Wiedenh{\"o}fer, T. and Brown, C.} } @Manual { EloKnKALSZSFRBSHWHHHNHMMHP2019, subid = {1433}, title = {SmartCom Digital System of Units (D-SI) Guide for the use of the metadata-format used in metrology for the easy-to-use, safe, harmonised and unambiguous digital transfer of metrological data}, year = {2019}, month = {11}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Digital-SI (D-SI) metrology data digital exchange format SmartCom data communication IoT-networking IoT-communication}, web_url = {https://zenodo.org/record/3522631\#.XlTbaTFKhaQ}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.3522631}, stag_bib_extends_levelofaccess = {NA}, author = {Elo, T. and Kuosmanen, P. and  Mustap{\"a}{\"a}, T. and Klobucar, R. and Acko, B. and Linkeov{\'a}, I. and S{\'y}kora, J. and Zelen{\'y}, V. and Smith, I. and Forbes, A. and Rhodes, S. and Brown, C. and Scheibner, A. and Hackel, S.G. and Wiedenh{\"o}fer, T. and Heeren, W. and Haertig, F. and Hutschenreuter, D. and Nikander, P. and Hovhannisyan, K. and Maennel, O. and Muller, B. and Heindorf, L. and Paciello, V.} } @Techreport { SmithWHHB2019, subid = {1434}, title = {D-SI in Short - Digital brochure on establishing the use of units in digitalised communication}, journal = {Zenodo}, year = {2019}, month = {11}, volume = {1}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Digital-SI (D-SI) data communication IoT-communication IoT-networking metrology data SmartCom digital exchange format}, web_url = {https://zenodo.org/record/3522074\#.XlTiRTFKhaQ}, misc2 = {EMPIR 2017: Industry}, publisher = {SmartCom}, language = {30}, DOI = {10.5281/zenodo.3522074}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, I. and Wiedenh{\"o}fer, T. and Haertig, F. and Hutschenreuter, D. and Brown, C.} } @Proceedings { EschelbachLHG2019, subid = {1421}, title = {Measuring Focal Length Variations of VGOS TelescopesUsing Unmanned Aerial Systems}, journal = {Proceedings of the 24th European VLBI Group for Geodesy and Astrometry Working Meeting}, year = {2019}, month = {11}, volume = {24}, number = {2019}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {17-21}, keywords = {VGOS, Ring-focus paraboloid, Antennadeformation, Focal length, Unmanned aircraft system}, web_url = {http://www.oan.es/evga2019/24_EVGA_2019_Las_Palmas.pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Centro Nacional de Informaci{\'o}n Geogr{\'a}fica (CNIG). 2019.}, address = {Madrid}, event_place = {Las Palmas de Gran Canaria, Spain}, event_name = {24th European VLBI Group for Geodesy and Astrometry}, event_date = {17-03-2019 to 19-03-2019}, language = {30}, ISBN = {978-84-416-5634-5}, DOI = {10.7419/162.08.2019}, stag_bib_extends_levelofaccess = {NA}, author = {Eschelbach, C. and Loesler, M. and Haas, R. and Greiwe, A.} } @Article { KipperHLBPHLV2019, subid = {1406}, title = {Retention of acidic and basic analytes in reversed phase column using fluorinated and novel eluent additives for liquid chromatography-tandem mass spectrometry}, journal = {Journal of Chromatography A}, year = {2019}, month = {11}, volume = {in press}, number = {in press}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {460667}, keywords = {Eluent additivesHFIPHFTBPPNFTBRetention mechanisms}, web_url = {https://www.sciencedirect.com/search/advanced?qs=Retention\%20of\%20acidic\%20and\%20basic\&pub=Journal\%20of\%20Chromatography\%20A\&cid=271409\&volumes=0\&lastSelectedFacet=volumes}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-9673}, DOI = {10.1016/j.chroma.2019.460667}, stag_bib_extends_levelofaccess = {NA}, author = {Veigure, R. and Lossmann, K. and Hecht, M. and Parman, E. and Born, R. and Leito, I. and Herodes, K. and Kipper, K.} } @Article { BinghamWSTMFZSRKH2019, subid = {1353}, title = {Formation of N{\'e}el-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy}, journal = {Physical Review B}, year = {2019}, month = {10}, day = {25}, volume = {100}, number = {14}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {144435}, keywords = {Skyrmions, DMI, spin waves}, web_url = {https://arxiv.org/abs/1910.04515}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.144435}, stag_bib_extends_levelofaccess = {NA}, author = {Saha, S. and Zelent, M. and Finizio, S. and Mruczkiewicz, M. and Tacchi, S. and Suszka, A. K. and Wintz, S. and Bingham, N. S. and Raabe, J. and Krawczyk, M. and Heyderman, L. J.} } @Article { KayserUWBWHH2019, subid = {1269}, title = {Experimental determination of line energies, line widths and relative transition probabilities of the Gadolinium L x-ray emission spectrum}, journal = {Metrologia}, year = {2019}, month = {10}, day = {21}, volume = {56}, number = {6}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {065007}, keywords = {x-ray spectrometry, von Hamos spectrometer, rare earth metal, x-ray metrology, HAPG, gadolinium, atomic fundamental parameters}, web_url = {https://arxiv.org/abs/1903.08085}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab40d2}, stag_bib_extends_levelofaccess = {NA}, author = {Wansleben, M. and Kayser, Y. and Honicke, P. and Holfelder, I. and W{\"a}hlisch, A. and Unterumsberger, R. and Beckhoff, B.} } @Article { MarcqMHGFCBBTBMWW2019, subid = {1248}, title = {RadCalNet: A Radiometric Calibration Network for Earth Observing Imagers Operating in the Visible to Shortwave Infrared Spectral Range}, journal = {Remote Sensing}, year = {2019}, month = {10}, day = {16}, volume = {11}, number = {2401}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {20}, keywords = {RadCalNet, CEOS, radiometric calibration, SI-traceable, surface reflectance, network, instrument}, web_url = {https://doi.org/10.3390/rs11202401\&\#160;}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs11202401}, stag_bib_extends_levelofaccess = {NA}, author = {Bouvet, M. and Thome, K. and Berthelot, B. and Bialek, A. and Czapla-Myers, J. and Fox, N. and Goryl, P. and Henry, P. and Ma, L. and Marcq, S. and Meygret, A. and Wenny, B. and Woolliams, E.} } @Proceedings { HoogenboomHRY2019, subid = {1301}, title = {Reliable Power Transformer Efficiency Tests}, journal = {Proceedings 5th International Colloquium “Transformer Research and Asset Management” Opatija/Croatia, October 09 – 12, 2019}, year = {2019}, month = {10}, day = {11}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {power transformers, efficiency, loss, loss measurement, reliability, calibration, accuracy, uncertainty}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Opatija, Croatia}, event_name = {5th International Colloquium “Transformer Research and Asset Management” Opatija/Croatia}, event_date = {09-10-2019 to 12-10-2019}, language = {30}, DOI = {10.5281/zenodo.3559845}, stag_bib_extends_levelofaccess = {NA}, author = {Hoogenboom, D. and Houtzager, E. and Rietveld, G. and Ye, G.} } @Article { NajmanovaPP2019, subid = {1326}, title = {Intraocular pressure response affected by changing of sitting and supine positions}, journal = {Acta Ophthalmologica}, year = {2019}, month = {10}, day = {10}, volume = {n/a}, number = {n/a}, number2 = {16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements}, pages = {1-5}, keywords = {baseline, body position, intraocular pressure, sitting, supine, time course}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1111/aos.14267}, misc2 = {EMPIR 2016: Research Potential}, publisher = {Wiley}, language = {30}, ISSN = {1755-375X, 1755-3768}, DOI = {10.1111/aos.14267}, stag_bib_extends_levelofaccess = {NA}, author = {Najmanov{\'a}, E. and Pluh{\'a}ček, F. and Haklov{\'a}, M} } @Article { LaihoSSKHSBWR2019, subid = {2617}, title = {Photon-number parity of heralded single photons from a Bragg-reflection waveguide reconstructed loss-tolerantly via moment generating function}, journal = {New Journal of Physics}, year = {2019}, month = {10}, volume = {21}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {103025}, keywords = {factorial moment of photon number, photon-number parity, moment generating function, parametric down-conversion, Bragg-reflection waveguide, transition-edge sensor}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab42ae}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab42ae}, stag_bib_extends_levelofaccess = {NA}, author = {Laiho, K. and Schmidt, M. and Suchomel, H. and Kamp, M. and H{\"o}fling, S. and Schneider, C. and Beyer, J. and Weihs, G. and Reitzenstein, S.} } @Article { BurgerHZB2019, subid = {1249}, title = {Modal analysis for nanoplasmonics with nonlocal material properties}, journal = {Physical Review B}, year = {2019}, month = {10}, volume = {100}, number = {15}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {155406}, keywords = {Nanophotonics, Plasmonic, Drude model, Electromagnetic wave theory, Finite-element method}, web_url = {https://arxiv.org/abs/1906.01941}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.155406}, stag_bib_extends_levelofaccess = {NA}, author = {Binkowski, F. and Zschiedrich, L. and Hammerschmidt, M. and Burger, S.} } @Article { BochudNHLJJ2019, subid = {1231}, title = {Development and validation of a double focalizing magnetic spectrometer for beta spectrum measurements}, journal = {Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment}, year = {2019}, month = {10}, volume = {942}, number = {21 October}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {162384}, keywords = {magnetic spectrometer, beta shape measurement, acquisition system, Cl-36}, web_url = {https://reader.elsevier.com/reader/sd/pii/S0168900219309684?token=9907411027790E1C7A6500A4337D2D10E57E40E772BECF66298808C0FD62E4F989D02F38F9DA80F8EEB0FCC5EF556A53}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2019.162384}, stag_bib_extends_levelofaccess = {NA}, author = {Juget, F. and Juget, F. and Lorusso, G. and Haefeli, G. and Nedjadi, Y. and Bochud, F.} } @Article { EschelbachHLG2019, subid = {1222}, title = {Gravitational deformation of ring-focus antennas for VGOS: first investigations at the Onsala twin telescopes project}, journal = {Journal of Geodesy}, year = {2019}, month = {9}, day = {28}, volume = {2019}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {1-19}, keywords = {Ring-focus paraboloid, Radio telescope, Antenna deformation, VLBI, VGOS, Signal path variation, SQP, Reverse engineering, Photogrammetry, Unmanned aircraft system}, web_url = {https://link.springer.com/content/pdf/10.1007\%2Fs00190-019-01302-5.pdf\&\#10;https://link.springer.com/article/10.1007/s00190-019-01302-5}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Berlin Heidelberg}, language = {30}, ISSN = {0949-7714}, DOI = {10.1007/s00190-019-01302-5}, stag_bib_extends_levelofaccess = {NA}, author = {L{\"o}sler, M. and Haas, R. and Eschelbach, C. and Greiwe, A.} } @Proceedings { BagciHYTAGD2019, subid = {1325}, title = {Improvement of dynamic pressure standard for calibration of dynamic pressure transducers}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number = {2019}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, keywords = {dynamic pressure, measurement, calibration, drop mass, dynamic calibration machine}, misc2 = {EMPIR 2017: Industry}, publisher = {EDP Sciences}, address = {17 av. du Hoggar PA de Courtaboeuf BP 112 PA de Courtaboeuf BP 112 Les Ulis cedex A 91944 France}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201927009}, stag_bib_extends_levelofaccess = {NA}, author = {Durgut, Y. and Ganioglu, O. and Aydemir, B. and Turk, A. and Yilmaz, R. and Hamarat, A. and Bağcı, E.} } @Article { BurgerHSGSR2019, subid = {1291}, title = {Benchmarking Five Global Optimization Approaches for Nano-optical Shape Optimization and Parameter Reconstruction}, journal = {ACS Photonics}, year = {2019}, month = {9}, day = {17}, volume = {6}, number = {11}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {2726-2733}, keywords = {shape optimization, parameter reconstruction, machine learning, global optimization, Bayesian optimization}, web_url = {https://arxiv.org/abs/1809.06674}, misc2 = {EMPIR 2017: Fundamental}, publisher = {ACS}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.9b00706}, stag_bib_extends_levelofaccess = {NA}, author = {Schneider, P.I. and Garcia Santiago, X. and Soltwisch, Vi. and Hammerschmidt, M. and Burger, S. and Rockstuhl, C.} } @Article { MayrBWHFMRWZ2019, subid = {1370}, title = {Deterministic Field-Free Skyrmion Nucleation at a Nanoengineered Injector Device}, journal = {Nano Letters}, year = {2019}, month = {9}, day = {17}, volume = {19}, number = {10}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {7246-7255}, keywords = {Skyrmion; nanomagnetism, spin-orbit torque}, web_url = {https://arxiv.org/abs/1902.10435}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Contract \#: 19-0000016470-01 PO \#: 6000110532 Columbus Ohio 43210 United States}, language = {30}, ISSN = {1530-6984, 1530-6992}, DOI = {10.1021/acs.nanolett.9b02840}, stag_bib_extends_levelofaccess = {NA}, author = {Finizio, S. and Zeissler, K. and Wintz, S. and Mayr, S. and We{\ss}els, T. and Huxtable, A.J. and Burnell, G. and Marrows, C.H. and Raabe, J.} } @Article { BremerFPRSHW2019, subid = {1804}, title = {Cesium‐Vapor‐Based Delay of Single Photons Emitted by Deterministically Fabricated Quantum Dot Microlenses}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {9}, day = {12}, volume = {3}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1900071}, keywords = {atomic vapors delays deterministic fabrication quantum dots single‐photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900071}, stag_bib_extends_levelofaccess = {NA}, author = {Bremer, L. and Fischbach, S. and Park, S‐I. and Rodt, S. and Song, J‐Dong. and Heindel, T. and Weber, N.} } @Proceedings { KazemipourHSWRZ2019, subid = {2799}, title = {THz Detector Calibration Based on Microwave Power Standards}, journal = {2019 International Conference on Electromagnetics in Advanced Applications (ICEAA)}, year = {2019}, month = {9}, volume = {N/A}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {0402-0403}, keywords = {Detectors, Optical waveguides, Calibration, Metrology, Scattering parameters, Standards}, web_url = {https://doi.org/10.5281/zenodo.5771103}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Granada, Spain}, event_name = {2019 International Conference on Electromagnetics in Advanced Applications (ICEAA)}, event_date = {09-09-2019 to 13-09-2019}, language = {30}, ISBN = {978-1-7281-0564-2}, ISSN = {N/A}, DOI = {10.1109/ICEAA.2019.8879374}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hoffmann, J. and Stalder, D. and Wollensack, M. and R{\"u}fenacht, J. and Zeier, M.} } @Article { KorpelainenGKAS2019, subid = {1298}, title = {Atomic force microscope with an adjustable probe direction and piezoresistive cantilevers operated in tapping-mode / Im Tapping-Modus betriebenes Rasterkraftmikroskop mit einstellbarer Antastrichtung und piezoresistiven Cantilevern}, journal = {tm - Technisches Messen}, year = {2019}, month = {9}, volume = {86}, number = {s1}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {12-16}, keywords = {Rasterkraftmikroskopie; piezoresistive Cantilever; Nanomessmaschine}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2196-7113, 0171-8096}, DOI = {10.1515/teme-2019-0035}, stag_bib_extends_levelofaccess = {NA}, author = {Schaude, J. and Albrecht, J. and Kl{\"o}pzig, U. and Gr{\"o}schl, A.C. and Hausotte, Tino} } @Article { KokHvvR2019, subid = {1380}, title = {Current waveforms of household appliances for advanced meter testing}, journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {Electromagnetic compatibility , static meters , interference , accuracy , testing , household appliances}, tags = {SEG}, web_url = {https://zenodo.org/record/3582391\#.XiG1P3u7KUl}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/AMPS.2019.8897771}, stag_bib_extends_levelofaccess = {NA}, author = {van Leeuwen, R. and van den Brom, H. and Hoogenboom, D. and Kok, G. and Rietveld, G.} } @Article { vanLeeuwenHMvR2019, subid = {1378}, title = {A Testbed for Static Electricity Meter Testing with Conducted EMI}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {Static meters, energy measurement, standards, Electromagnetic Compatibility, EMC immunity testing, electricity meters.}, tags = {SEG}, web_url = {https://zenodo.org/record/3580444\#.XiG0OHu7KUk}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/EMCEurope.2019.8872130}, stag_bib_extends_levelofaccess = {NA}, author = {van den Brom, H.E. and Marais, Z. and Hoogenboom, D. and van Leeuwen, R. and Rietveld, G.} } @Article { HoogenboomvRvMR2019, subid = {1379}, title = {Sensitivity of static energy meter reading errors to changes in non-sinusoidal load conditions}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {static energy meter; metering error; electromagnetic interference; accuracy; impedance; phase firing angle.}, tags = {SEG}, web_url = {https://zenodo.org/record/3580436\#.XiG00Xu7KUl}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/EMCEurope.2019.8872006}, stag_bib_extends_levelofaccess = {NA}, author = {Marais, Z. and van den Brom, H.E. and Rietveld, G. and van Leeuwen, R. and Hoogenboom, D. and Rens, J.} } @Proceedings { BermbachSHTL2019, subid = {1294}, title = {Guards and Watchdogs in One-Way Synchronization with Delay-Related Authentication Mechanisms}, journal = {2019 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, year = {2019}, month = {9}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-6}, keywords = {Synchronization, Protocols, Servers, Cryptography, Clocks, Global navigation satellite system}, tags = {SEG}, web_url = {https://doi.org/10.1109/ISPCS.2019.8886633}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Portland (Oregon) United States}, event_name = {International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication}, event_date = {22-09-2019 to 27-09-2019}, language = {30}, ISBN = {978-1-5386-7607-3, 978-1-5386-}, ISSN = {1949-0313, 1949-0305}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.17IND06.CA.20191126}, author = {Bermbach, R. and Sibold, D. and Heine, K. and Teichel, K. and Langer, M.} } @Article { LeferinkMHH2019_2, subid = {1384}, title = {Why Frequency Domain Tests Like IEC 61000-4-19 Are Not Valid; a Call for Time Domain Testing}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {5}, keywords = {IEEE Keywords Meters, Standards, Immunity testing, Frequency-domain analysis, Time-domain analysis, Electromagnetic interference INSPEC: Controlled Indexing electromagnetic compatibility, electromagnetic interference, frequency-domain analysis, IEC standards, time-domain analysis INSPEC: Non-Controlled Indexing IEC 61000-4-19, time domain testing, electrical equipment testing, electronic equipment, differential mode disturbances, electromagnetic interference, time domain signals, frequency domain tests, static energy meters, equipment immunity, instance nonlinear effects, digital sampling error effects, nonlinear time invariant effects, frequency 2.0 kHz to 150.0 kHz}, web_url = {https://research.utwente.nl/en/publications/why-frequency-domain-tests-like-iec-61000-4-19-are-not-valid-a-ca}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2019.8872070}, stag_bib_extends_levelofaccess = {NA}, author = {Have, B.t. and Hartman, T. and Moonen, N. and Leferink, F.} } @Article { LeferinkMHH2019_3, subid = {1383}, title = {Inclination of Fast Changing Currents Effect the Readings of Static Energy Meters}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {IEEE Keywords Meters, Impedance, Current measurement, Electromagnetic compatibility, Power supplies, Water pumps, Regulators INSPEC: Controlled Indexing amplifiers, electromagnetic interference, fluorescent lamps, LED lamps, power meters INSPEC: Non-Controlled Indexing fast changing currents effect, static energy meters, energy readings, reference meter, electromagnetic interference, fluorescent lightning, light emitting diode lamps, nondistorted mains power supply, four-quadrant amplifier, line impedance stabilization network, pulsed current waveform}, web_url = {https://research.utwente.nl/en/publications/inclination-of-fast-changing-currents-effect-the-readings-of-stat}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2019.8871982}, stag_bib_extends_levelofaccess = {NA}, author = {Have, B.t. and Hartman, T. and Moonen, N. and Leferink, F.} } @Article { LeferinkSAPH2019, subid = {1381}, title = {On-site Waveform Characterization at Static Meters Loaded with Electrical Vehicle Chargers}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {IEEE Keywords Current measurement, Meters, Time measurement, Electromagnetic interference, Time-domain analysis, Probes, Battery charge measurement INSPEC: Controlled Indexing battery storage plants, charge measurement, electric vehicle charging, electromagnetic interference, statistical distributions, time-domain analysis INSPEC: Non-Controlled Indexing electrical vehicle chargers, static meter misreadings, noisy waveforms, electric vehicle charging stations, on-site waveform characterization, EV charging stations, TEMPS software, time domain electromagnetic interference measurement and post-processing system, amplitude probability distribution, APD, EMI measurements, baseband digitizer}, tags = {SEG}, web_url = {https://research.utwente.nl/en/publications/on-site-waveform-characterization-at-static-meters-loaded-with-el}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2019.8871469}, stag_bib_extends_levelofaccess = {NA}, author = {Hartman, T. and Pous, M. and Azpurua, M.A. and Silva, F. and Leferink, F.} } @Article { TacheTMPMMH2019, subid = {1409}, title = {Towards Accurate Analysis of Particle Size Distribution for Non-Spherically Shaped Nanoparticles as Quality Control Materials}, journal = {Microscopy and Microanalysis}, year = {2019}, month = {8}, day = {31}, volume = {25}, number = {Suppl. 2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {2328-2329}, keywords = {Imaging;Nanoparticles;Non-spherical;Particle size distribution;Reference material}, web_url = {https://www.cambridge.org/core/services/aop-cambridge-core/content/view/CD48E9298865410124E22837D8CF73A0/S1431927619012376a.pdf/towards_accurate_analysis_of_particle_size_distribution_for_nonspherically_shaped_nanoparticles_as_quality_control_materials.pd}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927619012376}, stag_bib_extends_levelofaccess = {NA}, author = {Mansfeld, U. and Pellegrino, F. and Maurino, V. and Marguet, S. and Testard, F. and Tache, O. and Hodoroaba, V.-D.} } @Proceedings { CastroVWKHS2019, subid = {1202}, title = {Stability of the surface passivation properties of atomic layer deposited aluminum oxide in damp heat conditions}, journal = {AIP Conference Proceedings}, year = {2019}, month = {8}, day = {27}, volume = {2147}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {050003}, keywords = {Aluminium oxide, surface passivation, damp heat exposure, atomic layer deposition, degradation}, web_url = {https://aip.scitation.org/doi/pdf/10.1063/1.5123852?class=pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, event_place = {Leuven, Belgium}, event_name = {SiliconPV 2019, THE 9TH INTERNATIONAL CONFERENCE ON CRYSTALLINE SILICON PHOTOVOLTAICS}, event_date = {08-04-2019 to 10-04-2019}, language = {30}, ISBN = {978-0-7354-1892-9}, ISSN = {1551-7616}, DOI = {10.1063/1.5123852}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, I.T.S. and Koutsourakis, G. and Wood, S. and V{\"a}h{\"a}nissi, V. and Castro, F.A. and Savin, H.} } @Proceedings { KhamlichiG2015, subid = {1097}, title = {Calibration Setup For Traceable Measurements Of Very Fast Transients}, journal = {Proceedings of IHS2019}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {Calibration, setup, transients}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {International Symposium on High Voltage Engineering 2019}, language = {30}, DOI = {10.5281/zenodo.3238169}, stag_bib_extends_levelofaccess = {NA}, author = {Khamlichi, A. and Garnacho, F. and H{\"a}llstr{\"o}m, J. and Elg, A.P.} } @Proceedings { HallstromMPE2019, subid = {1184}, title = {High voltage topologies for very fast transient measurements}, journal = {Proceedings of ISH2019}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {high voltage measurement, fast transients}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3244216}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"a}llstr{\"o}m, J. and Meisner, J. and Passon, S. and Elg, A-P.} } @Proceedings { ViniciusdLYHHFL2019, subid = {1187}, title = {Comparison of Measuring Systems for Puncture Test According to IEC 61211}, journal = {21st International Symposium on High Voltage Engineering}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {puncture test, measurement}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3243452}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Yan, W. and Li, Y. and Vinicius, M. and Filho, O. and Laiho, M.} } @Proceedings { KaramanDMEBHHRGG2019, subid = {1186}, title = {Comparison of PD calibration capabilities in four National Metrology Institutes down to 0.1 pC}, journal = {Proceedings of ISH2019}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {partial discharge, calibration}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3243449}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Bergman, A.E. and Elg, A-P. and Merev, A. and Dedeoğlu, S. and Karaman, I. and Rovira, J. and Garcia, T. and Garnacho, F.} } @Proceedings { NieminenHRGGE2019, subid = {1212}, title = {Traceable measurement of transmitted overvoltages in instrument transformers}, journal = {Proceedings of ISH2019}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {Voltage instrument transformers, Transient overoltages, traceability}, tags = {SEG}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering (ISH2019)}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3244088}, stag_bib_extends_levelofaccess = {NA}, author = {Nieminen, T. and H{\"a}llstr{\"o}m, J. and Rovira, J. and Garcia, T. and Garnacho, F. and Elg, A-P.} } @Proceedings { LehtonenHTSHM2019, subid = {1303}, title = {Measuring Losses of an Air-Core Shunt Reactor with an Advanced Loss Measuring System}, journal = {Proceedings of ISH 2019}, year = {2019}, month = {8}, day = {26}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {Reactor, loss measurement, voltage divider, loss measuring system}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3521194}, stag_bib_extends_levelofaccess = {NA}, author = {Havunen, J. and Suomalainen, E-P. and Tornberg, J. and H{\"a}llstr{\"o}m, J. and Lehtonen, T. and Mervi{\"o}, A.} } @Proceedings { VentreMDBCFPPRSTBASSGHBZFDKL2019, subid = {1200}, title = {Metrology for Inductive Charging of Electric Vehicles (MICEV)}, journal = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, year = {2019}, month = {8}, day = {19}, volume = {Electrical}, number = {2019 AEIT}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {6 pages}, keywords = {Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety}, tags = {SEG}, web_url = {http://arxiv.org/abs/1908.11108}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Turin (Italy)}, event_name = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, event_date = {02-07-2019 to 04-07-2019}, language = {30}, ISBN = {978-8-8872-3743-6}, ISSN = {0018-9219}, DOI = {10.23919/EETA.2019.8804498}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Bottauscio, O. and Harmon, S. and Guilizzoni, R. and Schilling, F. and Schmidt, M. and Ankarson, P. and Bergsten, T. and Tammi, K. and Sainio, P. and Romero, J.B. and Puyal, E.L. and Pichon, L. and Freschi, F. and Cirimele, V. and Bauer, P. and Dong, J. and Maffucci, A. and Ventre, S. and Femia, N. and Di Capua, G. and Kuster, N. and Liorni, I.} } @Article { GomaZHB2019, subid = {1331}, title = {Comparison of PENH, FLUKA and Geant4/TOPAS for absorbed dose calculations in air cavities representing ionization chambers in high‐energy photon and proton beams}, journal = {Medical Physics}, year = {2019}, month = {8}, day = {19}, volume = {46}, number = {10}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {4639-4653}, keywords = {beam quality correction factors, dosimetry, high‐energy photon and proton radiation, Monte Carlo simulation, radiation therapy}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.13737}, stag_bib_extends_levelofaccess = {NA}, author = {Baumann, K.‐S. and Horst, F. and Zink, K. and Gom{\`a}, C.} } @Article { ChouhaniFiPBJVH2019, subid = {2041}, title = {A Unique Interactive Nanostructure Knitting based Passive Sampler Adsorbent for Monitoring of Hg2+ in Water}, journal = {Sensors}, year = {2019}, month = {8}, volume = {19}, number = {15}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {3432}, keywords = {Nanostructure Knitting based Passive Sampler , Hg2+, Water}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s19153432}, stag_bib_extends_levelofaccess = {NA}, author = {Chouhan, R.S. and Žitko, G. and Fajon, V. and Živković, I. and Pavlin, M. and Berisha, S. and Jerman, I. and Vesel, A. and Horvat, M.} } @Article { KotilHHSK2019, subid = {1242}, title = {Analysis of elemental composition and porosity of mesoporous iridium-titanium mixed oxide thin films for energy application by SEM/EDS}, journal = {Microscopy and Microanalysis}, year = {2019}, month = {8}, volume = {25}, number = {S2}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {1770-1771}, keywords = {oxide thin films}, misc2 = {EMPIR 2016: Energy}, publisher = {Cambridge University Press (CUP)}, language = {30}, ISSN = {1431-9276, 1435-8115}, DOI = {10.1017/S1431927619009589}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Hodoroaba, V.-D. and Hertwig, A. and Kotil, L. and Kraehnert, R.} } @Article { ShardCHS2019, subid = {1182}, title = {Summary of ISO/TC 201 Standard: ISO 22415—Surface chemical analysis—Secondary ion mass spectrometry—Method for determining yield volume in argon cluster sputter depth profiling of organic materials}, journal = {Surface and Interface Analysis}, year = {2019}, month = {7}, day = {15}, number2 = {15SIP02: ISOChemDepth: An International Standard for Reliable Chemical Depth Profiling of Organic Materials}, keywords = {ISO, standard, SIMS, sputtering, yield volumes}, web_url = {https://doi.org/10.1002/sia.6686}, misc2 = {EMPIR 2015: Support for Impact}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421, 1096-9918}, DOI = {10.1002/sia.6686}, stag_bib_extends_levelofaccess = {NA}, author = {Shard, A.G. and Havelund, R. and Seah, M.P. and CLIFFORD, C.} } @Article { RedshawQPMIHGEDBSRY2019, subid = {1232}, title = {Direct determination of the La138\(\beta\)-decay Q value using Penning trap mass spectrometry}, journal = {Physical Review C}, year = {2019}, month = {7}, day = {11}, volume = {100}, number = {1}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {014308}, keywords = {138La, high-precision Q-values, mass spectrometry, Penning trap}, web_url = {https://arxiv.org/abs/1904.12076v2}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9985, 2469-9993}, DOI = {10.1103/PhysRevC.100.014308}, stag_bib_extends_levelofaccess = {NA}, author = {Sandler, R. and Bollen, G. and Dissanayake, J. and Eibach, M. and Gulyuz, K. and Hamaker, A. and Izzo, C. and Mougeot, X. and Puentes, D. and Quarati, F. G. A. and Redshaw, M. and Ringle, R. and Yandow, I.} } @Proceedings { HoffmannVQZB2019, subid = {1610}, title = {Fabrication and Measurements of Inductive Devices for Scanning Microwave Microscopy}, journal = {2019 IEEE 19th International Conference on Nanotechnology (IEEE-NANO)}, year = {2019}, month = {7}, volume = {2019}, number = {-}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {1-4}, keywords = {calibration, doping profiles, inductors, scanning probe microscopy, silicon compounds}, web_url = {https://zenodo.org/record/4275929}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Macao}, event_name = {IEEE Nano}, event_date = {22-07-2019 to 26-07-2019}, language = {30}, ISBN = {Electronic ISBN: 978-1-7281-28}, ISSN = {Electronic ISSN: 1944-9380 Pri}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4275929}, author = {Hoffmann, J. and Vasyukov, D. and Quang, T. L. and Ziade, F. and Buchter, A.} } @Article { PollakowskiMKNDHB2019, subid = {1267}, title = {Reference-free grazing incidence x-ray fluorescence and reflectometry as a methodology for independent validation of x-ray reflectometry on ultrathin layer stacks and a depth-dependent characterization}, journal = {Journal of Vacuum Science \& Technology A}, year = {2019}, month = {7}, volume = {37}, number = {4}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {041502}, keywords = {XRR, GIXRF, nanolayers}, web_url = {https://arxiv.org/abs/1903.01196}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5094891}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Detlefs, B. and Nolot, E. and Kayser, Y. and M{\"u}hle, U. and Pollakowski, B. and Beckhoff, B.} } @Article { HonickeKMBPD2019, subid = {1270}, title = {Reference-free grazing incidence x-ray fluorescence and reflectometry as a methodology for independent validation of x-ray reflectometry on ultrathin layer stacks and a depth-dependent characterization}, journal = {Journal of Vacuum Science \& Technology A}, year = {2019}, month = {7}, volume = {37}, number = {4}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {041502}, keywords = {nanolayer stacks}, web_url = {https://arxiv.org/abs/1903.01196}, misc2 = {EMPIR 2016: Environment}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5094891}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Detlefs, B. and Kayser, Y. and M{\"u}hle, U. and Pollakowski, B. and Beckhoff, B.} } @Article { SilanderHFZA2019, subid = {1542}, title = {Gas equilibration gas modulation refractometry for assessment of pressure with sub-ppm precision}, journal = {Journal of Vacuum Science \& Technology B}, year = {2019}, month = {7}, volume = {37}, number = {4}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {042901}, keywords = {Gas equilibration gas modulation refractometry for assessment of pressure with sub-ppm precision}, misc2 = {EMPIR 2014: Industry}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/1.5090860}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Hausmaninger, T. and Forss{\'e}n, C. and Zelan, M. and Axner, O.} } @Article { VasilatouAH2019_2, subid = {1220}, title = {Facility for calibration of optical and condensation particle counters based on a turbulent aerosol mixing tube and a reference optical particle counter}, journal = {Review of Scientific Instruments}, year = {2019}, month = {7}, volume = {90}, number = {7}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {075111}, keywords = {optical particle counters, aerosol instrumentation, aerosol generation setup, turbulent flow tube, particle homogenization, isokinetic sampling ports, particle counter, Stable and reproducible aerosols, polystyrene latex particles}, web_url = {https://aip.scitation.org/doi/10.1063/1.5095853}, misc2 = {EMPIR 2016: Environment}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5095853}, stag_bib_extends_levelofaccess = {NA}, author = {Horender, S. and Auderset, K. and Vasilatou, K.} } @Article { KeyerMHtL2019, subid = {1319}, title = {Faulty Readings of Static Energy Meters Caused by Conducted Electromagnetic Interference from a Water Pump}, journal = {Renewable Energy and Power Quality Journal}, year = {2019}, month = {7}, volume = {17}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {15-19}, keywords = {Static Meter, Smart Meter, Electronic Meter, Conducted Interference, Electromagnetic Compatibility}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {AEDERMACP (European Association for the Development of Renewable Energies and Power Quality)}, language = {30}, ISSN = {2172-038X}, DOI = {10.24084/repqj17.205}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Hartman, T. and Moonen, N. and Keyer, C. and Leferink, F.} } @Article { SchmidtCOHBMLK2019, subid = {1340}, title = {A cryogenic radio-frequency ion trap for quantum logic spectroscopy of highly charged ions}, journal = {Review of Scientific Instruments}, year = {2019}, month = {7}, volume = {90}, number = {7}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {073201}, keywords = {Optical ClocksTrapped Ions}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5100594}, stag_bib_extends_levelofaccess = {NA}, author = {Leopold, T. and King, S. A. and Micke, P. and Bautista-Salvador, A. and Heip, J. C. and Ospelkaus, C. and Crespo L{\'o}pez-Urrutia, J. R. and Schmidt, P. O.} } @Article { MurugandBvAtH2019, subid = {1816}, title = {Measurement challenges for hydrogen vehicles}, journal = {International Journal of Hydrogen Energy}, year = {2019}, month = {7}, volume = {44}, number = {35}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {19326-19333}, keywords = {Hydrogen; Fuel cell; Vehicles; ISO 14687; Metrology; Measurement; Flow metering; Quality control}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2019.03.190}, stag_bib_extends_levelofaccess = {NA}, author = {Murugan, A. and de Huu, M. and Bacquart, T. and van Wijk, J. and Arrhenius, K. and te Ronde, I. and Hemfrey, D.} } @Article { AdibekyanKMH2019, subid = {1287}, title = {Characterization, calibration and validation of an industrial emissometer}, journal = {Journal of Sensors and Sensor Systems}, year = {2019}, month = {6}, day = {27}, volume = {8}, number = {1}, number2 = {16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials}, pages = {233-242}, keywords = {emissivity, TIR 100-2 emissometer, characterization, calibration, reflective foils}, web_url = {https://www.j-sens-sens-syst.net/8/233/2019/}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-8-233-2019}, stag_bib_extends_levelofaccess = {NA}, author = {Kononogova, Elena and Adibekyan, Albert and Monte, Christian and Hollandt, J{\"o}rg} } @Article { HibberdMOCORMOPVHC2019, subid = {1159}, title = {Integrating informatics tools and portable sequencing technology for rapid detection of resistance to anti-tuberculous drugs}, journal = {Genome Medicine}, year = {2019}, month = {6}, day = {24}, volume = {11}, number = {1}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, pages = {41}, keywords = {whole genome sequencing, drug resistance, tuberculosis}, web_url = {https://genomemedicine.biomedcentral.com/articles/10.1186/s13073-019-0650-x}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1756-994X}, DOI = {10.1186/s13073-019-0650-x}, stag_bib_extends_levelofaccess = {NA}, author = {Phelan, J.E. and O’Sullivan, D.M. and Machado, D. and Ramos, J. and Oppong, Y.E.A. and Campino, S. and O’Grady, J. and McNerney, R. and Hibberd, M.L. and Viveiros, M. and Huggett, J.F. and Clark, T.G.} } @Proceedings { MeuretHC2019, subid = {1435}, title = {Accurate and robust characterization of volume scattering materials using the intensity-based inverse adding-doubling method}, journal = {SPIE Proceeding, Modeling Aspects in Optical Metrology VII}, year = {2019}, month = {6}, day = {21}, volume = {11057}, number = {-}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {110570N}, keywords = {Volume scattering, solid-state lighting, inverse problem, adding-doubling}, web_url = {https://lirias.kuleuven.be/2825988?limo=0}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {SPIE}, event_place = {Munich, Germany}, event_name = {Modeling Aspects in Optical Metrology VII (SPIE Optical Metrology)}, event_date = {24-06-2019 to 26-06-2019}, language = {30}, ISBN = {9781510627932}, ISSN = {0277-786X}, DOI = {10.1117/12.2525791}, stag_bib_extends_levelofaccess = {NA}, author = {Correia, A. and Hanselaer, P. and Meuret, Y.} } @Article { HannNFSTK2019, subid = {1196}, title = {FI-ICP-TOFMS for quantification of biologically essential trace elements in cerebrospinal fluid – high-throughput at low sample volume}, journal = {The Analyst}, year = {2019}, month = {6}, day = {11}, volume = {144}, number = {15}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {4653-4660}, keywords = {cerebrospinal fluid, FI-ICP-TOFMS, quantification of biologically essential trace elements}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2019/AN/C9AN00039A\#!divAbstract}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0003-2654, 1364-5528}, DOI = {10.1039/C9AN00039A}, stag_bib_extends_levelofaccess = {NA}, author = {Theiner, S. and Schoeberl, A. and Fischer, L. and Neumayer, S. and Hann, S. and Koellensperger, G.} } @Article { vandenBromHHBKWI2019, subid = {1154}, title = {An Optoelectronic Pulse Drive for Quantum Voltage Synthesizer}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {2066-2071}, keywords = {Josephson arbitrary waveform synthesizer, Josephson arrays, measurement, metrology, optoelectronics, voltage measurement}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2877562}, stag_bib_extends_levelofaccess = {NA}, author = {Ireland, J. and Williams, J. and Kieler, O. and Behr, R. and Houtzager, E. and Hornecker, R. and van den Brom, H.E.} } @Article { CelepPGDH2019, subid = {1070}, title = {Harmonics Effects on Microwave Power Measurement Using Diode Sensors}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1852-1859}, keywords = {Diode detector, Harmonic effect, Microwave measurements, Microwave power, Power sensor}, web_url = {https://ieeexplore.ieee.org/document/8700278}, misc2 = {EMPIR 2015: Research Potential}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2019.2905885}, stag_bib_extends_levelofaccess = {NA}, author = {Drazil, K. and Grajciar, J. and Pavlicek, T. and Celep, M. and Hudlicka, M.} } @Article { GulmezHGE2019, subid = {1137}, title = {Reference Ultralow DC Current Source Between 1 fA and 100 pA at T{\"U}BİTAK UME}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {2201-2207}, keywords = {Capacitors, Standards, Voltage measurement, Temperature measurement, Temperature sensors, Current measurement, Uncertainty}, web_url = {https://arxiv.org/abs/1907.01389}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2019.2895435}, stag_bib_extends_levelofaccess = {NA}, author = {Erkan, {\"O}. and G{\"u}lmez, Y. and G{\"u}lmez, G. and Hayırlı, C.} } @Article { LeferinkMHH2019, subid = {1382}, title = {Misreadings of Static Energy Meters due to Conducted EMI caused by Fast Changing Current}, journal = {2019 Joint International Symposium on Electromagnetic Compatibility, Sapporo and Asia-Pacific International Symposium on Electromagnetic Compatibility (EMC Sapporo/APEMC)}, year = {2019}, month = {6}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {4}, keywords = {IEEE Keywords Meters, Regulators, Water pumps, Current measurement, Impedance, Power measurement, Voltage measurement INSPEC: Controlled Indexing amplifiers, electromagnetic interference, power meters, water pumps INSPEC: Non-Controlled Indexing static energy meters, conducted EMI, conducted electromagnetic interference , water pump, speed regulators, reference meter, fast changing current, four-quadrant amplifier}, web_url = {https://research.utwente.nl/en/publications/misreadings-of-static-energy-meters-due-to-conducted-emi-caused-b}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.23919/EMCTokyo.2019.8893903}, stag_bib_extends_levelofaccess = {NA}, author = {Have, B. t. and Hartman, T. and Moonen, N. and Leferink, F.} } @Article { HohlsKGHKW2019, subid = {1126}, title = {Quantum dot state initialization by control of tunneling rates}, journal = {Physical Review B}, year = {2019}, month = {5}, day = {20}, volume = {99}, number = {20}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {201409(R)}, keywords = {quantum dot, single-electron, quantum state, electron quantum optics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/physrevb.99.201409}, stag_bib_extends_levelofaccess = {NA}, author = {Wenz, T. and Klochan, J. and Hohls, F. and Gerster, T. and Kashcheyevs, V. and Schumacher, H. W.} } @Article { HohlsKGHKW20190, subid = {1126}, title = {Quantum dot state initialization by control of tunneling rates}, journal = {Physical Review B}, year = {2019}, month = {5}, day = {20}, volume = {99}, number = {20}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {201409(R)}, keywords = {quantum dot, single-electron, quantum state, electron quantum optics}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/physrevb.99.201409}, stag_bib_extends_levelofaccess = {NA}, author = {Wenz, T. and Klochan, J. and Hohls, F. and Hohls, F. and Gerster, T. and Kashcheyevs, V.} } @Article { OliveroBOFCJGSPBFHBER2019, subid = {1261}, title = {Quantum Micro–Nano Devices Fabricated in Diamond by Femtosecond Laser and Ion Irradiation}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {5}, day = {20}, volume = {2}, number = {5-6}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1900006}, keywords = {diamond, ion‐beam irradiation, nitrogen vacancies ,NV magnetometry, quantum sensing, ultrafast laser writing}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900006}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/2318/1704485}, author = {Eaton, S.M. and Hadden, J.P. and Bharadwaj, V. and Forneris, J. and Picollo, F. and Bosia, F. and Sotillo, B. and Giakoumaki, A.N. and Jedrkiewicz, O. and Chiappini, A. and Ferrari, M. and Osellame, R. and Barclay, P.E. and Olivero, P. and Ramponi, R.} } @Article { HeinrichPSDKFA2019, subid = {1067}, title = {Influence of Microwave Probes on Calibrated On-Wafer Measurements}, journal = {IEEE Transactions on Microwave Theory and Techniques}, year = {2019}, month = {5}, volume = {67}, number = {5}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1892-1900}, keywords = {Calibration, coplanar waveguide, electromagnetic field simulation, multiline-thru-reflect-line, on-wafer probing, probes}, web_url = {https://www.fbh-berlin.de/fileadmin/downloads/Publications/2019/FINAL_VERSION_repository.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9480, 1557-9670}, DOI = {10.1109/TMTT.2019.2903400}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Kahne, B. and Fritzsch, T. and Arz, U. and Heinrich, W.} } @Article { LeferinktMH2019, subid = {1385}, title = {Fast Magnetic Emission Tests for Continuous Measurements Around an Equipment Under Test}, journal = {2019 ESA Workshop on Aerospace EMC (Aerospace EMC)}, year = {2019}, month = {5}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {IEEE Keywords Position measurement, Time measurement, Time-frequency analysis, Magnetic field measurement, Electromagnetic interference INSPEC: Controlled Indexing electromagnetic interference, position measurement, time-domain analysis INSPEC: Non-Controlled Indexing continuous measurements, fast magnetic emission tests, continuous positional measurement, maximum emission, maximum interference, measurement positions, time domain electromagnetic interference analyzers, EMI test receiver, long measurement time, EUT, radiated electromagnetic interference emission}, web_url = {https://research.utwente.nl/en/publications/fast-magnetic-emission-tests-for-continuous-measurements-around-a}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.23919/AeroEMC.2019.8788950}, stag_bib_extends_levelofaccess = {NA}, author = {Hartman, T. and Moonen, N. and ten Have, B. and Leferink, F.} } @Manual { HaddadiDLHGLHPZWHMSRKPASC2019, subid = {1085}, title = {Best Practice Guide for Planar S-Parameter Measurements using Vector Network Analysers}, year = {2019}, month = {4}, day = {24}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), microwave probes, extreme impedance measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise, vector network analyzer (VNA)}, web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424B}, misc2 = {EMPIR 2014: Industry}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, language = {30}, DOI = {10.7795/530.20190424B}, stag_bib_extends_levelofaccess = {NA}, author = {Haddadi, K. and Dambrine, G. and Lozar, R. and Helmreich, K. and Gold, G. and Lomakin, K. and Heinrich, W. and Phung, G.N. and Zeier, M. and Wollensack, M. and Hoffmann, J. and Mubarak, F. and Shang, X. and Ridler, N. and Kuhlmann, K. and Probst, T. and Arz, U. and Spirito, M. and Clarke, R.} } @Manual { SchmucklePASHL2019, subid = {1084}, title = {Guidelines for the design of calibration substrates, including the suppression of parasitic modes for frequencies up to and including 325 GHz}, year = {2019}, month = {4}, day = {24}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Calibration, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), on-wafer probing, probes}, web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424A}, misc2 = {EMPIR 2014: Industry}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, language = {30}, DOI = {10.7795/530.20190424A}, stag_bib_extends_levelofaccess = {NA}, author = {Schmuckle, F.J. and Phung, G.N. and Arz, U. and Spirito, M. and Heinrich, W. and Lozar, R.} } @Article { HanselaerAL2019, subid = {1223}, title = {Development of an image-based gloss measurement instrument}, journal = {Journal of Coatings Technology and Research}, year = {2019}, month = {4}, volume = {16}, number = {4}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {913-921}, keywords = {specular gloss meterimage-based gloss measurementcontrast glossorange peel}, web_url = {https://rdcu.be/bTtmT}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1547-0091, 1935-3804}, DOI = {10.1007/s11998-019-00184-8}, stag_bib_extends_levelofaccess = {NA}, author = {Leloup, F.B. and Audenaert, J. and Hanselaer, P.} } @Article { MarquesTUWdLLLGHA2019, subid = {1369}, title = {Topology Driven g-Factor Tuning in Type-II Quantum Dots}, journal = {Physical Review Applied}, year = {2019}, month = {4}, volume = {11}, number = {4}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {044011}, keywords = {quantum dots, optoelectronics, spin-orbit coupling, Aharonov-Bohm effect}, web_url = {https://arxiv.org/abs/1710.08828}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.11.044011}, stag_bib_extends_levelofaccess = {NA}, author = {Llorens, J.M. and Lopes-Oliveira, V. and L{\'o}pez-Richard, V. and de Oliveira, E.R. Cardozo and Wewi{\'o}r, L. and Ulloa, J.M. and Teodoro, M.D. and Marques, G.E. and Garc{\'i}a-Crist{\'o}bal, A. and Hai, G.-Q. and Al{\'e}n, B.} } @Proceedings { BurgerZHS2019, subid = {1217}, title = {Using Gaussian process regression for efficient parameter reconstruction}, journal = {Metrology, Inspection, and Process Control for Microlithography XXXIII}, year = {2019}, month = {3}, day = {26}, volume = {10959}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1095911}, keywords = {computational metrology, optical metrology, computational lithography, Bayesian optimization,machine learning, finite-element methods, nanooptics}, web_url = {https://arxiv.org/abs/1903.12128}, misc2 = {EMPIR 2017: Fundamental}, publisher = {SPIE}, event_place = {San Jose, USA}, event_name = {Metrology, Inspection, and Process Control for Microlithography XXXIII}, event_date = {24-02-2019 to 28-02-2019}, language = {30}, DOI = {10.1117/12.2513268}, stag_bib_extends_levelofaccess = {NA}, author = {Schneider, P-I. and Hammerschmidt, M. and Zschiedrich, L. and Burger, S.} } @Article { KiselevDMFVPABBLXBHD2019, subid = {1024}, title = {Long Slender Piezo-Resistive Silicon Microprobes for Fast Measurements of Roughness and Mechanical Properties inside Micro-Holes with Diameters below 100 µm}, journal = {Sensors 2019}, year = {2019}, month = {3}, day = {22}, volume = {19(6)}, number = {1410}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {cantilever microprobe; high-speed; contact resonance; tip wear; piezo-resistive; mechanical damping; tip-testing standard}, web_url = {https://www.mdpi.com/1424-8220/19/6/1410}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, address = {Basel}, language = {30}, DOI = {10.3390/s19061410}, stag_bib_extends_levelofaccess = {NA}, author = {Brand, U. and XU, M. and Doering, L. and Langfahl-Klabes, J. and Behle, H. and B{\"u}tefisch, S. and Ahbe, T. and Peiner, E. and V{\"o}llmeke, S. and Frank, T. and Mickan, B. and Kiselev, I. and Hauptmannl, M. and Drexel, M.} } @Article { SafronovaPTLSHP2019, subid = {1051}, title = {Optical clock comparison for Lorentz symmetry testing}, journal = {Nature}, year = {2019}, month = {3}, volume = {567}, number = {7747}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {204-208}, keywords = {optical clock, Lorentz symmetry violation, ytterbium, ion trap}, web_url = {https://arxiv.org/abs/1809.10742\#}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0028-0836, 1476-4687}, DOI = {10.1038/s41586-019-0972-2}, stag_bib_extends_levelofaccess = {NA}, author = {Sanner, C. and Huntemann, N. and Lange, R. and Tamm, C. and Peik, E. and Safronova, M.S. and Porsev, S.G.} } @Article { HuKPHNKNC2019, subid = {1306}, title = {Determination of tip transfer function for quantitative MFM using frequency domain filtering and least squares method}, journal = {Scientific Reports}, year = {2019}, month = {3}, volume = {9}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, keywords = {quantitative MFM}, web_url = {https://www.nature.com/articles/s41598-019-40477-x\#additional-information}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-40477-x}, stag_bib_extends_levelofaccess = {NA}, author = {Nečas, D. and Klapetek, P. and Neu, V. and Havl{\'i}ček, M. and Puttock, R. and Kazakova, O. and Hu, X. and Zaj{\'i}čkov{\'a}, L.} } @Proceedings { SchulzFDSPH2019, subid = {1064}, title = {Crosstalk Effects of Differential Thin-Film Microstrip Lines in Multilayer Motherboards}, journal = {2019 12th German Microwave Conference (GeMiC)}, year = {2019}, month = {3}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {178-181}, keywords = {crosstalk effects, discontinuities, microstrip}, web_url = {https://www.fbh-berlin.com/fileadmin/downloads/Publications/2019/2019_02_20_GeMiC_GNP_repository.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, event_place = {Stuttgart}, event_name = {2019 12th German Microwave Conference (GeMiC)}, event_date = {25-03-2019 to 27-03-2019}, language = {30}, DOI = {10.23919/GEMIC.2019.8698163}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G. N. and Schmuckle, F. J. and Doerner, R. and Fritzsch, T. and Schulz, S. and Heinrich, W.} } @Article { PitreLHHCSPCGLZ2019, subid = {1167}, title = {A high-stability quasi-spherical resonator in SPRIGT for microwave frequency measurements at low temperatures}, journal = {Science Bulletin}, year = {2019}, month = {3}, volume = {64}, number = {5}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {286-288}, keywords = {Refractive Index, Primary Thermometry, resonance frequencies}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2095-9273}, DOI = {10.1016/j.scib.2019.01.018}, stag_bib_extends_levelofaccess = {NA}, author = {Zhang, H. and Liu, W. and Gao, B. and Chen, Y. and Chen, H. and Pan, C. and Song, Y. and Han, D. and Hu, J. and Luo, E. and Pitre, L.} } @Article { RaaymakersWHMv2019, subid = {1048}, title = {Monte Carlo simulations of out-of-field surface doses due to the electron streaming effect in orthogonal magnetic fields}, journal = {Physics in Medicine and Biology}, year = {2019}, month = {2}, day = {26}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, keywords = {out-of-field dose, MRgRT}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ab0aa0}, stag_bib_extends_levelofaccess = {NA}, author = {Malkov, V.N. and Hackett, S.L. and Wolthaus, J.W.H. and Raaymakers, B.W. and van Asselen, B.} } @Article { BurgerRRHS2019, subid = {1520}, title = {Numerical Investigation of Light Emission from Quantum Dots Embedded into On‐Chip, Low‐Index‐Contrast Optical Waveguides}, journal = {physica status solidi (b)}, year = {2019}, month = {2}, day = {15}, volume = {256}, number = {7}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1800437}, keywords = {single photon emitters, coherent light matter interaction, numerical simulations, finite element methods}, web_url = {https://arxiv.org/abs/2006.10466}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {0370-1972, 1521-3951}, DOI = {10.1002/pssb.201800437}, stag_bib_extends_levelofaccess = {NA}, author = {Hoehne, T. and Schnauber, P. and Rodt, S. and Reitzenstein, S. and Burger, S.} } @Article { WolthausRvHM2019, subid = {1142}, title = {Monte Carlo simulations of out-of-field skin dose due to spiralling contaminant electrons in a perpendicular magnetic field}, journal = {Medical Physics}, year = {2019}, month = {2}, day = {14}, volume = {46}, number = {3}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {1467-1477}, keywords = {MRgRT, Monte Carlo, dosimetry, magnetic field}, web_url = {https://aapm.onlinelibrary.wiley.com/doi/full/10.1002/mp.13392}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405}, DOI = {10.1002/mp.13392}, stag_bib_extends_levelofaccess = {NA}, author = {Malkov, V.N. and Hackett, S.L. and van Asselen, B. and Raaymakers, B.W. and Wolthaus, Jochem W. H.} } @Article { HallstromH2019, subid = {1055}, title = {Application of Charge-Sensitive Preamplifier for the Calibration of Partial Discharge Calibrators Below 1 pC}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {2}, day = {12}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, pages = {1-7}, keywords = {Voltage measurement, Uncertainty, Partial discharges, Capacitors, Charge measurement, Calibration, Measurement uncertainty}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2019.2895437}, stag_bib_extends_levelofaccess = {NA}, author = {Havunen, J. and H{\"a}llstr{\"o}m, J.} } @Article { McPeakBHGW2019, subid = {1059}, title = {Correlation of circular differential optical absorption with geometric chirality in plasmonic meta-atoms}, journal = {Optics Express}, year = {2019}, month = {2}, day = {11}, volume = {27}, number = {4}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {5097}, keywords = {circular differential optical absorption, chirality, plasmonics}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1364/OE.27.005097}, stag_bib_extends_levelofaccess = {NA}, author = {Wilson, J.C. and Gutsche, P. and Herrmann, S. and Burger, S. and McPeak, K.M.} } @Article { DittmannFHGBHKWPSDM2019, subid = {1001}, title = {Results of four European round-robins on short-circuit current temperature coefficient measurements of photovoltaic devices of different size}, journal = {Solar Energy}, year = {2019}, month = {2}, volume = {179}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {424-436}, keywords = {Photovoltaics, Short-circuit current temperature coefficient intercomparisons, Spectral temperature coefficients, Bare cells to full-size modules}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2018.10.051}, stag_bib_extends_levelofaccess = {NA}, author = {Salis, E. and Pavanello, D. and Kr{\"o}ger, I. and Winter, S. and Bothe, K. and Hinken, D. and Gandy, T. and Hohl-Ebinger, J. and Friesen, G. and Dittmann, S. and Dubard, J. and M{\"u}llejans, H.} } @Article { HarrisDBSKDS2019, subid = {1160}, title = {Children With Cystic Fibrosis Are Infected With Multiple Subpopulations of Mycobacterium abscessus With Different Antimicrobial Resistance Profiles}, journal = {Clinical Infectious Diseases}, year = {2019}, month = {1}, day = {26}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, keywords = {lung transplant, whole-genome sequencing, within-patient diversity, macrolides, physiological niches}, misc2 = {EMPIR 2015: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {1058-4838, 1537-6591}, DOI = {10.1093/cid/ciz069}, stag_bib_extends_levelofaccess = {NA}, author = {Shaw, L.P. and Doyle, R.M. and Kavaliunaite, E. and Spencer, H. and Balloux, F. and Dixon, G. and Harris, K.A.} } @Article { KochKBWHBISIK2019, title = {Does airborne ultrasound lead to activation of the auditory cortex?}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2019}, month = {1}, day = {18}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, keywords = {airborne ultrasound; brain imaging; hearingthreshold}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {1862-278X, 0013-5585}, DOI = {10.1515/bmt-2018-0048}, stag_bib_extends_levelofaccess = {NA}, author = {Koch, C. and K{\"u}hler, R. and Bauer, M. and Weichenberger, M. and Hensel, J. and Br{\"u}hl, R. and Ihlenfeld, A. and Sander, T. and Ittermann, B. and K{\"u}hn, S.} } @Proceedings { Horneckervv2019, subid = {1147}, title = {Characterization of DC current sensors under distorted conditions for railway applications}, journal = {2018 IEEE International Conference on Electrical Systems for Aircraft, Railway, Ship Propulsion and Road Vehicles \& International Transportation Electrification Conference (ESARS-ITEC)}, year = {2019}, month = {1}, day = {14}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {current sensor, current measurement function, energy measurement function, railway application}, tags = {SEG}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Nottingham, UK,}, event_name = {Conference on Electrical Systems for Aircraft, Railway, Ship Propulsion and Road Vehicles (ESARS) \& International Transportation Electrification Conference (ITEC)}, event_date = {07-11-2018 to 09-11-2018}, language = {30}, DOI = {10.5281/zenodo.3265659}, stag_bib_extends_levelofaccess = {NA}, author = {Hornecker, R. and van Leeuwen, R. and van den Brom, H.E.} } @Article { HashadEJS2019, subid = {805}, title = {Characterization of a force-balanced piston gauge as a primary pressure standard}, journal = {Measurement}, year = {2019}, month = {1}, volume = {131}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {723-729}, keywords = {Primary pressure standard, Effective area, FPG characterization, Rarefied gas flow,}, web_url = {https://www.sciencedirect.com/science/article/pii/S0263224118308443}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2018.09.016}, stag_bib_extends_levelofaccess = {NA}, author = {Hashad, A.S. and Ehlers, S. and Jusko, O. and Sabuga, W.} } @Article { ZschiedrichFRBHG2019, subid = {1060}, title = {Decomposition of scattered electromagnetic fields into vector spherical wave functions on surfaces with general shapes}, journal = {Physical Review B}, year = {2019}, month = {1}, volume = {99}, number = {4}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {045406}, keywords = {light scattering, vector spherical wave functions}, web_url = {https://arxiv.org/abs/1808.02315}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1103/PhysRevB.99.045406}, stag_bib_extends_levelofaccess = {NA}, author = {Garcia Santiago, X. and Hammerschmidt, M. and Burger, S. and Rockstuhl, C. and Fernandez-Corbaton, I. and Zschiedrich, L.} } @Article { PlimmerLHCLGCSZCSP2019, subid = {1168}, title = {Thermal response characteristics of a SPRIGT primary thermometry system}, journal = {Cryogenics}, year = {2019}, month = {1}, volume = {97}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {1-6}, keywords = {Cryogenics, Cryogen-free cryostat, Pulse-tube cooler, Single-pressure refractive index gas thermometry, Thermal switch, Temperature, Metrology, Primary thermometry}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0011-2275}, DOI = {10.1016/j.cryogenics.2018.10.015}, stag_bib_extends_levelofaccess = {NA}, author = {Chen, H. and Chen, Y. and Zhang, H. and Song, Y. and Changzhao, P. and Gao, B. and Liu, W. and Han, D. and Luo, E. and Plimmer, M. and Sparasci, F. and Pitre, L.} } @Article { HimbertSPP2019, subid = {1179}, title = {Determinations of the Boltzmann constant}, journal = {Comptes Rendus Physique}, year = {2019}, month = {1}, volume = {20}, number = {1-2}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {129-139}, keywords = {Boltzmann constant, Primary thermometry, International System of Units (SI)}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {1631-0705}, DOI = {10.1016/j.crhy.2018.11.007}, stag_bib_extends_levelofaccess = {NA}, author = {Pitre, L. and Plimmer, M.D. and Sparasci, F. and Himbert, M.E.} } @Article { MohnsHBHR2019, subid = {1041}, title = {Comparison of Reference Setups for Calibrating Power Transformer Loss Measurement Systems}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {power transformers, loss measurement, power transformer losses, load loss, shunt reactor, power measurement, comparison, calibration, high voltage, uncertainty.}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.1109/TIM.2018.2879171}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, Gert and Mohns, Enrico and Houtzager, Ernest and Badura, Henrik and Hoogenboom, Dennis} } @Article { HughesPMP2019, subid = {1388}, title = {Artifact-free coordinate registration of heterogeneous Large-Scale Metrology systems}, journal = {CIRP Annals}, year = {2019}, volume = {68}, number = {1}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, pages = {503-506}, keywords = {Metrology, Sensor, Uncertainty}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0007-8506}, DOI = {10.1016/j.cirp.2019.04.077}, stag_bib_extends_levelofaccess = {NA}, author = {Pfeifer, T. and Montavon, B. and Peterek, M. and Hughes, B.} } @Proceedings { SmithFAHP2019, subid = {1515}, title = {Risk calculations for conformity assessment in practice}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, number2 = {17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty}, keywords = {Conformity assessmentRiskCAsoftUncertainty}, tags = {MAT}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201916001}, stag_bib_extends_levelofaccess = {NA}, author = {Allard, A. and Fischer, N. and Smith, I. and Harris, P. and Pendrill, L.} } @Article { HashadVVNS2019, subid = {1020}, title = {Computation of the effective area and associated uncertainties of non-rotating piston gauges FPG and FRS}, journal = {Metrologia}, year = {2019}, volume = {56}, number = {015004}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {1-10}, keywords = {primary pressure standard, effective area, rarefied gas dynamics, FPG and FRS characterization}, web_url = {https://doi.org/10.1088/1681-7575/aaee18}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {1681-7575/19/015004+10$33.00}, DOI = {10.1088/1681-7575/aaee18}, stag_bib_extends_levelofaccess = {NA}, author = {Naris, S. and Vasileiadis, N. and Valougeorgis, D. and Hashad, A.S. and Sabuga, W.} } @Proceedings { SpasovaBNOSCTHZSAV2019, subid = {1490}, title = {A new EMPIR Project “MetForTC” for Developing Traceable Measurement Capabilities for Monitoring Thermocouple Performance}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, volume = {-}, number = {2019}, number2 = {18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance}, pages = {5/18006}, keywords = {EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple}, misc2 = {EMPIR 2018: Research Potential}, publisher = {EDP Sciences}, event_place = {Paris, France}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201918006}, stag_bib_extends_levelofaccess = {NA}, author = {Arifovic, N. and Sestan, D. and Zvizdić, D. and Hozic, N. and Turz{\'o}-Andr{\'a}s, E. and Čohodarević, S. and Strnad, R. and Opel, K. and Neagu, D. and Bordianu, C. and Spasova, S. and Vukičević, T.} } @Article { SchumacherPMWHMRFMGHU2018, subid = {1127}, title = {Robust formation of quantum dots in GaAs/AlGaAs heterostructures for single-electron metrology}, journal = {Metrologia}, year = {2018}, month = {12}, day = {21}, volume = {56}, number = {1}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {014002}, keywords = {quantum dot, single-electron, GaAs/AlGaAs, fabrication}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf4aa}, stag_bib_extends_levelofaccess = {NA}, author = {Gerster, T. and M{\"u}ller, A. and Freise, L. and Reifert, D. and Maradan, D. and Hinze, P. and Weimann, T. and Marx, H. and Pierz, K. and Schumacher, H.W. and Hohls, F. and Ubbelohde, N.} } @Proceedings { HrabinaiPeHi2018, subid = {1129}, title = {Investigating the use of the hydrogen cyanide (HCN) as an absorption media for laser spectroscopy}, journal = {21st Czech-Polish-Slovak Optical Conference on Wave and Quantum Aspects of Contemporary Optics}, year = {2018}, month = {12}, day = {18}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, keywords = {SI metre realisation, HCN gas, molecular spectroscopy, hyperfine transition, optical frequency comb}, web_url = {https://arxiv.org/abs/1905.07272}, misc2 = {EMPIR 2017: Industry}, publisher = {SPIE}, event_place = {Lednice, Czech Republic}, event_name = {21st Czech-Polish-Slovak Optical Conference on Wave and Quantum Aspects of Contemporary Optics}, event_date = {03-09-2018 to 07-09-2018}, language = {30}, DOI = {10.1117/12.2517761}, stag_bib_extends_levelofaccess = {NA}, author = {Hošek, M. and Rerucha, S. and Pravdova, L. and Č{\'i}žek, M. and Hrabina, J. and Č{\'i}p, O.} } @Article { SchioppoNMMLLIHCFBBBBAWSLWZZZ2018, subid = {958}, title = {New bounds on dark matter coupling from a global network of optical atomic clocks}, journal = {Science Advances}, year = {2018}, month = {12}, volume = {4}, number = {12}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {eaau4869}, keywords = {optical atomic clocks, sensor network, dark matter}, web_url = {http://advances.sciencemag.org/content/4/12/eaau4869.full}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Association for the Advancement of Science (AAAS)}, language = {30}, ISSN = {2375-2548}, DOI = {10.1126/sciadv.aau4869}, stag_bib_extends_levelofaccess = {NA}, author = {Wcisło, P. and Ablewski, P. and Beloy, K. and Bilicki, S. and Bober, M. and Brown, R. and Fasano, R. and Ciuryło, R. and Hachisu, H. and Ido, T. and Lodewyck, J. and Ludlow, A. and McGrew, W. and Morzyński, P. and Nicolodi, D. and Schioppo, M. and Sekido, M. and Le Targat, R. and Wolf, P. and Zhang, X. and Zjawin, B. and Zawada, M.} } @Proceedings { FateevPDJAWSSHSLAS2018, subid = {1022}, title = {Development of measurement and calibration techniques for dynamic pressures and temperatures (DynPT): background and objectives of the 17IND07 DynPT project in the European Metrology Programme for Innovation and Research (EMPIR)}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {12}, volume = {1065}, number = {2018}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {162015}, keywords = {dynamic pressure, dynamic temperature, traceability, measurement standard, calibration method, calibration procedure, measurement uncertainty, validation, reliability, pressure measurement, temperature measurement}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, event_place = {Belfast}, event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/16/162015}, stag_bib_extends_levelofaccess = {NA}, author = {Saxholm, S. and Saxholm, S. and H{\"o}gstr{\"o}m, R. and Sarraf, C. and Sutton, G. and Wynands, R. and Arrh{\'e}n, F. and J{\"o}nsson, G. and Durgut, Y. and Peruzzi, A. and Fateev, A. and Liverts, M. and Adolfse, C.} } @Article { LuoLYHLSPZGCGHP2018, subid = {1170}, title = {Ultra-stable pressure is realized for Chinese single pressure refractive index gas thermometry in the range 30–90 kPa}, journal = {Science Bulletin}, year = {2018}, month = {12}, volume = {63}, number = {24}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {1601-1603}, keywords = {primary thermometry, low temperature, refractive index, microwave resonator}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2095-9273}, DOI = {10.1016/j.scib.2018.12.001}, stag_bib_extends_levelofaccess = {NA}, author = {Han, D. and Gao, B. and Chen, H. and Gambette, P. and Zhang, H. and Pan, C. and Song, Y. and Liu, W. and Liu, Y. and Hu, J. and Yu, B. and Luo, E. and Pitre, L.} } @Techreport { KleinHDBBK2018, subid = {1413}, title = {NanoWorkshop 2018: Workshop on Reference Nanomaterials; Current Situation and needs: development, measurement, Standardization}, journal = {PTB bericht}, year = {2018}, month = {12}, volume = {F-61}, number = {F-61}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {1-315}, keywords = {Comparability of Measurement Results;Nanomaterial Properties;Nanometrology;Nanoparticle Characterization;Reference Nanomaterials;Standardization}, web_url = {https://oar.ptb.de/resources/show/10.7795/110.20190412}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Physikalisch-Technische Bundesanstalt}, language = {30}, ISBN = {78-3-95606-440-1}, ISSN = {0179-0609}, DOI = {10.7795/110.20190412}, stag_bib_extends_levelofaccess = {NA}, author = {Klein, T. and Hodoroaba, V.-D. and Dziomba, T. and Buhr, E. and Bosse, H. and Krumrey, M.} } @Article { DorscherASBSSPOHHSL2018, subid = {1054}, title = {Towards an optical clock for space: Compact, high-performance optical lattice clock based on bosonic atoms}, journal = {Physical Review A}, year = {2018}, month = {11}, day = {29}, volume = {98}, number = {5}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {053443}, keywords = {optical clocks, optical lattice clock, isotope shift, clock comparisons}, web_url = {https://www.ptb.de/cms/fileadmin/internet/fachabteilungen/abteilung_4/4.3_quantenoptik_und_laengeneinheit/4.32/ori18.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.98.053443}, stag_bib_extends_levelofaccess = {NA}, author = {Origlia, S. and Pramod, M.S. and Schiller, S. and Singh, Y. and Bongs, K. and Schwarz, R. and Al-Masoudi, A. and D{\"o}rscher, S. and Herbers, S. and H{\"a}fner, S. and Sterr, U. and Lisdat, C.} } @Proceedings { SiboldTH2018, subid = {1049}, title = {Delayed authentication and delayed measurement application in one-way synchronization}, journal = {Proceedings of: 2018 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, year = {2018}, month = {11}, day = {22}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-6}, keywords = {time synchronization, Network Time Security (NTS), Time Security, security, authentication, integrity, Network Time Protocol (NTP)}, tags = {SEG}, web_url = {https://doi.org/10.1109/ISPCS.2018.8543083}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Geneva, Switzerland}, event_name = {2018 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, event_date = {30-09-2018 to 05-10-2018}, language = {30}, ISBN = {978-1-5386-4263-4}, ISSN = {1949-0313}, DOI = {10.7795/EMPIR.17IND06.CA.20190410A}, stag_bib_extends_levelofaccess = {NA}, author = {Sibold, D. and Teichel, K. and Hildermeier, G.} } @Proceedings { TeichelH2018, subid = {1050}, title = {Experimental Evaluation of Attacks on TESLA-Secured Time Synchronization Protocols}, journal = {Security Standardisation Research}, year = {2018}, month = {11}, day = {21}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {37-55}, keywords = {Time synchronization protocols, TESLA, Authentication, Experimental attack analysis, ASTS, TinySeRSync}, tags = {SEG}, web_url = {https://doi.org/10.1007/978-3-030-04762-7_3}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer International Publishing}, event_place = {Darmstadt, Germany}, event_name = {International Conference on Research in Security Standardisation}, event_date = {26-11-2018 to 27-11-2018}, language = {30}, ISBN = {978-3-030-04761-0, 978-3-030-0}, ISSN = {0302-9743, 1611-3349}, DOI = {10.7795/EMPIR.17IND06.CA.20190410B}, stag_bib_extends_levelofaccess = {NA}, author = {Teichel, K. and Hildermeier, G.} } @Article { NewellHMRLKHCPYKE2018, subid = {994}, title = {Confocal laser scanning microscopy for rapid optical characterization of graphene}, journal = {Communications Physics}, year = {2018}, month = {11}, day = {20}, volume = {1}, number = {1}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, keywords = {Confocal microscopy, graphene.}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-018-0084-6}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, V. and Yang, Y. and Cheng, G. and Hu, J. and Kruskopf, M. and Liu, C.I. and Rigosi, A.F. and Melios, C. and Hight Walker, A.R. and Newell, D.B. and Kazakova, O. and Elmquist, R.E.} } @Article { JaksiMODPCMTSSKDHLDGF2018, subid = {1009}, title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond}, journal = {ACS Photonics}, year = {2018}, month = {11}, day = {12}, volume = {5}, number = {12}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4864-4871}, keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.8b01013}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Herzig, T. and K{\"u}pper, J. and Damin, A. and Santonocito, S. and Signorile, M. and Traina, P. and Moreva, E. and Celegato, F. and Pezzagna, S. and Degiovanni, I. P. and Olivero, P. and Jakšić, M. and Meijer, J. and Genovese, P. M. and Forneris, J.} } @Article { JaksiMODPCMTSSKDHLDGF20180, subid = {1009}, title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond}, journal = {ACS Photonics}, year = {2018}, month = {11}, day = {12}, volume = {5}, number = {12}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {4864-4871}, keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.8b01013}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Herzig, T. and K{\"u}pper, J. and Damin, A. and Santonocito, S. and Signorile, M. and Traina, P. and Moreva, E. and Celegato, F. and Pezzagna, S. and Degiovanni, I. P. and Olivero, P. and Jakšić, M. and Meijer, J. and Genovese, P. M. and Forneris, J.} } @Proceedings { DambrineRVMMDRH2018, subid = {1002}, title = {On-Wafer Broadband Microwave Measurement of High Impedance Devices-CPW Test Structures with Integrated Metallic Nano-Resistances}, journal = {2018 48th European Microwave Conference (EuMC)}, year = {2018}, month = {11}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {25-28}, keywords = {S-parameters, microwave, uncertainty, on-wafer,}, web_url = {https://hal.archives-ouvertes.fr/hal-02056825}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Madrid}, event_name = {EuMC 2018}, event_date = {23-09-2018 to 27-09-2018}, language = {30}, DOI = {10.23919/EuMC.2018.8541607}, stag_bib_extends_levelofaccess = {NA}, author = {Daff{\'e}, K. and Mubarak, F. and Mascolo, V. and Votsi, H. and Ridler, N.M. and Dambrine, G. and Roch, I. and Haddadi, K.} } @Proceedings { HartmanML2018, subid = {2091}, title = {Direct Sampling in Multi-channel Synchronous TDEMI Measurements}, journal = {2018 IEEE 4th Global Electromagnetic Compatibility Conference (GEMCCON)}, year = {2018}, month = {11}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {-}, web_url = {https://research.utwente.nl/en/publications/direct-sampling-in-multi-channel-synchronous-tdemi-measurements}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Stellenbosch, South Africa}, event_name = {2018 IEEE 4th Global Electromagnetic Compatibility Conference (GEMCCON)}, event_date = {07-11-2018 to 09-11-2018}, language = {30}, DOI = {10.1109/GEMCCON.2018.8628576}, stag_bib_extends_levelofaccess = {NA}, author = {Hartman, T. and Moonen, N. and Leferink, F.} } @Proceedings { HallstromH2018, subid = {854}, title = {Application of Charge-Sensitive Preamplifier for the Calibration of Partial Discharge Calibrators Below 1 pC}, journal = {2018 Conference on Precision Electromagnetic Measurements}, year = {2018}, month = {10}, day = {22}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {calibration, measurement, measurement techniques, measurement uncertainty, partial discharge}, web_url = {https://ieeexplore.ieee.org/document/8501003}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Paris, France}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {08-07-2018 to 13-07-2018}, language = {30}, DOI = {10.5281/zenodo.1470240}, stag_bib_extends_levelofaccess = {NA}, author = {Havunen, J. and H{\"a}llstr{\"o}m, J.} } @Proceedings { JohannHDM2018, subid = {856}, title = {Reference system for the Practical Peak Voltage calibration in Radiology and diagnostic applications}, journal = {2018 Conference on Precision Electromagnetic Measurements}, year = {2018}, month = {10}, day = {22}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {X-ray, High voltage, Transient, Impulse voltage, D{\'e}convolution, Practical Peak Voltage}, web_url = {https://ieeexplore.ieee.org/document/8500915}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Paris}, event_name = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, event_date = {08-07-2018 to 13-07-2018}, language = {30}, ISBN = {978-1-5386-0974-3}, ISSN = {2160-0171}, DOI = {10.5281/zenodo.1471188}, stag_bib_extends_levelofaccess = {NA}, author = {Johann, P. and Hanane, S. and Dominique, F. and Mohamed, A.} } @Article { KuosmanenTHWV2018, title = {Uncertainty analysis of phase and amplitude of harmonic components of bearing inner ring four-point roundness measurement}, journal = {Precision Engineering}, year = {2018}, month = {10}, volume = {54}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {118-130}, keywords = {Monte-Carlo simulation, Phase uncertainty, Harmonic component uncertainty, Uncertainty evaluation, Bearing excitation, Odd and even harmonic components, Four-point method, Three-point method}, web_url = {https://www.sciencedirect.com/science/article/pii/S0141635918302368}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2018.05.008}, stag_bib_extends_levelofaccess = {NA}, author = {Kuosmanen, P. and Tammi, K. and Hemming, B. and Widmaier, T. and Viitala, R.} } @Article { HuldSBGD2018, title = {Energy-based metric for analysis of organic PV devices in comparison with conventional industrial technologies}, journal = {Renewable and Sustainable Energy Reviews}, year = {2018}, month = {10}, volume = {93}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {76-89}, keywords = {Energy, Transport and Climate}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {1364-0321}, DOI = {10.1016/j.rser.2018.04.029}, stag_bib_extends_levelofaccess = {NA}, author = {Huld, T. and Salis, E. and Bardizza, G. and Gracia-Amillo, A.M. and Dunlop, E.D.} } @Article { TarletonHD2018, subid = {932}, title = {Consistent determination of geometrically necessary dislocation density from simulations and experiments}, journal = {International Journal of Plasticity}, year = {2018}, month = {10}, volume = {109}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {18-42}, keywords = {density}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0749-6419}, DOI = {10.1016/j.ijplas.2018.05.001}, stag_bib_extends_levelofaccess = {NA}, author = {Das, S. and Hofmann, F. and Tarleton, E.} } @Article { RuttTTHLHILS2018, subid = {1122}, title = {Manipulation of random telegraph signals in a silicon nanowire transistor with a triple gate}, journal = {Nanotechnology}, year = {2018}, month = {9}, day = {25}, volume = {29}, number = {47}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {475201}, keywords = {random telegraph signal, silicon nanowire, quantum dot, MOSFET}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/aadfa6/meta\#back-to-top-target}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/aadfa6}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, F. and Ibukuro, K. and Husain, M.H. and Li, Z. and Hillier, J. and Tomita, I. and Tsuchiya, Y. and Rutt, H. and Saito, S.} } @Article { ChebenVMOHLSWH2018, subid = {873}, title = {Tilted subwavelength gratings: controlling anisotropy in metamaterial nanophotonic waveguides}, journal = {Optics Letters}, year = {2018}, month = {9}, day = {21}, volume = {43}, number = {19}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {4691}, keywords = {Subwavelength, anisotropy, silicon, waveguides}, web_url = {https://riuma.uma.es/xmlui/handle/10630/16695}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.43.004691}, stag_bib_extends_levelofaccess = {NA}, author = {Luque-Gonz{\'a}lez, J.M. and Herrero-Bermello, A. and Ortega-Monux, A. and Molina-Fernandez, I. and Velasco, A.V. and Cheben, P. and Schmid, J.H. and Wang, S. and Halir, R.} } @Article { HisamotoRHLASTYTLSK2018, subid = {595}, title = {Quantum Dipole Effects in a Silicon Transistor under High Electric Fields}, journal = {Journal of the Physical Society of Japan}, year = {2018}, month = {9}, day = {15}, volume = {87}, number = {9}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {094801}, keywords = {Si, CMOS, transistor, quantum dipole, Heisenberg model}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Physical Society of Japan}, language = {30}, ISSN = {0031-9015, 1347-4073}, DOI = {10.7566/jpsJ.87.094801}, stag_bib_extends_levelofaccess = {NA}, author = {Saito, S. and Li, Z. and Yoshimoto, H, and Tomita, I. and Tsuchiya, Y. and Sasago, Y. and Arimoto, H. and Liu, F. and Husain, M.K. and Hisamoto, D. and Rutt, H.N. and Kurihara, S.} } @Article { FlueggeNFSHDS2018, subid = {709}, title = {Metrological large range magnetic force microscopy}, journal = {Review of Scientific Instruments}, year = {2018}, month = {9}, volume = {89}, number = {9}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {093703}, keywords = {metrological magnetic force microscopy, large range, stray field}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5035175}, stag_bib_extends_levelofaccess = {NA}, author = {Dai, G. and Hu, X. and Sievers, S. and Fern{\'a}ndez Scarioni, A. and Neu, V. and Fluegge, J. and Schumacher, H.W.} } @Article { HaddadiGDDD2018, subid = {783}, title = {On-Wafer Series-Through Broadband Measurement of Sub-fF55-nm MOS RF Voltage-Tunable Capacitors}, journal = {IEEE Microwave and Wireless Components Letters}, year = {2018}, month = {9}, volume = {28}, number = {9}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {831-833}, keywords = {Microwave, on-wafer, S-parameters, capacitor, uncertainty}, web_url = {https://hal.archives-ouvertes.fr/hal-01873048}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, language = {30}, ISSN = {1531-1309, 1558-1764}, DOI = {10.1109/LMWC.2018.2851386}, stag_bib_extends_levelofaccess = {NA}, author = {Daff{\'e}, K. and Dambrine, G. and Durand, C. and Gaquiere, C. and Haddadi, K.} } @Proceedings { ProbstHDSPA2018_2, subid = {939}, title = {Impact of Substrate Modes on mTRL-Calibrated CPW Measurements in G Band}, journal = {2018 48th European Microwave Conference (EuMC)}, year = {2018}, month = {9}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {on-wafer probes, coplanar waveguides (CPW), substrate modes, calibration}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/impact-of-substrate-modes-on-mtrl-calibrated-cpw-measurements-in-g-band}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Madrid}, event_name = {2018 48th European Microwave Conference}, event_date = {23-09-2018 to 28-09-2018}, language = {30}, DOI = {10.23919/EuMC.2018.8541813}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Heinrich, W. and Probst, T. and Arz, U.} } @Article { LeuenbergerPHMVN2018, title = {Effect of moisture on the adsorption of ammonia}, journal = {Applied Physics B}, year = {2018}, month = {8}, day = {30}, volume = {124}, number = {9}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {189}, keywords = {Ammonia, adsorption, moisture}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-018-7054-2}, stag_bib_extends_levelofaccess = {NA}, author = {Leuenberger, D. and Persijn, S. and Halonen, L. and Mets{\"a}l{\"a}, M. and Vaittinen, O. and Niederhauser, B.} } @Article { HaasSSRBH2018, title = {A gravitational telescope deformation model for geodetic VLBI}, journal = {Journal of Geodesy}, year = {2018}, month = {8}, day = {29}, volume = {93}, number = {5}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {669-680}, keywords = {VLBI, Telescope deformation, Systematic errors, Terrestrial reference frames}, web_url = {http://link.springer.com/article/10.1007/s00190-018-1188-1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-7714, 1432-1394}, DOI = {10.1007/s00190-018-1188-1}, stag_bib_extends_levelofaccess = {NA}, author = {Haas, R. and Svantesson, C.G. and Spetz, J. and Rieck, C. and Bergstrand, S. and Herbertsson, M.} } @Article { IldayCEHe2018, subid = {1075}, title = {Tailored Design of Mode-Locking Dynamics for Low-Noise Frequency-Comb Generation}, journal = {Physical Review Applied}, year = {2018}, month = {8}, day = {20}, volume = {10}, number = {2}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {024027}, keywords = {frequency comb, low-noise}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1905.01116}, author = {Ilday, F.O. and \c{C}elik, M. and Erdoğan, C. and Hamid, R. and Şenel, C.} } @Article { KoppmannHGRAMO2018, title = {A large-area blackbody for in-flight calibration of an infrared interferometer deployed on board a long-duration balloon for stratospheric research}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {8}, day = {14}, volume = {11}, number = {8}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {4757-4762}, keywords = {GLORIA, Calibration}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-4757-2018}, stag_bib_extends_levelofaccess = {NA}, author = {Koppmann, R. and Hollandt, J. and Gutschwager, B. and Reiniger, M. and Adibekyan, A. and Monte, C. and Olschewski, F.} } @Article { SieversYSHGBTCBF2018, subid = {996}, title = {Excitation and coherent control of magnetization dynamics in magnetic tunnel junctions using acoustic pulses}, journal = {Applied Physics Letters}, year = {2018}, month = {8}, day = {13}, volume = {113}, number = {7}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, keywords = {Excitation, Coherent control, Magnetization dynamics, magnetic tunnel junctions, acoustic pulses}, web_url = {https://arxiv.org/abs/1804.10503}, misc2 = {EMPIR 2015: SI Broader Scope}, language = {30}, DOI = {10.1063/1.5037780}, stag_bib_extends_levelofaccess = {NA}, author = {Yang, H.F. and Garcia-Sanchez, F. and Hu, X.K. and Sievers, S. and B{\"o}hnert, T. and Costa, J.D. and Tarequzzaman, M. and Ferreira, R. and Bieler, M. and Schumacher, H.W.} } @Article { HaileLGK2018, subid = {962}, title = {Characterizing the operating conditions of bifacial modules}, journal = {AIP Conference Proceedings 1999, 020014 (2018)}, year = {2018}, month = {8}, day = {10}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Si bifacial PV module}, web_url = {https://aip.scitation.org/doi/10.1063/1.5049253}, misc2 = {EMPIR 2016: Energy}, publisher = {Author(s)}, language = {30}, DOI = {10.1063/1.5049253}, stag_bib_extends_levelofaccess = {NA}, author = {Kenny, R.P. and Garcia Menendez, E. and Lopez-Garcia, J. and Haile, B.} } @Article { SaxholmSHHSK2018, title = {Low-Pressure and Low-Temperature Dew/Frost-Point Generator}, journal = {International Journal of Thermophysics}, year = {2018}, month = {8}, volume = {39}, number = {9}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Dew-point generator, Frost-point generator, Humidity, Low pressure, Uncertainty}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-018-2425-9}, stag_bib_extends_levelofaccess = {NA}, author = {Saxholm, S. and Salminen, J. and H{\"o}gstr{\"o}m, R. and Heinonen, M. and Sairanen, H. and Kajastie, H.} } @Article { BruchertseiferFCDPHVPLMM2018, title = {Measurement of absolute \(\gamma\)-ray emission probabilities in the decay of 227Ac in equilibrium with its progeny}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {8}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, keywords = {\(\gamma\)-ray intensities, 227Ac, 227Th, 223Ra, decay data, \(\gamma\)-ray spectrometry}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2018.08.023}, stag_bib_extends_levelofaccess = {NA}, author = {Bruchertseifer, F. and Fazio, A. and Carconi, P. and Dry{\'a}k, P. and Pierre, S. and Hult, M. and Van Ammel, R. and Pomm{\'e}, S. and Lutter, G. and Marouli, M. and Morgenstern, A.} } @Article { OguzAytekinKMSISFSZSJoHBHPV2018, subid = {1086}, title = {Improving emerging European NMIs’ capabilities in humidity measurement}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {122019}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/12/122019}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Zvizdić, D. and Sestan, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Article { ZvizdiFSIRSSH2018, subid = {1087}, title = {Development and preliminary investigation of a modular chamber for calibration of relative humidity instruments}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {122017}, keywords = {Humidity, Relative humidity, Calibration chamber}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122017}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/12/122017}, stag_bib_extends_levelofaccess = {NA}, author = {Sestan, D. and Smorgon, D. and Rothmund, P. and Iacomini, L. and Šariri, K. and Fernicola, V. and Zvizdić, D. and Hodzic, N.} } @Proceedings { HodoroabaKHS2018, subid = {954}, title = {Analysis of Mesoporous Iridium Oxide Thin Films by the Combined Methodical Approach SEM/EDS/STRATAGem}, journal = {Proceedings of Microscopy \& Microanalysis 2018}, year = {2018}, month = {8}, volume = {24}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {762-763}, keywords = {Electron probe microanalysis (EPMA); Iridium oxide; Porous thin films; Spectroscopic ellipsometry}, misc2 = {EMPIR 2016: Energy}, publisher = {Cambridge University Press (CUP)}, event_place = {Baltimore, Maryland, USA}, event_name = {Microscopy \& Microanalysis 2018}, event_date = {05-08-2018 to 09-08-2018}, language = {30}, ISSN = {1431-9276, 1435-8115}, DOI = {10.1017/S1431927618004300}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Hertwig, A. and Kraehnert, R. and Hodoroaba, V.D.} } @Article { BehrHDBIIWBS2018, subid = {1153}, title = {Towards a Metrology class ADC based on Josephson junction devices}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {052044}, keywords = {Metrology, Josephson, ADC, DC Voltage, AC Voltage}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/5/052044}, stag_bib_extends_levelofaccess = {NA}, author = {Belcher, A. and Williams, J. and Ireland, J. and Iuzzolino, R. and Bierzychudek, M.E. and Dekker, R. and Herick, J. and Behr, R. and Schaapman, K.} } @Article { McKennaGSBCHGP2018, subid = {608}, title = {Exposure of mass-selected bimetallic Pt–Ti nanoalloys to oxygen explored using scanning transmission electron microscopy and density functional theory}, journal = {RSC Advances}, year = {2018}, month = {7}, day = {31}, volume = {8}, number = {52}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {27276–27282}, keywords = {Nanoparticles, nanotechnology, nanoalloys, platinum, bimetallic, electron microscopy}, web_url = {http://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra02449a}, misc2 = {EMPIR 2014: Industry}, publisher = {The Royal Society of Chemistry}, language = {30}, ISSN = {2046-2069}, DOI = {10.1039/C8RA02449A}, stag_bib_extends_levelofaccess = {NA}, author = {Gholhaki, S. and Hung, S. and Cant, D. and Blackmore, C. and Shard, A. and Guo, Q. and McKenna, K. and Palmer, R.} } @Article { HoflingSBBHSGLFSKRS2018_2, subid = {696}, title = {Photon-Number-Resolved Measurement of an Exciton-Polariton Condensate}, journal = {Physical Review Letters}, year = {2018}, month = {7}, day = {25}, volume = {121}, number = {4}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {047401}, keywords = {Exciton Polariton, Photon Statistics}, web_url = {https://arxiv.org/abs/1805.02959}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.121.047401}, stag_bib_extends_levelofaccess = {NA}, author = {Klaas, M. and Schlottmann, E. and Flayac, H. and Laussy, F. P. and Gericke, F. and Schmidt, M. and Helversen, M. v. and Beyer, J. and Brodbeck, S. and Suchomel, H. and H{\"o}fling, S. and Reitzenstein, S. and Schneider, C.} } @Proceedings { GrajciarDACHP2018, subid = {887}, title = {Harmonics Effects on Microwave Low-Power Measurement}, journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-2}, keywords = {Harmonic effect, microwave measurements, microwave power, power sensor, uncertainty}, web_url = {http://rfmw.cmi.cz/documents/papers/Celep_HarmonicEffect_cpem2018.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Paris, France}, event_name = {2018 Conference on Precision Electromagnetic Measurements}, event_date = {08-07-2018 to 13-07-2018}, language = {30}, ISBN = {978-1-5386-0974-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2018.8500788}, stag_bib_extends_levelofaccess = {NA}, author = {CELEP, Murat and Abdo, Yaser and Dražil, Karel and Grajciar, Jan and Hudlicka, Martin and Pinter, Borut} } @Article { WeisbachKHDBALKHW2018, subid = {515}, title = {Development and characterization of sub-monolayer coatings as novel calibration samples for X-ray spectroscopy}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2018}, month = {7}, volume = {145}, number2 = {14IND07: 3D Stack: Metrology for manufacturing 3D stacked integrated circuits}, pages = {36-42}, keywords = {X-ray fluorescence, calibration samples}, web_url = {https://arxiv.org/abs/1801.04246}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2018.04.001}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Kr{\"a}mer, M. and L{\"u}hl, L. and Andrianov, K. and Beckhoff, B. and Dietsch, R. and Holz, T. and Kanngie{\ss}er, B. and Wei{\ss}bach, D. and Wilhein, T.} } @Proceedings { DambrineTPH2018, subid = {891}, title = {Quantitative Error Analysis in Near-Field Scanning Microwave Microscopy}, journal = {2018 International Conference on Manipulation, Automation and Robotics at Small Scales (MARSS)}, year = {2018}, month = {7}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Near-field , microwave, microscopy}, web_url = {https://hal.archives-ouvertes.fr/hal-01913677}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Nagoya - Japan}, event_name = {2018 International Conference on Manipulation, Automation and Robotics at Small Scales (MARSS)}, event_date = {04-07-2018 to 08-07-2018}, language = {30}, DOI = {10.1109/MARSS.2018.8481160}, stag_bib_extends_levelofaccess = {NA}, author = {Haddadi, K. and Polovodov, P. and Theron, D. and Dambrine, G.} } @Proceedings { DaffeSRMMH2018, subid = {893}, title = {Parameterization Models for Traceable Characterization of Planar CPW SOL Calibration Standards}, journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Uncertainty, Calibration, Coplanar waveguides, Standards, Frequency measurement, Measurement Uncertainty, Probes}, web_url = {https://hal.archives-ouvertes.fr/hal-02085776/document}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Paris, France}, event_name = {CPEM}, event_date = {08-07-2018 to 13-07-2018}, language = {30}, ISBN = {978-1-5386-0974-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2018.8500810}, stag_bib_extends_levelofaccess = {NA}, author = {Mubarak, F. and Mascolo, V. and Rietveld, G. and Spirito, M. and Daff{\'e}, K. and Haddadi, K.} } @Article { SigrayLCBMBBAHRGCBD2018, subid = {904}, title = {Calibration standards for hydrophones and autonomous underwater noise recorders for frequencies below 1 kHz: current activities of EMPIR “UNAC-LOW” project}, journal = {ACTA IMEKO}, year = {2018}, month = {7}, volume = {7}, number = {2}, number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz}, pages = {32}, keywords = {low frequency hydrophone calibration; low frequency underwater noise recorders; underwater acoustics; calibration}, web_url = {http://dx.doi.org/10.21014/acta_imeko.v7i2.542}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v7i2.542}, stag_bib_extends_levelofaccess = {NA}, author = {Biber, A. and \c{C}orak\c{c}ı, A.C. and Golick, A. and Robinson, S. and Hayman, G. and Ablitt, J. and Barrera-Figueroa, S. and Buogo, S. and Mauro, S. and Borsani, F. and Curcuruto, S. and Linn{\'e}, M. and Sigray, P. and Davidsson, P.} } @Article { WubbelerRPKHUHSKZ2018, subid = {1114}, title = {Compressed sensing FTIR nano-spectroscopy and nano-imaging}, journal = {Optics Express}, year = {2018}, month = {6}, day = {28}, volume = {26}, number = {14}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {18115}, keywords = {Infrared scattering scanning near-field optical microscopy, Optical spectroscopy, Compressed sensing}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-14-18115}, misc2 = {EMPIR 2016: Energy}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.018115}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}stner, Bernd and Schm{\"a}hling, Franko and Hornemann, Andrea and Ulrich, Georg and Hoehl, Arne and Kruskopf, Mattias and Pierz, Klaus and Raschke, Markus B. and W{\"u}bbeler, Gerd and Elster, C.} } @Article { HarrisHRB2018, subid = {905}, title = {Signal-modelling methods applied to the free-field calibration of hydrophones and projectors in laboratory test tanks}, journal = {Measurement Science and Technology}, year = {2018}, month = {6}, day = {19}, volume = {29}, number = {8}, number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz}, pages = {085001}, keywords = {underwater acoustics, transducer calibration, signal-modelling, non-linear least-squares}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aac752}, stag_bib_extends_levelofaccess = {NA}, author = {Robinson, S.P. and Hayman, G. and Harris, P.M. and Beamiss, G.A.} } @Article { TettamanziKDRMHTRK2018, subid = {828}, title = {Gigahertz Single-Electron Pumping Mediated by Parasitic States}, journal = {Nano Letters}, year = {2018}, month = {6}, day = {19}, volume = {18}, number = {7}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {4141-4147}, keywords = {silicon electron pump}, web_url = {https://arxiv.org/abs/1803.00791}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1530-6984, 1530-6992}, DOI = {10.1021/acs.nanolett.8b00874}, stag_bib_extends_levelofaccess = {NA}, author = {Rossi, A. and Klochan, J. and Timoshenko, J. and Hudson, F.E. and M{\"o}tt{\"o}nen, M. and Rogge, S. and Dzurak, A.S. and Kashcheyevs, V. and Tettamanzi, G.C.} } @Article { HorvatJPP2018, subid = {566}, title = {Mercury fractionation in gypsum using temperature desorption and mass spectrometric detection}, journal = {Open Chemistry}, year = {2018}, month = {6}, day = {14}, volume = {16}, number = {1}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {544-555}, keywords = {Mass spectrometry; Mercury; Temperature programmed, desorption; WFGD gypsum; Particle size, fractions}, web_url = {https://doi.org/10.1515/chem-2018-0046}, misc2 = {EMPIR 2016: Environment}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2391-5420}, DOI = {10.1515/chem-2018-0046}, stag_bib_extends_levelofaccess = {NA}, author = {Pavlin, M. and Popovič, A. and Jaćimović, R. and Horvat, M.} } @Article { RaaymakersKvHWvW2018, subid = {951}, title = {A formalism for reference dosimetry in photon beams in the presence of a magnetic field}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {6}, day = {11}, volume = {63}, number = {12}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {125008}, keywords = {Dosimetry, MRgRT, Radiotherapy, magnetic fields}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aac70e/meta}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aac70e}, stag_bib_extends_levelofaccess = {NA}, author = {van Asselen, B. and Woodings, S.J. and Hackett, S.L. and van Soest, T.L. and Kok, J.G.M and Raaymakers, B.W and Wolthaus, J.W.H} } @Article { WidmaierVRLEHKL2018, title = {Interferometric step gauge for CMM verification}, journal = {Measurement Science and Technology}, year = {2018}, month = {6}, volume = {29}, number = {7}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {074012}, keywords = {CMM, verification, metrology}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aabd2b}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, DOI = {10.1088/1361-6501/aabd2b}, stag_bib_extends_levelofaccess = {NA}, author = {Widmaier, T. and Viitala, R. and Rantanen, A. and Laukkanen, P. and Esala, V.P. and Hemming, B. and Kuosmanen, P. and Lassila, A.} } @Proceedings { ProbstHDSPA2018, subid = {752}, title = {Effects Degrading Accuracy of CPW mTRL Calibration at W Band}, journal = {2018 IEEE/MTT-S International Microwave Symposium - IMS}, year = {2018}, month = {6}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1296-1299}, keywords = {Calibration, measurement accuracy, on-wafer measurement, probe}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/effects-degrading-accuracy-of-cpw-mtrl-calibration-at-w-band}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, event_place = {Philadelphia}, event_name = {2018 IEEE/MTT-S International Microwave Symposium - IMS}, event_date = {10-06-2018 to 15-06-2018}, language = {30}, DOI = {10.1109/MWSYM.2018.8439837}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Heinrich, W. and Probst, T. and Arz, U.} } @Article { MaheSHDMPLOC2018, subid = {896}, title = {Investigation of new volumetric non-destructive techniques to characterise additive manufacturing parts}, journal = {Welding in the World}, year = {2018}, month = {6}, volume = {62}, number = {5}, number2 = {15HLT09: MetAMMI: Metrology for additively manufactured medical implants}, pages = {1049-1057}, keywords = {Additive manufacturing, Volumetric non-destructive techniques (NDTs), Archimedes’ method, Gas pycnometric method, Multi-frequency eddy current method, C-scan ultrasound method}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {0043-2288, 1878-6669}, DOI = {10.1007/s40194-018-0593-7}, stag_bib_extends_levelofaccess = {NA}, author = {Obaton, A.F. and Le, M.Q. and Prezza, V. and Marlot, D. and Delvart, P. and Huskic, A. and Senck, S. and Mah{\'e}, E. and Cayron, C.} } @Article { LuoHLCSZCPPG2018, subid = {1169}, title = {Chinese SPRIGT realizes high temperature stability in the range of 5–25 K}, journal = {Science Bulletin}, year = {2018}, month = {6}, volume = {63}, number = {12}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {733-734}, keywords = {low-temperature, cryogenic temperature, primary thermometry, refractive-index gas thermometry, microwave resonator}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2095-9273}, DOI = {10.1016/j.scib.2018.05.023}, stag_bib_extends_levelofaccess = {NA}, author = {Gao, B. and Pan, C. and Pitre, L. and Chen, H. and Chen, Y. and Zhang, H. and Song, Y. and Liu, W. and Han, D. and Luo, E.} } @Article { HaeringLMDRK2018, subid = {838}, title = {Feasibility of polymer gel-based measurements of radiation isocenter accuracy in magnetic fields}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {5}, day = {29}, volume = {63}, number = {11}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {11NT02}, keywords = {3D-dosimetry, MRgRT, gel-dosimetry}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6560/aac228/meta}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aac228}, stag_bib_extends_levelofaccess = {NA}, author = {Dorsch, S. and Mann, P. and Lang, C. and Haering, P. and Runz, A. and Karger, C.P.} } @Proceedings { BymanLHBSS2018, subid = {870}, title = {Online measurement of optical fibre geometry during manufacturing}, journal = {Proc. SPIE}, year = {2018}, month = {5}, day = {17}, volume = {10683}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1068318}, keywords = {fibre, manufacturing, concentricity, scatterometry, modelling}, web_url = {https://arxiv.org/abs/1806.07596}, misc2 = {EMPIR 2014: Industry}, publisher = {SPIE}, event_place = {Strasbourg}, event_name = {Fiber Lasers and Glass Photonics: Materials through Applications}, event_date = {22-04-2018 to 26-04-2018}, language = {30}, DOI = {10.1117/12.2314762}, stag_bib_extends_levelofaccess = {NA}, author = {Shpak, M. and Burger, S. and Haapalainen, M. and Lassila, A. and Byman, V. and Saastamoinen, K.} } @Article { LiuHSFB2018, subid = {822}, title = {Fast and cost-effective in-process defect inspection for printed electronics based on coherent optical processing}, journal = {Optics Express}, year = {2018}, month = {5}, day = {16}, volume = {26}, number = {11}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {13927}, keywords = {all-optical difference engine, defects, detection, printed electronics, roll-to-roll, Fourier optics and signal processing, Spatial filtering, Imaging systems, Optical inspection, Optical sensing and sensors}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-11-13927}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.013927}, stag_bib_extends_levelofaccess = {NA}, author = {Feng, X. and Su, R. and Happonen, T. and Liu, J. and Leach, Richard} } @Article { HudlickaHBL2018, subid = {794}, title = {Prediction of SINR using BER and EVM for Massive MIMO Applications}, journal = {EuCAP}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {SINR, EVM, BER, Interference Characterisation, Massive MIMO}, web_url = {http://epubs.surrey.ac.uk/846356/}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1809.07811}, author = {Hudlicka, M. and Humphreys, D.A. and Brown, T.W.C. and Loh, T. H.} } @Article { BuismanCHL2018, subid = {797}, title = {An Evaluation of Distortion and Interference Sources originating Within a Millimeter-wave MIMO Testbed for 5G Communications}, journal = {URSI}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {MIMO, Testbed, Interference, Distortion}, web_url = {http://www.ursi.org/proceedings/procAT18/papers/SA052.pdf}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1809.07825}, author = {Buisman, K. and Cheadle, D. and Humphreys, D. and Loh, T. H.} } @Article { AxnerZHS2018, subid = {804}, title = {Gas modulation refractometry for high-precision assessment of pressure under non-temperature-stabilized conditions}, journal = {Journal of Vacuum Science \& Technology A: Vacuum, Surfaces, and Films}, year = {2018}, month = {5}, volume = {36}, number = {3}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {03E105}, keywords = {GAs modulation refractometry, Fabry Perot cavity refractometry}, misc2 = {EMPIR 2014: Industry}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5022244}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Hausmaninger, T. and Zelan, M. and Axner, O.} } @Article { ErikssonHLCB2018, subid = {800}, title = {Millimeter-Wave Over-the-Air Signal-to-Interference-plus-Noise-Ratio Measurements Using aMIMO Testbed}, journal = {URSI}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Millimeter-waveSINRMIMO}, misc2 = {EMPIR 2014: Industry}, language = {30}, DOI = {10.23919/URSI-AT-RASC.2018.8471560}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://research.chalmers.se/en/publication/505084}, author = {Buisman, K and Cheadle, D and Loh, T H and Humphreys, D and Eriksson, T } } @Article { HeinrichSPHDKA2018, subid = {1053}, title = {Traceable Coplanar Waveguide Calibrations on Fused Silica Substrates up to 110 GHz}, journal = {IEEE TRANSACTIONS ON MICROWAVE THEORY AND TECHNIQUES}, year = {2018}, month = {4}, day = {19}, volume = {t.b.d.}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1-10}, keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=8693763}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TMTT.2019.2908857}, stag_bib_extends_levelofaccess = {NA}, author = {Arz, U. and Kuhlmann, K. and Dziomba, T. and Hechtfischer, G. and Phung, G. and Schm{\"u}ckle, F. and Heinrich, W.} } @Article { KastnerJHKPHHUFPRU2018, subid = {1690}, title = {Infrared Nanospectroscopy of Phospholipid and Surfactin Monolayer Domains}, journal = {ACS Omega}, year = {2018}, month = {4}, day = {12}, volume = {3}, number = {4}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {4141-4147}, keywords = {-}, misc2 = {EMPIR 2016: Energy}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2470-1343, 2470-1343}, DOI = {10.1021/acsomega.7b01931}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}stner, B. and Johnson, C.M. and Hermann, P. and Kruskopf, M. and Pierz, K. and Hoehl, A. and Hornemann, A. and Ulrich, G. and Fehmel, J. and Patoka, P. and Ruhl, E. and Ulm, G.} } @Article { KajastieOPSSPH2018, title = {Effects of Sample Handling and Transportation on the Moisture Content of Biomass Samples}, journal = {International Journal of Thermophysics}, year = {2018}, month = {4}, volume = {39}, number = {5}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Biomass, Moisture content, Sample handling, Transportation}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-018-2382-3}, stag_bib_extends_levelofaccess = {NA}, author = {Kajastie, H. and Ojanen-Saloranta, M. and Patel, S. and Sairanen, H. and Salminen, J. and Palkova, Z. and Heinonen, M.} } @Article { MarquesBMHIPSGS2018_2, subid = {520}, title = {Theoretical and experimental determination of K- and L-shell x-ray relaxation parameters in Ni}, journal = {Physical Review A}, year = {2018}, month = {4}, volume = {97}, number = {4}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {042501}, keywords = {Electronic Structure, X-ray Fluorescence, Fundamental Parameters, Fluorescence Yields, Condensed matter}, web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.97.042501}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.97.042501}, stag_bib_extends_levelofaccess = {NA}, author = {Guerra, M. and Sampaio, J. M. and Parente, F. and Indelicato, P. and Honicke, P. and Muller, M. and Beckhoff, B. and Marques, J. P. and Santos, J. P.} } @Article { AarhaugHAGCMB2018, subid = {502}, title = {Probability of occurrence of ISO 14687-2 contaminants in hydrogen: Principles and examples from steam methane reforming and electrolysis (water and chlor-alkali) production processes model}, journal = {International Journal of Hydrogen Energy}, year = {2018}, month = {4}, number2 = {15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications}, keywords = {ISO14687-2, Hydrogen quality, Fuel cell electrical vehicle, Probability of occurrence, Hydrogen production process, ISO 19880-8}, web_url = {https://www.sciencedirect.com/science/article/pii/S0360319918308450}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2018.03.084}, stag_bib_extends_levelofaccess = {NA}, author = {Bacquart, T and Murugan, A and Carr{\'e}, M and Gozlan, B and Aupr{\^e}tre, F and Haloua, F and Aarhaug, T.A.} } @Article { MolinaFernandezHOVWGHV2018, subid = {570}, title = {Ultra-Broadband Mode Converter and Multiplexer Based on Sub-Wavelength Structures}, journal = {IEEE Photonics Journal}, year = {2018}, month = {4}, volume = {10}, number = {2}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1-10}, keywords = {Mode-division multiplexing, mode-converter, broadband, sub-wavelength grating waveguides, silicon-on-insulator}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1943-0655}, DOI = {10.1109/JPHOT.2018.2819364}, stag_bib_extends_levelofaccess = {NA}, author = {Gonzalez-Andrade, D. and Wanguemert-Perez, J.G. and Velasco, A. and Velasco, A.V. and Ortega-Monux, A. and Herrero-Bermello, A. and Molina-Fernandez, I. and Halir, R.} } @Article { PlimmerOHB2018, subid = {807}, title = {Development and characterisation of a low pressure transfer standard in the range 1 Pa to 10 kPa}, journal = {ACTA IMEKO}, year = {2018}, month = {4}, volume = {7}, number = {1}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {80}, keywords = {pressure, vacuum, transfer standard, resonant silicon gauge, mcapacitance diaphragm gauge}, misc2 = {EMPIR 2014: Industry}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v7i1.496}, stag_bib_extends_levelofaccess = {NA}, author = {Boineau, F. and Huret, S. and Otal, P. and Plimmer, M.} } @Proceedings { EbenhagWH2018, subid = {1120}, title = {Analysis and compensation of polarization in an optical frequency transfer through a fiber communication network}, journal = {2018 European Frequency and Time Forum (EFTF)}, year = {2018}, month = {4}, volume = {1}, number = {1}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {pp. 253-257}, keywords = {fiber, frequency transfer, heterodyne detection, coherent, polarization,}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2018.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Torino, IT}, event_name = {2018 European Frequency and Time Forum (EFTF)}, event_date = {10-04-2018 to 12-04-2018}, language = {30}, ISBN = {978-1-5386-4077-7}, DOI = {10.1109/EFTF.2018.8409044}, stag_bib_extends_levelofaccess = {NA}, author = {Hedekvist, P.O. and Weddig, L. and Ebenhag, S.C.} } @Article { ChudnovskyPGWKGWHZBNZZZZ2018, subid = {582}, title = {Direct writing of room temperature and zero field skyrmion lattices by a scanning local magnetic field}, journal = {Applied Physics Letters}, year = {2018}, month = {3}, day = {26}, volume = {112}, number = {13}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {132405}, keywords = {magnetic skyrmion, magnetic force microscopy, stray field, perpendicular magnetic anisotropy}, web_url = {http://hdl.handle.net/10754/627497}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/1.5021172}, stag_bib_extends_levelofaccess = {NA}, author = {Zhang, X, and Zhang, S. and Zhang, J. and Zhang, Q. and Barton, C. and Neu, V. and Zhao, Y. and Hou, Z. and Wen, Y. and Gong, C. and Kazakova, O. and Wang, W. and Peng, Y. and Garanin, D.A. and Chudnovsky, E.M.} } @Article { RawsonHAS2018, subid = {841}, title = {Electrochemically stimulating developments in bioelectronic medicine}, journal = {Bioelectronic Medicine}, year = {2018}, month = {3}, day = {15}, volume = {4}, number = {1}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, keywords = {Bioelectronic interfaces, Bioelectrochemistry, Nanobioelectronics, Cellular signalling}, web_url = {https://link.springer.com/content/pdf/10.1186\%2Fs42234-018-0001-z.pdf}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature}, language = {30}, ISSN = {2332-8886}, DOI = {10.1186/s42234-018-0001-z}, stag_bib_extends_levelofaccess = {NA}, author = {Sanjuan-Alberte, P. and Alexander, M.R. and Hague, R.J.M. and Rawson, F.J.} } @Article { FagerGLHE2018, subid = {788}, title = {Digital Predistortion for Multi-Antenna Transmitters Affected by Antenna Crosstalk}, journal = {IEEE}, year = {2018}, month = {3}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Antenna crosstalk, digital predistortion (DPD), multiple-input multiple-output (MIMO) transmitter, power amplifier (PA) linearization}, web_url = {https://research.chalmers.se/publication/252918/file/252918_Fulltext.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TMTT.2017.2748948}, stag_bib_extends_levelofaccess = {NA}, author = {Hausmair, K. and Landin, P.N. and Gustavsson, U. and Fager, C. and Eriksson, T .} } @Article { PaleckiOMLLJIHHGDTPdTVM2018_2, title = {Towards a global land surface climate fiducial reference measurements network}, journal = {International Journal of Climatology}, year = {2018}, month = {3}, volume = {38}, number = {6}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {2760-2774}, keywords = {climate, metrology, essential climate variables, climate change}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley}, language = {30}, ISSN = {0899-8418}, DOI = {10.1002/joc.5458}, stag_bib_extends_levelofaccess = {NA}, author = {Palecki, M. and Oakley, T. and Merlone, A. and Lawrimore, J. H. and Lister, D. H. and Jones, P. D. and Ingleby, N. B. and Hausfather, Z. and Harrigan, S. and Goodison, B. and Diamond, H. J. and Thorne, P. W. and Peterson, T. C. and de Podesta, M. and Tassone, C. and Venema, V. and Mana, G.} } @Article { GilmoreTSH2018, subid = {559}, title = {SIMS of Organic Materials—Interface Location in Argon Gas Cluster Depth Profiles Using Negative Secondary Ions}, journal = {Journal of The American Society for Mass Spectrometry}, year = {2018}, month = {2}, day = {21}, volume = {29}, number = {4}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {774-785}, keywords = {SIMS}, web_url = {https://link.springer.com/article/10.1007\%2Fs13361-018-1905-2}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer US}, language = {30}, ISSN = {1044-0305, 1879-1123}, DOI = {10.1007/s13361-018-1905-2}, stag_bib_extends_levelofaccess = {NA}, author = {Havelund, R. and Seah, M. P. and Tiddia, M. and Gilmore, I. S.} } @Article { SylvainCHF2018, title = {Exploitation of a novel thermo-invariant multi-feature bar for high-precision CMMs and machine tool testing}, journal = {The International Journal of Advanced Manufacturing Technology}, year = {2018}, month = {2}, day = {18}, volume = {96}, number = {1-4}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {947–961}, keywords = {Material standard; Calibration; Geometric errors; Intercomparison; Traceability}, web_url = {https://link.springer.com/article/10.1007/s00170-017-1572-7\#enumeration}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Springer London}, language = {30}, ISSN = {1433-3015}, DOI = {10.1007/s00170-017-1572-7}, stag_bib_extends_levelofaccess = {NA}, author = {Sylvain, L. and Christophe, T. and Hichem, N. and Fabien, V.} } @Article { CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018, subid = {812}, title = {Geodesy and metrology with a transportable optical clock}, journal = {Nature Physics}, year = {2018}, month = {2}, day = {12}, volume = {14}, number = {5}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {437-441}, keywords = {optical fiber, optical frequency transfer}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-017-0042-3}, stag_bib_extends_levelofaccess = {NA}, author = {Costanzo, G.A. and Zucco, M. and Barbieri, P. and Tampellini, A. and Bregolin, F. and Rauf, B. and Pizzocaro, M. and Thoumany, P. and Margolis, H.S. and Zampaolo, M. and Rolland, A. and Baynes, F.N. and Timmen, L. and Denker, H. and Voigt, C. and Lisdat, C. and H{\"a}fner, S. and Sterr, U. and Vogt, S. and Koller, S. and Grotti, J. and Clivati, C. and Levi, F. and Calonico, D.} } @Article { HudlickaPOPAS2018, subid = {597}, title = {Waveform Approach for Assessing Conformity of CISPR 16-1-1 Measuring Receivers}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2018}, month = {2}, volume = {67}, number = {5}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1187-1198}, keywords = {Receivers, Electromagnetic interference, Calibration, Current measurement, Standards, Real-time systems, Frequency measurement}, misc2 = {EMPIR 2015: Research Potential}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2794941}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://upcommons.upc.edu/handle/2117/116447}, author = {Azpurua, M.A. and Pous, M. and Oliva, J.A. and Pinter, B. and Hudlicka, M. and Silva, F.} } @Article { HollandtMGRDv2018, title = {Traceability of the Network for Detection of the Mesospheric Change (NDMC) to radiometric standards via a Near Infrared Filter Radiometer}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {2}, volume = {972}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {012006}, keywords = {Traceability, radiometric standards}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/972/1/012006}, stag_bib_extends_levelofaccess = {NA}, author = {Hollandt, J. and Monte, C. and Gutschwager, B. and Reiniger, M. and Dekker, P. and van den Berg, S.} } @Article { PeyresERHVPLMGDMC2018, title = {Measurement of absolute \(\gamma\)-ray emission probabilities in the decay of 235 U}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {2}, volume = {132}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {72-78}, keywords = {\(\gamma\)-ray spectrometry, 235U, 231Th, Decay data, \(\gamma\)-ray emission probabilities, NORM}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.10.049}, stag_bib_extends_levelofaccess = {NA}, author = {Peyres, V. and Eykens, R. and Richter, S. and Hult, M. and Van Ammel, R. and Pomm{\'e}, S. and Lutter, G. and Marouli, M. and Garc{\'i}a-Tora{\~n}o, E. and Dry{\'a}k, P. and Maz{\'a}nov{\'a}, M. and Carconi, P.} } @Article { StevenSRPGGGHPTB2018, title = {A calibration procedure for a traceable contamination analysis on medical devices by combined X-ray spectrometry and ambient spectroscopic techniques}, journal = {Journal of Pharmaceutical and Biomedical Analysis}, year = {2018}, month = {2}, volume = {150}, number = {1}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {308-317}, keywords = {XRF; Reference-free; N,N’-ethylene-bis (stearamide); Vibrational spectroscopy; Medical device}, web_url = {https://www.sciencedirect.com/science/article/abs/pii/S0731708517310609}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0731-7085}, DOI = {10.1016/j.jpba.2017.12.007}, stag_bib_extends_levelofaccess = {NA}, author = {Steven, R. and Seim, C. and Rossi, A. and Portesi, C. and Gunning, P. and Green, F. and Giovannozzi, A.M. and Hornemann, A. and Pollakowski-Herrmann, B. and Tyler, B. and Beckhoff, B.} } @Article { HenaultCLDRBFMBH2018, subid = {374}, title = {A metrological comparison of Raman-distributed temperature sensors}, journal = {Measurement}, year = {2018}, month = {2}, volume = {116}, number2 = {16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities}, pages = {18-24}, keywords = {Distributed temperature sensors; Raman; Metrology; Structural health monitoring; Optical fibres}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224117306656}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2017.10.041}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Beaumont, O. and Razouk, R. and Delepine-Lesoille, S. and Landolt, M. and Courthial, B. and H{\'e}nault, J.M. and Martinot, F. and Bertrand, J. and Hay, B.} } @Article { HoferLRK2018, subid = {588}, title = {The absolutely characterized nitrogen vacancy center-based single-photon source – measurement uncertainty of photon flux and angular emission properties}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {2}, volume = {972}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {012008}, keywords = {single-photon source, Photon f,lux, measurement uncertainty, emission characterisitics}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/972/1/012008/pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/972/1/012008}, stag_bib_extends_levelofaccess = {NA}, author = {Rodiek, B and L{\'o}pez, M and Hofer, H and K{\"u}ck, S} } @Article { HauerSQK2018, subid = {1016}, title = {Polarization properties and microfacet-based modelling of white, grey and coloured matte diffuse reflection standards}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {2}, volume = {972}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {012024}, keywords = {Polarization, BRDF, Microfacet model, diffuse reflection Standards, BiRD-Project}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/972/1/012024}, stag_bib_extends_levelofaccess = {NA}, author = {Quast, T. and Schirmacher, A. and Hauer, K.O. and Koo, A.} } @Article { PeikTLHS2018, subid = {558}, title = {Autobalanced Ramsey Spectroscopy}, journal = {Physical Review Letters}, year = {2018}, month = {1}, day = {30}, volume = {120}, number = {5}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {053602}, keywords = {atomic clock, atomic spectroscopy, light shift}, web_url = {https://www.ptb.de/cms/en/ptb/fachabteilungen/abt4/fb-44/44-literatur.html\#c8360}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.120.053602}, stag_bib_extends_levelofaccess = {NA}, author = {Sanner, C. and Huntemann, N. and Lange, R. and Tamm, C. and Peik, E.} } @Article { ReitzensteinHRSKSFS2018_2, subid = {695}, title = {A stand-alone fiber-coupled single-photon source}, journal = {Scientific Reports}, year = {2018}, month = {1}, day = {22}, volume = {8}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1340}, keywords = {quantum-light source, semiconductor quantum dots}, web_url = {https://www.nature.com/articles/s41598-017-19049-4}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-19049-4}, stag_bib_extends_levelofaccess = {NA}, author = {Schlehahn, A. and Fischbach, S. and Schmidt, R. and Kaganskiy, A. and Strittmatter, A. and Rodt, S. and Heindel, T. and Reitzenstein, S.} } @Article { SaitoTTHSYHLSL2018, subid = {596}, title = {Random telegraph noise from resonant tunnelling at low temperatures}, journal = {Scientific Reports}, year = {2018}, month = {1}, day = {10}, volume = {8}, number = {1}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Random telegraph noise, Quantum dot, transistor}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-18579-1}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Yoshimoto, H. and Sasago, Y. and Hisamoto, D. and Tomita, I. and Tsuchiya, Y. and Saito, S.} } @Article { ScholzePEKHSB2018, subid = {478}, title = {Element sensitive reconstruction of nanostructured surfaces with finite elements and grazing incidence soft X-ray fluorescence}, journal = {Nanoscale}, year = {2018}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, keywords = {GIXRF, nanostructure characterization, FEM}, web_url = {https://arxiv.org/abs/1801.04157}, misc2 = {EMPIR 2014: Industry}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/C8NR00328A}, stag_bib_extends_levelofaccess = {NA}, author = {Soltwisch, V. and Honicke, P. and Kayser, Y. and Eilbracht, J. and Probst, J. and Scholze, F. and Beckhoff, B.} } @Article { BeckhoffMWJCHU2018, subid = {534}, title = {Accurate experimental determination of Gallium K- and L3-shell XRF fundamental parameters}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2018}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, keywords = {X-ray fluorescence, atomic fundamental parameters}, web_url = {https://arxiv.org/abs/1805.02951}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, address = {Thomas Graham House Science Park, Milton Rd Science Park, Milton Rd Cambridge CB4 0WF United Kingdom}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/C8JA00046H}, stag_bib_extends_levelofaccess = {NA}, author = {Unterumsberger, R. and Honicke, P. and Colaux, J.L. and Jeynes, C. and Wansleben, M. and Muller, M. and Beckhoff, B.} } @Article { KoblarFSJPH2018, subid = {1156}, title = {Distribution and Accumulation of Major and Trace Elements in Gypsum Samples from Lignite Combustion Power Plant}, journal = {American Journal of Analytical Chemistry}, year = {2018}, volume = {09}, number = {12}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {602-621}, keywords = {Trace and Major Elements, Wet Flue Gas Desulphurization Gypsum, Particle Size Fractions, Mercury and Selenium, Sample Preparation}, misc2 = {EMPIR 2016: Environment}, publisher = {Scientific Research Publishing, Inc,}, language = {30}, ISSN = {2156-8251, 2156-8278}, DOI = {10.4236/ajac.2018.912044}, stag_bib_extends_levelofaccess = {NA}, author = {Pavlin, M. and Jaćimović, R. and Stergaršek, A. and Frkal, P. and Koblar, M. and Horvat, M.} } @Proceedings { GowerBMHLKB2018, title = {Quantitative comparison of different non-destructive techniques for the detection of artificial defects in GFRP}, journal = {Proceedings of 12th European Conference on NDT}, year = {2018}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, keywords = {composites, non-destructive testing, defects}, web_url = {http://www.ndt.net/?id=22834}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Gothenburg}, event_name = {12th European Conference on Non Destructive Testing}, event_date = {11-06-2018 to 15-06-2018}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ecndt2018/papers/ecndt-0297-2018.pdf}, author = {Gower, M. and Brackrock, D. and Maierhofer, C. and Heckel, T. and Lodeiro, M. and Krankenhagen, R. and Baker, G.} } @Article { AlexanderWWNRPHH2018, subid = {844}, title = {Effect of surfactant on Pseudomonas aeruginosa colonization of polymer microparticles and flat films}, journal = {RSC Advances}, year = {2018}, volume = {8}, number = {28}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {15352-15357}, keywords = {nanoparticles, polymer microparticles, polymerizable monomer}, web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra01491d}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2046-2069}, DOI = {10.1039/C8RA01491D}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"u}sler, A. and Haas, S. and Parry, L. and Romero, M. and Nisisako, T. and Williams, P. and Wildman, R.D. and Alexander, M.R.} } @Article { BurnsRMNBFLADYHR2017, subid = {499}, title = {Antimicrobial peptide capsids of de novo design}, journal = {Nature Communications}, year = {2017}, month = {12}, day = {22}, volume = {8}, number = {1}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, pages = {2263}, keywords = {Antimicrobials, Protein design, Self-assembly, Biometrology}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-017-02475-3}, stag_bib_extends_levelofaccess = {NA}, author = {De Santis, E. and Alkassem, H. and Lamarre, B. and Faruqui, N. and Bella, A. and Noble, J.E. and Micale, N. and Ray, S. and Burns, J.R. and Yon, A.R. and Hoogenboom, B.W. and Ryadnov, M.G.} } @Article { HauptE2017, subid = {529}, title = {Thermoelemente auf Graphitbasis – M{\"o}glichkeiten und Grenzen}, journal = {tm - Technisches Messen}, year = {2017}, month = {12}, day = {20}, volume = {84}, number = {12}, number2 = {14IND04: EMPRESS: Enhancing process efficiency through improved temperature measurement}, pages = {779-786}, keywords = {Graphite, high temperatures, Seebeck coefficient, thermocouple}, misc2 = {EMPIR 2014: Industry}, publisher = {Walter de Gruyter GmbH}, language = {43}, ISSN = {0171-8096, 2196-7113}, DOI = {10.1515/teme-2017-0073}, stag_bib_extends_levelofaccess = {NA}, author = {Edler, F. and Haupt, S.} } @Article { SterrRZSOBHLYMR2017, subid = {720}, title = {Ultrastable Silicon Cavity in a Continuously Operating Closed-Cycle Cryostat at 4 K}, journal = {Physical Review Letters}, year = {2017}, month = {12}, day = {15}, volume = {119}, number = {24}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, keywords = {ultrastable laser, silicon cavity, 4K cryocooler, time and frequency standards}, web_url = {https://arxiv.org/abs/1708.05161}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.119.243601}, stag_bib_extends_levelofaccess = {NA}, author = {Zhang, W. and Robinson, J. M. and Sonderhouse, L. and Oelker, E. and Benko, C. and Hall, J. L. and Legero, T. and Matei, D. G. and Riehle, F. and Sterr, U. and Ye, J.} } @Article { NielsenAKKIIHGFCCBHOOSS2017, title = {New Primary Standards for Establishing SI Traceability for Moisture Measurements in Solid Materials}, journal = {International Journal of Thermophysics}, year = {2017}, month = {12}, volume = {39}, number = {1}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Karl Fischer, Loss-on-drying, Moisture, Oven drying, Traceability}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2340-5}, stag_bib_extends_levelofaccess = {NA}, author = {Nielsen, J. and Aro, R. and Krasheninina, M. and Keawprasert, T. and Ismail, N. and Ionescu, G.V. and Hudoklin, D. and Georgin, E. and Fernicola, V. and Cortellessa, G. and Choi, B.I. and Bell, S. and Heinonen, M. and Oguz Aytekin, S. and {\"O}sterberg, P. and Skabar, J. and Strnad, R.} } @Article { PivacPSDVFWKBHFDDB2017, subid = {544}, title = {Development and Synchrotron-Based Characterization of Al and Cr Nanostructures as Potential Calibration Samples for 3D Analytical Techniques}, journal = {physica status solidi (a)}, year = {2017}, month = {12}, volume = {215}, number = {6}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {1700866}, keywords = {SIMS, APT, GISAXS, 3D nanostructures, di-block copolymers}, misc2 = {EMPIR 2014: Industry}, publisher = {Wiley}, language = {30}, ISSN = {1862-6300}, DOI = {10.1002/pssa.201700866}, stag_bib_extends_levelofaccess = {NA}, author = {Dialameh, M. and Ferrarese Lupi, F. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Weimann, T. and Fleischmann, C. and Vandervorst, W. and Dubček, P. and Pivac, B. and Perego, M. and Seguini, G. and De Leo, N. and Boarino, L.} } @Proceedings { SchmuckleHPAZH2017, subid = {521}, title = {Establishing traceability for on-wafer S-parameter measurements of membrane technology devices up to 110 GHz}, journal = {2017 90th ARFTG Microwave Measurement Symposium (ARFTG)}, year = {2017}, month = {11}, day = {30}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {on-wafer, calibration, S-parameters, traceability,uncertainty budget}, web_url = {https://doi.org/10.1109/ARFTG.2017.8255874}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Boulder, Colorado}, event_name = {ARFTG Microwave Measurement Symposium}, event_date = {28-11-2017 to 01-12-2017}, language = {30}, ISBN = {978-1-5386-4356-3}, DOI = {10.7795/EMPIR.14IND02.CA.20190403}, stag_bib_extends_levelofaccess = {NA}, author = {Schmuckle, Franz-Josef and Heinrich, Wolfgang and Probst, Thorsten and Arz, Uwe and Zinal, Sherko and Hechtfischer, Gerd} } @Article { FountoulakisFGKKKHFDBBLRF2017, title = {Temperature dependence of the Brewer global UV measurements}, journal = {Atmospheric Measurement Techniques}, year = {2017}, month = {11}, day = {22}, volume = {10}, number = {11}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {4491-4505}, keywords = {Brewer spectrophotometer, temperature characterization, UV radiation}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-10-4491-2017}, stag_bib_extends_levelofaccess = {NA}, author = {Fountoulakis, I. and Fragkos, K. and Garane, K. and Koskela, T. and Karhu, J.M. and Karppinen, T. and Heikkila, A. and Feister, U. and Doppler, L. and Bais, A.F. and Berjon, A. and Lakkala, K. and Redondas, A. and Fountoulakis, I.} } @Article { BaeHCGHAK2017, subid = {414}, title = {Upper frequency limit depending on potential shape in a QD-based single electron pump}, journal = {Journal of Applied Physics}, year = {2017}, month = {11}, day = {21}, volume = {122}, number = {19}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {194502}, keywords = {single electron pump, quantum dot, single electron tunneling}, web_url = {http://aip.scitation.org/doi/abs/10.1063/1.5000319}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979, 1089-7550}, DOI = {10.1063/1.5000319}, stag_bib_extends_levelofaccess = {NA}, author = {Ahn, Y.H. and Hong, Y.P. and Hong, C. and Ghee, Y.S. and Chung, Y. and Bae, M.H. and Kim, N.} } @Article { EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017, subid = {602}, title = {First patients treated with a 1.5 T MRI-Linac: clinical proof of concept of a high-precision, high-field MRI guided radiotherapy treatment}, journal = {Physics in Medicine \& Biology}, year = {2017}, month = {11}, day = {14}, volume = {62}, number = {23}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {L41-L50}, keywords = {MRgRT, Radiotherapy, MRI}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aa9517}, stag_bib_extends_levelofaccess = {NA}, author = {Raaymakers, B W and J{\"u}rgenliemk-Schulz, I M and Bol, G H and Glitzner, M and Kotte, A N T J and van Asselen, B and de Boer, J C J and Bluemink, J J and Hackett, S L and Moerland, M A and Woodings, S J and Wolthaus, J W H and van Zijp, H M and Philippens, M E P and Tijssen, R and Kok, J G M and de Groot-van Breugel, E N and Kiekebosch, I and Meijers, L T C and Nomden, C N and Sikkes, G G and Doornaert, P A H and Eppinga, W S C and Kasperts, N and Kerkmeijer, L G W and Tersteeg, J H A and Brown, K J and Pais, B and Woodhead, P and Lagendijk, J J W} } @Article { SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017, title = {The MeteoMet2 project – Highlights and results}, journal = {Measurement Science and Technology}, year = {2017}, month = {11}, day = {13}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa99fc}, stag_bib_extends_levelofaccess = {NA}, author = {Šindel{\'a}rov{\'a}, L. and Sestan, D. and Salminen, J. and Sairanen, H. and Rosso, L. and del Rio, J. and Rasmussen, M.K. and Oguz Aytekin, S. and de Podesta, M. and Pavlasek, P. and Nogueras Cervera, M. and Nielsen, J. and Musacchio, C. and Miao, P. and Lanza, L.G. and Kowal, A. and Kalemci, M. and Hudoklin, D. and H{\"o}gstr{\"o}m, R. and Hernandez de la Villa, S. and Heinonen, M. and Groselj, D. and Gonzalez Calvo, A. and Georgin, E. and Gardiner, T. and Garc{\'i}a Izquierdo, C. and Garcia-Benad{\'i}, A. and Fernicola, V and Ebert, V. and Drnovsek, J. and Dobre, M. and Cuccaro, R. and Coppa, G. and Colli, M. and Chiodo, N. and Castrillo, A. and del Campo, D. and Brunet, M. and Bojkovski, J. and Beltramino, G. and Bell, S.A. and Beges, G. and Sanna, F. and Merlone, A. and Smorgon, D. and Sparasci, F. and Strnad, R. and Vold{\'a}n, M. and Underwood, R.J. and Mana, G.} } @Article { GustavssonLSGHEF2017, subid = {319}, title = {Prediction of Nonlinear Distortion in Wideband Active Antenna Arrays}, journal = {IEEE}, year = {2017}, month = {11}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Active antenna array, antenna crosstalk, mismatch, multiple-input multiple-output (MIMO) transmitter (TX), power-amplifier (PA) modeling}, web_url = {https://research.chalmers.se/publication/252917/file/252917_Fulltext.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TMTT.2017.2699962}, stag_bib_extends_levelofaccess = {NA}, author = {Hausmair, K. and Gustafsson, S. and Sanchez-Perez, C. and Landin, P.N. and Gustavsson, U. and Eriksson, T. and Fager, C.} } @Article { ZhaoRGFHMKF2017, subid = {405}, title = {Thermal-Error Regime in High-Accuracy Gigahertz Single-Electron Pumping}, journal = {Physical Review Applied}, year = {2017}, month = {10}, day = {30}, volume = {8}, number = {4}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Single electron pumps}, web_url = {https://arxiv.org/abs/1703.04795}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.8.044021}, stag_bib_extends_levelofaccess = {NA}, author = {Zhao, R. and Rossi, A. and Giblin, S. P. and Fletcher, J. D. and Fletcher, J. and Hudson, F. E. and M{\"o}tt{\"o}nen, M. and Kataoka, M.} } @Article { UlmKECCSHFB2017, subid = {450}, title = {A pilot study on fingerprinting Leishmania species from the Old World using Fourier transform infrared spectroscopy}, journal = {Analytical \& Bioanalytical Chemistry}, year = {2017}, month = {10}, day = {28}, volume = {409}, number = {29}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {6907-6923}, keywords = {Fourier transforminfrared spectroscopy, Hierarchical cluster analysis (HCA), Principal componentsanalysis (PCA), Leishmania, DNA, Multivariate differentiation}, misc2 = {EMPIR 2015: Health}, publisher = {Springer}, language = {30}, ISSN = {1618-2642}, DOI = {10.1007/s00216-017-0655-5}, stag_bib_extends_levelofaccess = {NA}, author = {Hornemann, A. and Sinning, D. and Cortes, S. and Campino, L. and Emmer, P. and Kuhls, K. and Ulm, G. and Frohme, M. and Beckhoff, B.} } @Article { GilmoreHS2017, subid = {64}, title = {SIMS of Delta Layers in Organic Materials: Amount of Substance, Secondary Ion Species, Matrix Effects, and Anomalous Structures in Argon Gas Cluster Depth Profiles}, journal = {The Journal of Physical Chemistry C}, year = {2017}, month = {10}, day = {26}, volume = {120}, number = {46}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {26328–26335}, keywords = {mass-spectrometry, sputtering yields, response function, impurity layers, semiconductors, suppression, interfaces, emission, beams}, web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcc.6b08646}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society}, address = {Washington}, language = {30}, ISSN = {1932-7455}, DOI = {10.1021/acs.jpcc.6b08646}, stag_bib_extends_levelofaccess = {NA}, author = {Seah, M.P. and Havelund, R. and Gilmore, I.S.} } @Article { QuinceyVTSPMMHWBWWSN2017, subid = {956}, title = {Mobility particle size spectrometers: Calibration procedures and measurement uncertainties}, journal = {Aerosol Science and Technology}, year = {2017}, month = {10}, day = {26}, volume = {52}, number = {2}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {146-164}, keywords = {aerosol metrology , mobility particle size spectrometers , calibration, measurement uncertainties}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, language = {30}, ISSN = {0278-6826, 1521-7388}, DOI = {10.1080/02786826.2017.1387229}, stag_bib_extends_levelofaccess = {NA}, author = {Wiedensohler, A. and Wiesner, A. and Weinhold, K. and Birmili, W. and Hermann, M. and Merkel, M. and M{\"u}ller, T. and Pfeifer, S. and Schmidt, A. and Tuch, T. and Velarde, F. and Quincey, P. and Seeger, S. and Nowak, A.} } @Article { JennettH2017, subid = {935}, title = {A method to separate and quantify the effects of indentation size, residual stress and plastic damage when mapping properties using instrumented indentation}, journal = {Journal of Physics D: Applied Physics}, year = {2017}, month = {10}, day = {20}, volume = {50}, number = {45}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {455304}, keywords = {.}, web_url = {https://pure.coventry.ac.uk/ws/portalfiles/portal/12629973/Hou_and_Jennett_Accpeted_version.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0022-3727, 1361-6463}, DOI = {10.1088/1361-6463/aa8a22}, stag_bib_extends_levelofaccess = {NA}, author = {Hou, X D and Jennett, N M} } @Article { TunnermannESHLWSSPB2017, subid = {388}, title = {Measuring thermal load in fiber amplifiers in the presence of transversal mode instabilities}, journal = {Optics Letters}, year = {2017}, month = {10}, day = {18}, volume = {42}, number = {21}, number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {4311-4314}, keywords = {Fiber optics amplifiers and oscillators, Thermal effects, Fiber properties, High power lasers}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-42-21-4311}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society of America}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.42.004311}, stag_bib_extends_levelofaccess = {NA}, author = {Beier, F. and Pl{\"o}tner, M. and Sattler, B. and Stutzki, F. and Walbaum, T. and Liem, A. and Haarlammert, N. and Schreiber, T. and Eberhardt, R. and T{\"u}nnermann, A.} } @Article { HallstromL2017, title = {Optimizing Temperature Coefficient and Frequency Response of Rogowski Coils}, journal = {IEEE Sensors Journal}, year = {2017}, month = {10}, day = {15}, volume = {17}, number = {20}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {6646-6652}, keywords = {Current measurement, inductive transducers, power systems, RLC circuits, smart grids, Temperature dependence}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1530-437X, 1558-1748, 2379-915}, DOI = {10.1109/JSEN.2017.2743259}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"a}llstr{\"o}m, J. and Lehtonen, T.A.} } @Proceedings { HoogenboomAHR2017, subid = {391}, title = {Meeting ecodesign efficiency requirements: ensuring accuracy in power transformer loss tests via TLM system calibrations}, journal = {CIRED - Open Access Proceedings Journal}, year = {2017}, month = {10}, volume = {2017}, number = {1}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, pages = {329-332}, keywords = {power transformer testing power factor; error sources; Ecodesign Directive; sustainable energy policies; high-quality TLM systems; efficiency requirements; power transformer loss test; TLM system calibration; transformer loss measurement systems; EU; calibration accuracies; advanced digital signal processing technique; ecodesign efficiency requirement}, tags = {SEG}, web_url = {http://digital-library.theiet.org/content/journals/10.1049/oap-cired.2017.0475}, misc2 = {EMPIR 2014: Industry}, publisher = {Institution of Engineering and Technology (IET)}, event_place = {Scottish Event Campus (SEC), Glasgow, Scotland}, event_name = {CIRED 2017}, event_date = {12-06-2017 to 15-06-2017}, language = {30}, ISSN = {2515-0855}, DOI = {10.1049/oap-cired.2017.0475}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, G. and Houtzager, E. and Acanski, M. and Hoogenboom, D.} } @Proceedings { NelsonNHFSH2017, title = {Optical voltage sensor for MV networks}, journal = {2017 IEEE SENSORS}, year = {2017}, month = {10}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {1-3}, keywords = {Fiber Bragg grating, optical voltage sensor, power system instrumentation, electronic voltage transformer}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Glasgow, UK}, event_name = {IEEE Sensors 2017}, event_date = {30-10-2017 to 01-11-2017}, language = {30}, DOI = {10.1109/ICSENS.2017.8234104}, stag_bib_extends_levelofaccess = {NA}, author = {Nelson, J. and Niewczas, P. and Havunen, J. and Fusiek, G. and Suomalainen, E-P. and H{\"a}llstr{\"o}m, J.} } @Proceedings { GrandidierEBXFMDAHD2017, subid = {421}, title = {Nano-probing station incorporating MEMS probes for 1D device RF on-wafer characterization}, journal = {2017 47th European Microwave Conference (EuMC)}, year = {2017}, month = {10}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {MEMS GSG Probe, nano-prober, Nanowire, on-wafer, microwave}, web_url = {https://hal.archives-ouvertes.fr/hal-01726555}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Nuremberg}, event_name = {EuMC}, event_date = {08-10-2017 to 12-10-2017}, language = {30}, DOI = {10.23919/EuMC.2017.8230973}, stag_bib_extends_levelofaccess = {NA}, author = {Daff{\'e}, K. and Marzouk, J. and Fellahi, A. El and Xu, T. and Boyaval, C. and Eliet, S. and Grandidier, B. and Arscott, S. and Dambrine, G. and Haddadi, K.} } @Article { WehmannLSTVASFNLZSHW2017, title = {Study of 3D-growth conditions for selective area MOVPE of high aspect ratio GaN fins with non-polar vertical sidewalls}, journal = {Journal of Crystal Growth}, year = {2017}, month = {10}, volume = {476}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {90-98}, keywords = {Crystal morphology, Metalorganic vapor phase epitaxy, Gallium compounds, Nitrides, Light emitting diodes}, web_url = {http://www.sciencedirect.com/science/article/pii/S0022024817305146}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0022-0248}, DOI = {10.1016/j.jcrysgro.2017.08.021}, stag_bib_extends_levelofaccess = {NA}, author = {Wehmann, H-H and Lugauer, H-J and Stra{\ss}burg, M. and Trampert, A. and Varghese, T. and Avramescu, A. and Schimpke, T. and F{\"u}ndling, S. and Nicolai, L. and Ledig, J. and Zhou, H. and Steib, F. and Hartmann, J. and Waag, A} } @Proceedings { FritzschDSPH2017, subid = {530}, title = {Impact of parasitic coupling on multiline TRL calibration}, journal = {2017 47th European Microwave Conference (EuMC)}, year = {2017}, month = {10}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {835-838}, keywords = {Measurements, probes, coupling, parasitic modes, em simulation}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/impact-of-parasitic-coupling-on-multiline-trl-calibration-1}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Nuremberg}, event_name = {2017 47th European Microwave Conference}, event_date = {10-10-2017 to 12-10-2017}, language = {30}, DOI = {10.23919/EuMC.2017.8230974}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G. N. and Schmuckle, F. J. and Doerner, R. and Fritzsch, T. and Heinrich, W.} } @Article { RiechelmannHEKGS2017, title = {The high-resolution extraterrestrial solar spectrum (QASUMEFTS) determined from ground-based solar irradiance measurements}, journal = {Atmospheric Measurement Techniques}, year = {2017}, month = {9}, day = {15}, volume = {10}, number = {9}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {3375-3383}, keywords = {extraterrestrail spectrum, QASUMEFTS, QASUME}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-10-3375-2017}, stag_bib_extends_levelofaccess = {NA}, author = {Riechelmann, S. and H{\"u}lsen, G. and Egli, L. and Kr{\"o}ger, I. and Gr{\"o}bner, J. and Sperfeld, P.} } @Article { RobinsonIHG2017, title = {Field Validation of Remote Sensing Methane Emission Measurements}, journal = {Remote Sensing}, year = {2017}, month = {9}, day = {14}, volume = {9}, number = {9}, number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions}, pages = {956}, keywords = {validation; emission measurements; DIAL; remote measurements; methane}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs9090956}, stag_bib_extends_levelofaccess = {NA}, author = {Robinson, R. and Innocenti, F. and Helmore, J. and Gardiner, T.} } @Article { AgustoniFHCMMA2017, title = {Calibration of Commercial Test Sets for Non-Conventional Instrument Transformers}, journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2017}, month = {9}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {19-24}, keywords = {Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measurement standards}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, DOI = {10.1109/AMPS.2017.8078324}, stag_bib_extends_levelofaccess = {NA}, author = {Agustoni, M. and Fricke, S. and Houtzager, E. and \c{C}aycı, H. and Mortara, A. and Mohns, E. and Ayhan, B.} } @Article { FailleauHHPSRBZARGVSSKSPLG2017, title = {Metrology for decommissioning nuclear facilities: Partial outcomes of joint research project within the European Metrology Research Program}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Decommissioning, Sample preparation, Metrology}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.032}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Hay, B. and Holm, P. and Per{\"a}j{\"a}rvi, K. and Sand, J. and Rogiers, B. and Boden, S. and Zapata-Garc{\'i}a, D. and Arnold, D. and Russell, B. and Garcia Miranda, M. and Van Ammel, R. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Plumeri, S. and Laurent Beck, Y. and Grisa, T.} } @Article { AntonanzasTorresGPLRTHKGU2017, title = {Extensive validation of CM SAF surface radiation products over Europe}, journal = {Remote Sensing of Environment}, year = {2017}, month = {9}, volume = {199}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {171-186}, keywords = {Satellite-based models, Global horizontal irradiance, CM SAF, Solar radiation data, Pyranometer}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0034-4257}, DOI = {10.1016/j.rse.2017.07.013}, stag_bib_extends_levelofaccess = {NA}, author = {Antonanzas-Torres, F. and Gottschalg, R. and Palmer, D. and Lindfors, A. and Riihel{\"a}, A. and Trentmann, J. and Huld, T. and Koubli, E. and Gracia-Amillo, A.M. and Urraca, R.} } @Article { MoldersBHMRR2017, title = {Reproducibly emitting reference material on thermoplastic polyurethane basis for quality assurance/quality control of emission test chamber measurements}, journal = {Building and Environment}, year = {2017}, month = {9}, volume = {122}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {230-236}, keywords = {Reference material, Emissions testing, Volatile Organic Compounds, Polymeric material, CO2 assisted impregnation}, web_url = {https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/40646}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, address = {230 Park Avenue Suite 800 Shantae McGee 360 Park Avenue South New York NY 10169-0935 United States}, language = {30}, ISSN = {0360-1323}, DOI = {10.1016/j.buildenv.2017.06.005}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"o}lders, Nils and Br{\"o}dner, Doris and Horn, Wolfgang and Mull, Birte and Richter, Matthias and Renner, Manfred} } @Article { BrodnerHSSMR2017, title = {Reproducibly emitting reference materials for volatile and semi-volatile organic compounds—using finite element modeling for emission predictions}, journal = {Air Quality, Atmosphere \& Health}, year = {2017}, month = {9}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, keywords = {Emitting reference material, Emission test chamber, Micro-chamber, FEM model}, web_url = {https://link.springer.com/article/10.1007/s11869-017-0508-6}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature}, language = {30}, ISSN = {1873-9318, 1873-9326}, DOI = {10.1007/s11869-017-0508-6}, stag_bib_extends_levelofaccess = {NA}, author = {Br{\"o}dner, Doris and Horn, Wolfgang and Schultealbert, Caroline and Sauerwald, Tilman and Mull, Birte and Richter, Matthias} } @Proceedings { ClarksonCHRS2017, title = {Validation of Algorithms to Estimate Distribution Network Characteristics Using Power-Hardware-in-the-Loop Configuration}, journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2017}, month = {9}, number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics}, keywords = {Network topology, Topology, Substations, Estimation, Current measurement, voltage measurement, Load flow}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Liverpool, United Kingdom}, event_name = {Applied Measurements for Power Systems}, event_date = {20-09-2017 to 22-09-2017}, language = {30}, ISBN = {978-1-5386-0343-7}, ISSN = {2475-2304}, DOI = {10.1109/AMPS.2017.8078349}, stag_bib_extends_levelofaccess = {NA}, author = {Clarkson, P. and Chretien, S. and Hong, Q. and Rohouma, I. and Segovia, M.} } @Article { ChoiGIBFBGRPH2017, title = {Effect of Handling, Packing and Transportation on the Moisture of Timber Wood}, journal = {International Journal of Thermophysics}, year = {2017}, month = {8}, day = {29}, volume = {38}, number = {10}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Effect of ambient humidity, Moisture content, Timber wood,Transportation, Wood handling}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2292-9}, stag_bib_extends_levelofaccess = {NA}, author = {Choi, B.I. and Gelil, D.A.E. and Ismail, N. and Beltramino, G. and Fernicola, V. and Ben Ayoub, M.W. and Georgin, E. and Rudolfov{\'a}, M. and Palkova, Z. and Heinonen, M.} } @Proceedings { HoutzagerR2017, subid = {466}, title = {High-accuracy reference setup for system calibration of transformer loss measurement systems}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Transformer loss, reference measuring system,}, tags = {SEG}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_610-high-accuracy-reference-setup-for-system-calibration-of-transformer-loss-measurement-systems}, author = {Houtzager, E. and Rietveld, G.} } @Proceedings { ZhouLLHBEK2017, subid = {463}, title = {Measurement of the Internal Inductance of Impulse Voltage Generators and the Limits of LI Front Times.}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {lightning impulse, time parameters, front time, impulse generator}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International conference on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_569-measurement-of-the-internal-inductance-of-impulse-voltage-generators-and-the-limits-of-li-front-times}, author = {Zhou, L. and Li, Y. and Larzelere, W. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Elg, A.P. and Kl{\"u}ss, J.} } @Proceedings { HallstromBNEMP2017, subid = {460}, title = {Characterization of a fast step generator}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Step response, impulse measurment, lightning impulse}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_484-characterization-of-a-fast-step-generator}, author = {H{\"a}llstr{\"o}m, J. and Bergman, A. and Nordlund, M. and Elg, A.P. and Meisner, J. and Passon, S.} } @Proceedings { BergmanNEHMH2017, subid = {461}, title = {Influence of coaxial cable on response of high voltage resistive dividers}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Lightning impulse, pulse response, front time}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_487-influence-of-coaxial-cable-on-response-of-high-voltage-resistive-dividers}, author = {Bergman, A. and Nordlund, M. and Elg, A.P. and Havunen, J. and Meisner, J. and H{\"a}llstr{\"o}m, J.} } @Proceedings { HallstromHPK2017, subid = {459}, title = {Design and performance of a fast divider for puncture testing}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Puncture testing, very fast transient}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_470-design-and-performance-of-a-fast-divider-for-puncture-testing}, author = {H{\"a}llstr{\"o}m, J. and Havunen, J. and Pyk{\"a}l{\"a}, M.L. and Kazmi, S.} } @Proceedings { ElgHB2017, subid = {462}, title = {Evaluation of step response of transient recorders for lightning impulse}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Step response, lightning impulse, transient recorder}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_488-evaluation-of-step-response-of-transient-recorders-for-lightning-impulse}, author = {Elg, A.P. and H{\"a}llstr{\"o}m, J. and Bergman, A.} } @Proceedings { HavunenHBB2017, subid = {458}, title = {Using Deconvolution for Correction of Non-Ideal Step Response of Lightning Impulse Digitizers and Measurement Systems}, journal = {e-cigre}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {Lightning impulse, Deconvolution}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_381-using-deconvolution-for-correction-of-non-ideal-step-response-of-lightning-impulse-digitizers-and-measurement-systems}, author = { Havunen, J. and H{\"a}llstr{\"o}m, J. and Bergman, A.E. and Bergman, A.} } @Proceedings { HilbertSKMP2017, subid = {464}, title = {PTB’s new standard impulse voltage divider for traceable calibrations up to 1 MV}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {reference measuring system, lightning impulse,}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_415-ptbs-new-standard-impulse-voltage-divider-for-traceable-calibrations-up-to-1-mv}, author = {Hilbert, M. and Schierding, C. and Kurrat, M. and Meisner, J. and Passon, S.} } @Article { ZhaovH2017, subid = {1189}, title = {Mitigating voltage lead errors of an AC Josephson voltage standard by impedance matching}, journal = {Measurement Science and Technology}, year = {2017}, month = {8}, day = {16}, volume = {28}, number = {9}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {095004}, keywords = {AC Josephson voltage standard, impedance matching, simulation, error sources,uncertainty}, web_url = {https://zenodo.org/record/3265687\#.XWZRsuhKgdW}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa7aba}, stag_bib_extends_levelofaccess = {NA}, author = {Zhao, D. and van den Brom, H.E. and Houtzager, E.} } @Article { GrigoryevaGUTTKHAWKS2017, subid = {1175}, title = {Thermodynamic Temperature of High-Temperature Fixed Points Traceable to Blackbody Radiation and Synchrotron Radiation}, journal = {International Journal of Thermophysics}, year = {2017}, month = {8}, day = {16}, volume = {38}, number = {10}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, keywords = {Absolute radiometry, Blackbody radiation, Cryogenic substitution radiometer, Filter radiometer, High-temperature fixed points, Irradiance mode, Primary radiation standards, Ratio radiometry, Synchrotron radiation, Thermodynamic temperature}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2273-z}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}hmer, M. and Anhalt, K. and Hollandt, J. and Klein, R. and Taubert, R. D. and Thornagel, R. and Ulm, G. and Gavrilov, V. and Grigoryeva, I. and Khlevnoy, B. and Sapritsky, V.} } @Article { SuterSSPOMKHGFBAKLWS2017, title = {The CLARA/NORSAT-1 solar absolute radiometer: instrument design, characterization and calibration}, journal = {Metrologia}, year = {2017}, month = {8}, day = {10}, volume = {54}, number = {5}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {674-682}, keywords = {solar irradiance, satellite measurements, electrical substitution radiometer, cavity detector, sun}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa7a63}, stag_bib_extends_levelofaccess = {NA}, author = {Suter, M. and Spescha, M. and Soder, R. and Pfiffner, D, and Oliva, A.R. and Mingard, N. and Koller, S. and Heuerman, K. and Gyo, M. and Finsterle, W. and Beck, I. and Andersen, B. and Kopp, G. and Levesque, P.L. and Walter, B. and Schmutz, W.} } @Article { StrohMHSSCSLT2017, title = {A low-energy set-up for gamma-ray spectrometry of NORM tailored to the needs of a secondary smelting facility}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, volume = {126}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {296-299}, keywords = {210Pb, 210Po, Metallurgy, Industry, Gamma-ray spectrometry, Naturally occurring radionuclides}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.12.048}, stag_bib_extends_levelofaccess = {NA}, author = {Stroh, H. and Marissens, G. and Hult, M. and Schreurs, S. and Schroeyers, W. and Croymans, T. and Schreurs, I.V. and Lutter, G. and Tzika, F.} } @Article { HenriksenCST2017, subid = {404}, title = {Dynamics of bad-cavity-enhanced interaction with cold Sr atoms for laser stabilization}, journal = {Physical Review A}, year = {2017}, month = {7}, day = {24}, volume = {96}, number = {1}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {013847}, keywords = {laser stabilisation, atom-cavity dynamics}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.96.013847}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/pdf/1704.08245.pdf}, author = {Sch{\"a}ffer, S. A. and Christensen, B. T. R. and Henriksen, M. R. and Thomsen, J. W.} } @Article { OzturkUH2017, title = {Development of Measurement and Extraction Technique of Complex Permittivity Using Transmission Parameter S21 for Millimeter Wave Frequencies}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2017}, month = {7}, day = {13}, volume = {38}, number = {12}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {1510-1520}, keywords = {Complex permittivity, Material characterization, Newton-Raphson technique, Quasi-optical free space measurement}, web_url = {https://doi.org/10.1007/s10762-017-0421-y}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer Nature}, language = {30}, ISSN = {1866-6892, 1866-6906}, DOI = {10.1007/s10762-017-0421-y}, stag_bib_extends_levelofaccess = {NA}, author = {{\"O}zt{\"u}rk, T. and Uluer, I. and Hudlicka, M.} } @Article { HudlickaSBFH2017, subid = {769}, title = {Optical and RF metrology for 5G}, journal = {2017 IEEE Photonics Society Summer Topical Meeting Series (SUM)}, year = {2017}, month = {7}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Optical variables measurement, 5G mobile communication, Transmission line measurements, Photodiodes, Adaptive optics, Optical fiber communication, Oscilloscopes}, web_url = {https://arxiv.org/abs/1809.08934}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/PHOSST.2017.8012717}, stag_bib_extends_levelofaccess = {NA}, author = {Humphreys, D.A. and Fatadin, I. and Bieler, M. and Struszewski, P. and Hudlicka, M.} } @Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017, subid = {477}, title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fibre, network, clock, time, dissemination, service}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/FCS.2017.8089004}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Dostal, J. and Radil, J. and Smotlacha, V. and Velc, R. and Vojtech, J. and Campanella, M. and Calonico, D. and Clivati, C. and Levi, F. and Č{\'i}p, O. and Rerucha, S. and Holzwarth, R. and Lessing, M. and Camargo, F. and Desruelle, B. and Lautier-Gaud, J. and English, E.L. and Kronj{\"a}ger, J. and Whibberley, P. and Pottie, P.E. and Tavares, R. and Tuckey, P. and John, F. and Snajder, M. and Stefl, J. and Nogaś, P. and Urbaniak, R. and Binczewski, A. and Bogacki, W. and Turza, K. and Grosche, G. and Schnatz, H. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.} } @Article { RuhlBTRFUPKHKHU2017, subid = {848}, title = {Enhancing the sensitivity of nano-FTIR spectroscopy}, journal = {Optics Express}, year = {2017}, month = {7}, volume = {25}, number = {14}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {16574}, keywords = {Instrumentation, measurement, and metrology; Near-field microscopy}, web_url = {https://www.osapublishing.org/DirectPDFAccess/158D237A-A0E8-5960-84426107CE1CBCF4_369006/oe-25-14-16574.pdf?da=1\&id=369006\&seq=0\&mobile=no}, misc2 = {EMPIR 2015: Health}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.25.016574}, stag_bib_extends_levelofaccess = {NA}, author = {Hermann, P. and K{\"a}stner, B. and Hoehl, A. and Kashcheyevs, V. and Patoka, P. and Ulrich, G. and Feikes, J. and Ries, M. and Tydecks, T. and Beckhoff, B. and Ruhl, E. and Ulm, G.} } @Article { UnterumsbergerPLKHHWB2017, title = {Determination of SiO2 and C layers on a monocrystalline silicon sphere by reference-free x-ray fluorescence analysis}, journal = {Metrologia}, year = {2017}, month = {6}, day = {28}, volume = {54}, number = {4}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {481-486}, keywords = {Avogadro project, X-ray fluorescence, quantification}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa765f}, stag_bib_extends_levelofaccess = {NA}, author = {Unterumsberger, R. and Pollakowski-Herrmann, B. and Lubeck, J. and Kolbe, M. and Holfelder, I. and H{\"o}nicke, P and Weser, J. and Beckhoff, B.} } @Article { HughesCLLK2017_2, title = {Development of a high-accuracy multi-sensor, multi-target coordinate metrology system using frequency scanning interferometry and multilateration}, journal = {Proc. SPIE}, year = {2017}, month = {6}, day = {26}, volume = {10332}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {1033202}, keywords = {Interferometry, large volume metrology, sensors, distance measurement, calibration, traceability}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, language = {30}, DOI = {10.1117/12.2273644}, stag_bib_extends_levelofaccess = {NA}, author = {Hughes, B. and Campbell, M. A. and Lewis, A. J. and Lazzarini, G. M. and Kay, N.} } @Article { HoutzagerBKv2017, title = {AC–DC Calibrations With a Pulse-Driven AC Josephson Voltage Standard Operated in a Small Cryostat}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {6}, volume = {66}, number = {6}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1391-1396}, keywords = {AC–DC difference, Josephson voltage standard, measurement standards, measurement techniques, voltagemeasurement.}, web_url = {http://ieeexplore.ieee.org/document/7898429/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2662381}, stag_bib_extends_levelofaccess = {NA}, author = {Houtzager, E. and Bauer, S. and Kieler, O.F.O. and van den Brom, H.E.} } @Proceedings { WollensackHSRH2017, subid = {517}, title = {VNA tools II: Calibrations involving eigenvalue problems}, journal = {2017 89th ARFTG Microwave Measurement Conference (ARFTG)}, year = {2017}, month = {6}, volume = {1}, number = {1}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1-4}, keywords = {Vector Network Analyzer, S-parameters, Calibration, Uncertainty, Traceability}, web_url = {http://dx.doi.org/10.1109/ARFTG.2017.8000832}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Honolulu}, event_name = {Wollensack, Michael, et al.}, event_date = {09-06-2017 to 10-06-2017}, language = {30}, ISBN = {978-1-5386-2748-8}, DOI = {10.7795/EMPIR.14IND02.CA.20190404}, stag_bib_extends_levelofaccess = {NA}, author = {Wollensack, M. and Hoffmann, J. and Stalder, D. and Ruefenacht, J. and Hoffmann, J.} } @Article { FrigoRDHC2017, title = {Metrological characterization of a PMU calibrator in the 25 Hz to 3 kHz range}, journal = {2017 IEEE Manchester PowerTech}, year = {2017}, month = {6}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, keywords = {Phasor Measurement Unit (PMU), PMU calibrator, distribution networks, IEEE C37.118}, web_url = {http://ieeexplore.ieee.org/document/7981109/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, DOI = {10.1109/PTC.2017.7981109}, stag_bib_extends_levelofaccess = {NA}, author = {Frigo, G. and Rietveld, G. and Dierikx, E. and Hoogenboom, D. and Colangelo, D.} } @Article { HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017, subid = {141}, title = {Test of Special Relativity Using a Fiber Network of Optical Clocks}, journal = {Physical Review Letters}, year = {2017}, month = {6}, volume = {118}, number = {22}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, web_url = {https://arxiv.org/abs/1703.04426}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.118.221102}, stag_bib_extends_levelofaccess = {NA}, author = {Delva, P. and Lodewyck, J. and Bilicki, S. and Bookjans, E. and Vallet, G. and Le Targat, R. and Pottie, P.-E. and Guerlin, C. and Meynadier, F. and Le Poncin-Lafitte, C. and Lopez, O. and Amy-Klein, A. and Lee, W.-K. and Quintin, N. and Lisdat, C. and Al-Masoudi, A. and D{\"o}rscher, S. and Grebing, C. and Grosche, G. and Kuhl, A. and Raupach, S. and Sterr, U. and Hill, I. R. and Hobson, R. and Bowden, W. and Kronj{\"a}ger, J. and Marra, G. and Rolland, A. and Baynes, F. N. and Margolis, H. S. and Gill, P.} } @Article { HerkommerRHSKTRGSTSFGR2017, subid = {412}, title = {Single Quantum Dot with Microlens and 3D-Printed Micro-objective as Integrated Bright Single-Photon Source}, journal = {ACS Photonics}, year = {2017}, month = {6}, volume = {4}, number = {6}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1327-1332}, keywords = {3D direct laser writing; 3D lithography; micro-objective; semiconductor quantum dot; single-photon source}, web_url = {http://pubs.acs.org/doi/ipdf/10.1021/acsphotonics.7b00253}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.7b00253}, stag_bib_extends_levelofaccess = {NA}, author = {Fischbach, S. and Schlehahn, A. and Thoma, A. and Srocka, N. and Gissibl, T. and Ristok, S. and Thiele, S. and Kaganskiy, A. and Strittmatter, A. and Heindel, T. and Rodt, S. and Herkommer, A. and Giessen, H. and Reitzenstein, S.} } @Article { HeinrichSPAPD2017, subid = {516}, title = {Mutual interference in calibration line configurations}, journal = {2017 89th ARFTG Microwave Measurement Conference (ARFTG)}, year = {2017}, month = {6}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Coupling, em simulation, measurements, parasitic modes, probes}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/mutual-interference-in-calibration-line-configurations}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/ARFTG.2017.8000823}, stag_bib_extends_levelofaccess = {NA}, author = {Schmuckle, F.J. and Probst, T. and Arz, U. and Phung, G.N. and Doerner, R. and Heinrich, W.} } @Article { XuCJSCPVHSC2017, subid = {574}, title = {Temperature dependence mitigation in stationary Fourier-transform on-chip spectrometers}, journal = {Optics Letters}, year = {2017}, month = {6}, volume = {42}, number = {11}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {2239}, keywords = {temperature, silicon on insulator, microspectrometer}, web_url = {https://digital.csic.es/handle/10261/164048}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.42.002239}, stag_bib_extends_levelofaccess = {NA}, author = {Herrero-Bermello, A. and Velasco, A.V. and Podmore, H. and Cheben, P. and Schmid, J.H. and Janz, S. and Calvo, M.L. and Xu, D.X and Scott, A. and Corredera, P.} } @Article { SchraderKSH2017, title = {Characterization of a 300-GHz Transmission System for Digital Communications}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2017}, month = {5}, day = {17}, volume = {38}, number = {8}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {1004-1018}, keywords = {Error vector magnitude, Waveform metrology, THz communication}, web_url = {https://link.springer.com/article/10.1007/s10762-017-0395-9}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {1866-6892, 1866-6906}, DOI = {10.1007/s10762-017-0395-9}, stag_bib_extends_levelofaccess = {NA}, author = {Schrader, T. and Kleine-Ostmann, T. and Salhi, M. and Hudlicka, M.} } @Article { BhattacharyaUPRH2017, title = {Temperature measurement using frequency comb absorption spectroscopy of CO2}, journal = {Review of Scientific Instruments}, year = {2017}, month = {5}, volume = {88}, number = {5}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {053113}, keywords = {spectroscopy, frequency comb laser}, web_url = {http://aip.scitation.org/doi/10.1063/1.4984252}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4984252}, stag_bib_extends_levelofaccess = {NA}, author = {Bhattacharya, N. and Urbach, H. P. and Persijn, S. T. and Reyes-Reyes, A. and H{\"a}nsel, A.} } @Article { KochGIIGHKBWK2017, subid = {174}, title = {Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI}, journal = {PLOS ONE}, year = {2017}, month = {4}, day = {12}, volume = {12}, number = {4}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {1-19}, keywords = {Altered cortical and subcortical connectivitydue to infrasound administered near thehearing threshold ± Evidence from fMRI}, misc2 = {EMPIR 2015: Health}, address = {San Francisco, California, and Cambridge, United Kingdom.}, language = {30}, DOI = {10.1371/journal.pone.0174420}, stag_bib_extends_levelofaccess = {NA}, author = {Weichenberger, Markus and Bauer, Martin and K{\"u}hler, Robert and Hensel, Johannes and Forlim, C. G. and Ihlenfeld, Albrecht and Ittermann, Bernd and Gallinat, J{\"u}rgen and Koch, Christian and K{\"u}hn, Simone} } @Article { HogstromGSSLH2017, title = {Characterization of the Humidity Calibration Chamber by Numerical Simulations}, journal = {International Journal of Thermophysics}, year = {2017}, month = {4}, volume = {38}, number = {6}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Calibration, Finite element method Humidity, calibration, Multiphysics, Simulation, Surface chemistry}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature}, address = {One New York Plaza, Suite 4500 New York NY 10004-1562 United States}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2221-y}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}gstr{\"o}m, R. and Grahn, P. and Sairanen, H. and Salminen, J. and Lakka, A. and Heinonen, M.} } @Article { SchmidtSPKHSL2017, subid = {389}, title = {On-line estimation of local oscillator noise and optimisation of servo parameters in atomic clocks}, journal = {Metrologia}, year = {2017}, month = {4}, volume = {54}, number = {3}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {307-321}, keywords = {quantum projection noise, atomic frequency standards, local oscillator noise, servo optimisation}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa66e9}, stag_bib_extends_levelofaccess = {NA}, author = {Leroux, I.D. and Scharnhorst, N. and Hannig, S. and Kramer, J. and Pelzer, L. and Stepanova, M. and Schmidt, P.O.} } @Article { HemmingWLEKJHL2017, title = {Application of Monte Carlo simulation for estimation of uncertainty of four-point roundness measurements of rolls}, journal = {Precision Engineering}, year = {2017}, month = {4}, volume = {48}, number2 = {IND62: TIM: Traceable in-process dimensional measuremen}, pages = {181-190}, keywords = {Application of Monte Carlo simulation for estimation of uncertainty of four-point roundness measurements of rolls}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, address = {360 Park Ave S, New York, NY 10010, USA}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2016.12.001}, stag_bib_extends_levelofaccess = {NA}, author = {Hemming, B. and Widmaier, T. and Lassila, A. and Esala, V.-P. and Kuosmanen, P. and Juhanko, J. and Haikio, J. and Laukkanen, P.} } @Article { BialekH2017, title = {Cause, Effect, and Correction of Field Spectroradiometer Interchannel Radiometric Steps}, journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing}, year = {2017}, month = {4}, volume = {10}, number = {4}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {1542-1551}, keywords = {Fieldspectroscopy, radiometry, sensor model, temperature dependence}, web_url = {http://ieeexplore.ieee.org/document/7819458/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New Jersey}, language = {30}, ISSN = {1939-1404, 2151-1535}, DOI = {10.1109/JSTARS.2016.2625043}, stag_bib_extends_levelofaccess = {NA}, author = {Bialek, A. and Hueni, A.} } @Article { CarmeleRBSSSGSSvTHKR2017, subid = {234}, title = {A bright triggered twin-photon source in the solid state}, journal = {Nature Communications}, year = {2017}, month = {4}, volume = {8}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {14870}, keywords = {Quantum dots, Quantum optics, Single photons and quantum effects .}, web_url = {https://www.nature.com/articles/ncomms14870}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms14870}, stag_bib_extends_levelofaccess = {NA}, author = {Heindel, T. and Thoma, A. and von Helversen, M. and Schmidt, M. and Schlehahn, A. and Gschrey, M. and Schnauber, P. and Schulze, J. -H. and Strittmatter, A. and Beyer, J. and Rodt, S. and Carmele, A. and Knorr, A. and Reitzenstein, S.} } @Article { JehlBKCVSHLBKC2017, subid = {369}, title = {Design and Operation of CMOS-Compatible Electron Pumps Fabricated With Optical Lithography}, journal = {IEEE Electron Device Letters}, year = {2017}, month = {4}, volume = {38}, number = {4}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {414-417}, keywords = {Quantum dots, Quantum effect semiconductor devices, Quantization, Current control}, web_url = {https://arxiv.org/abs/1612.09547}, web_url2 = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0741-3106, 1558-0563}, DOI = {10.1109/LED.2017.2670680}, stag_bib_extends_levelofaccess = {NA}, author = {Clapera, P. and Klochan, J. and Lavieville, R. and Barraud, S. and Hutin, L. and Sanquer, M. and Vinet, M. and Cinins, A. and Barinovs, G. and Kashcheyevs, V. and Jehl, X.} } @Article { PrancePPJHHGGBPB2017, subid = {504}, title = {On-chip magnetic cooling of a nanoelectronic device}, journal = {Scientific Reports}, year = {2017}, month = {4}, volume = {7}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {45566}, keywords = {Electronic devices, Electronic properties and materials}, web_url = {https://www.nature.com/articles/srep45566}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep45566}, stag_bib_extends_levelofaccess = {NA}, author = {Bradley, D. I. and Gu{\'e}nault, A. M. and Gunnarsson, D. and Haley, R. P. and Holt, S. and Jones, A. T. and Pashkin, Y. A. and Penttil{\"a}, J. and Prance, J. R. and Prunnila, M. and Roschier, L.} } @Article { LassilaHPBH2017, title = {Interferometric 2D small angle generator for autocollimator calibration}, journal = {Metrologia}, year = {2017}, month = {3}, day = {30}, volume = {54}, number = {3}, number2 = {SIB58: Angles: Angle metrology}, pages = {253-261}, keywords = {autocollimator, interferometry, metrology, angle measurement}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa648d}, stag_bib_extends_levelofaccess = {NA}, author = {Lassila, A. and Hemming, B. and Palosuo, I. and Byman, V. and Heikkinen, V.} } @Article { HusainLTYBSSTKFH2017, subid = {30}, title = {Single Carrier Trapping and De-trapping in Scaled Silicon Complementary Metal-Oxide-Semiconductor Field-Effect Transistors at Low Temperatures}, journal = {Semiconductor Science and Technology}, year = {2017}, month = {3}, day = {24}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Coulomb blockade, MOSFETs, Carrier Trapping and De-trapping, quantum dots}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0268-1242, 1361-6641}, DOI = {10.1088/1361-6641/aa6910}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Zuo and Husain, Muhammad and Yoshimoto, Hiroyuki and Tani, Kazuki and Sasago, Yoshitaka and Hisamoto, Digh and Fletcher, Jonathan and Kataoka, Masaya and Tsuchiya, Yoshishige and Saito, Shinichi} } @Article { WollschlagerHBGLP2017, title = {Note: Nanomechanical characterization of soft materials using a micro-machined nanoforce transducer with an FIB-made pyramidal tip}, journal = {Review of Scientific Instruments}, year = {2017}, month = {3}, volume = {88}, number = {3}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {036104}, keywords = {MEMS, nanoindentation, soft materials}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4977474}, stag_bib_extends_levelofaccess = {NA}, author = {Wollschl{\"a}ger, N. and Hiller, K. and Brand, U. and Gao, S. and Li, Z. and Pohlenz, F.} } @Article { MarsteinPHRCDS2017, title = {Surface Passivation Properties of $\{\textbackslashtextrm\{HfO\}\}_\{2\}$ Thin Film on n-Type Crystalline Si}, journal = {IEEE Journal of Photovoltaics}, year = {2017}, month = {3}, volume = {7}, number = {2}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {479-485}, keywords = {Passivation, Hafnium compounds, Silicon, Annealing, Temperature, silicon, atomic layer deposition, carrier lifetime, crystal growth from melt, dielectric thin films, electrical resistivity, hafnium compounds, passivation, refractive index, Si, surface passivation, hafnium oxide thin film, atomic layer deposition, resistivity, low temperature anneal, precleaning, precursors, deposition temperature, postannealing temperature, minority carrier lifetime, surface recombination velocity, Czochralski n-type wafers, light soaking, refractive index, solar cells, HfO2, silicon surface passivation, Atomic layer deposition (ALD), defect density, fixed charges, hafnium oxide (HfO2), photovoltaic cells}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2645399}, stag_bib_extends_levelofaccess = {NA}, author = {Marstein, Erik Stensrud and Perros, Alexander Pyymaki and Halvard, Haug and Repo, Paivikki and Cheng, Xuemei and Di Sabatino, Marisa and Savin, Hele} } @Article { BettsBHCKG2017, title = {Compressed Sensing Current Mapping Spatial Characterization of Photovoltaic Devices}, journal = {IEEE Journal of Photovoltaics}, year = {2017}, month = {3}, volume = {7}, number = {2}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {486-492}, keywords = {Compressed sensing (CS), light beam induced current (LBIC)measurements, solar cells, spatial characterization}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {Piscataway, New Jersey}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2646900}, stag_bib_extends_levelofaccess = {NA}, author = {Betts, TR and Bliss, M and Hall, SRG and Cashmore, M and Koutsourakis, G and Gottschalg, R} } @Article { SchaepmanSKDH2017, title = {Field and Airborne Spectroscopy Cross Validation—Some Considerations}, journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing}, year = {2017}, month = {3}, volume = {10}, number = {3}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {1117-1135}, keywords = {Spectroscopy, Atmospheric measurements, Uncertainty, Surface treatment, Vegetation mapping, Measurement uncertainty, Instruments}, web_url = {https://ieeexplore.ieee.org/document/7582439/keywords}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1939-1404, 2151-1535}, DOI = {10.1109/JSTARS.2016.2593984}, stag_bib_extends_levelofaccess = {NA}, author = {Schaepman, M.E. and Schlapfer, D. and Kneubuehler, M. and Damm, A. and Hueni, A.} } @Proceedings { LiSLHZYTSHTFKS2017, subid = {1123}, title = {Random-telegraph-noise by resonant tunnelling at low temperatures}, journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, year = {2017}, month = {2}, day = {28}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Random-telegraph-noise, charge trap, low temperatures}, web_url = {https://eprints.soton.ac.uk/418401/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Toyama}, event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, event_date = {28-02-2017 to 02-03-2017}, language = {30}, DOI = {10.1109/EDTM.2017.7947569}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Zeimpekis, I. and Yoshimoto, H. and Tani, K. and Sasago, Y. and Hisamoto, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.} } @Proceedings { LiSBFKHTLS2017, subid = {1124}, title = {Transport properties in silicon nanowire transistors with atomically flat interfaces}, journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, year = {2017}, month = {2}, day = {28}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {narrow channel effect, silicon nanowire, SOI, TMAH, self-limiting oxidation}, web_url = {https://eprints.soton.ac.uk/402316/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Toyama}, event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, event_date = {28-02-2017 to 02-03-2017}, language = {30}, DOI = {10.1109/EDTM.2017.7947561}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, F. and Husain, M.K. and Li, Z. and Sotto, M.S.H. and Burt, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.} } @Article { PalafoxBH2017, title = {A Josephson Impedance Bridge Based on Programmable Josephson Voltage Standards}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {2}, day = {16}, volume = {66}, number = {6}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {1539 - 1545}, keywords = {mpedance, Josephson array, programmable Josephson system, Bridge circuits, Impedance, Uncertainty, Transient analysis, Standards, Measurement uncertainty, Frequency measurement}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane Piscataway NJ 08855-1331}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2659898}, stag_bib_extends_levelofaccess = {NA}, author = {Palafox, L. and Behr, R. and Hagen, T.} } @Article { YacootRPCHCL2017, title = {Laser source for dimensional metrology: investigation of an iodine stabilized system based on narrow linewidth 633 nm DBR diode}, journal = {Measurement Science and Technology}, year = {2017}, month = {2}, day = {16}, volume = {28}, number = {4}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {045204}, keywords = {optical metrology, DBR laser diode, frequency stabilization, laser interferometry, dimensional metrology, iodine stabilization, displacement measurement}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, address = {Temple Circus,Temple Way, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa5ab9}, stag_bib_extends_levelofaccess = {NA}, author = {Yacoot, Andrew and Rerucha, Simon and Pham, Tuan M and Cizek, Martin and Hucl, Vaclav and Č{\'i}p, Ondřej and Lazar, Josef} } @Article { RobinsonSGWZMRLHSY2017, title = {1.5 \(\mu\)m lasers with sub 10 mHz linewidth}, journal = {APS Physics}, year = {2017}, month = {2}, day = {15}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, keywords = {tiem and frequency metrology, ultra-stable laser, oprical clock}, web_url = {https://arxiv.org/abs/1702.04669}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {30}, DOI = {10.1103/PhysRevLett.118.263202}, stag_bib_extends_levelofaccess = {NA}, author = {Robinson, J.M. and Sonderhouse, L. and Grebing, C. and Weyrich, R. and Zhang, W. and Matei, D.G. and Riehle, F. and Legero, T. and H{\"a}fner, S. and Sterr, U. and Ye, J.} } @Proceedings { Hafner2017, title = {Development Of A Reference Method For The Analysis Of Total Silicon Content In Biogas}, journal = {XI Conference of Chemists, Technologists and Environmentalists of Republic of SRPSKA Proceedings}, year = {2017}, month = {2}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {49-57}, keywords = {biogas, siloxanes, microwave plasma atomic emission}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {University of Banja Luka Faculty of Technology Banja Luka}, address = {Banja Luka}, event_place = {Teslić, Bosnia and Herzegovina}, event_name = {XI Conference of Chemists, Technologists and Environmentalists of Republic of SRPSKA Proceedings}, event_date = {18-11-2016 to 19-11-2016}, language = {30}, ISBN = {978-99938-54-67-8}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {COBISS.RS-ID 6330904}, author = {Hafner, K.} } @Article { IbraimETZHHHM2017, title = {Tracking nitrous oxide emission processes at a suburban site with semicontinuous, in situ measurements of isotopic composition}, journal = {Journal of Geophysical Research: Atmospheres}, year = {2017}, month = {2}, volume = {122}, number = {3}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {1850-1870}, keywords = {nitrous oxide, isotopic composition}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {2169-897X}, DOI = {10.1002/2016JD025906}, stag_bib_extends_levelofaccess = {NA}, author = {Ibraim, E. and Emmenegger, L. and Tuzson, B. and Zellweger, C. and H{\"u}glin, C. and Henne, S. and Harris, E. and Mohn, J.} } @Article { PavsiDBFVJSeHRKMAAM2017, subid = {2144}, title = {Inter-laboratory assessment of different digital PCR platforms for quantification of human cytomegalovirus DNA}, journal = {Analytical and Bioanalytical Chemistry}, year = {2017}, month = {1}, day = {26}, volume = {409}, number = {10}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {2601-2614}, keywords = {Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-017-0206-0}, stag_bib_extends_levelofaccess = {NA}, author = {Pavšič, J. and Devonshire, A. and Blejec, A. and Foy, C.A. and Van Heuverswyn, F. and Jones, G.M. and Schimmel, H. and Zel, J. and Huggett, J.F. and Redshaw, N. and Karczmarczyk, M. and Mozioglu, E. and Aky{\"u}rek, S. and Akg{\"o}z, M. and Milavec, M.} } @Article { , title = {Atomic force microscope adhesion measurements and atomistic molecular dynamics simulations at different humidities}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {23}, volume = {28}, number = {3}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {034004 (10pp)}, keywords = {Atomic force microscopy, metrology, adhesion, capillary effects, humidity, force measurement}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034004/meta;jsessionid=1CDCAA65608F84971489636A33CB4FD2.c3.iopscience.cld.iop.org}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/1361-6501/28/3/034004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-1-23}, author = {Sepp{\"a}, J and Reischl, B and Sairanen, H and Korpelainen, V and Husu, H and Heinonen, M and Raiteri, P and Rohl, A and Nordlund, K and Lassila, A} } @Article { JennettAH2017, subid = {381}, title = {Establishing isothermal contact at a known temperature under thermal equilibrium in elevated temperature instrumented indentation testing}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {13}, volume = {28}, number = {2}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {025016}, keywords = {nano-indentation, elevated temperature, thermal equilibrium, isothermal contact}, web_url = {https://pure.coventry.ac.uk/ws/portalfiles/portal/8188288/Establishing_isothermal_contact_accepted_MST_104245_corrected_postprint.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa533d}, stag_bib_extends_levelofaccess = {NA}, author = {Hou, X.D. and Alvarez, C.L.M. and Jennett, N.M.} } @Article { , title = {Spectroscopic thermometry for long-distance surveying}, journal = {Applied Optics}, year = {2017}, month = {1}, day = {6}, volume = {56}, number = {2}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {239-246}, keywords = {long-distance surveying, laser absorption spectroscopy, refractive index compensation}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-56-2-239}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {OSA Publishing}, address = {Washington}, language = {30}, ISSN = {1559-128X (print), 2155-3165 (online)}, DOI = {10.1364/AO.56.000239}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tomberg, T. and Fordell, T. and Jokela, J. and Merimaa, M. and Hieta, T.} } @Article { BecherLSGCSPHLRK2017_2, title = {Experimental realization of an absolute single-photon source based on a single nitrogen vacancy center in a nanodiamond}, journal = {Optica}, year = {2017}, month = {1}, volume = {4}, number = {1}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {71}, keywords = {Metrology, Radiometry, Sources, Photon statistics}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.4.000071}, stag_bib_extends_levelofaccess = {NA}, author = {Becher, C. and Lindner, S. and Sandoghdar, V. and G{\"o}tzinger, S. and Chu, X.L. and Smid, M. and Porrovecchio, G. and Hofer, H. and L{\'o}pez, M. and Rodiek, B. and K{\"u}ck, S.} } @Article { Huld2017, title = {PVMAPS: Software tools and data for the estimation of solar radiation and photovoltaic module performance over large geographical areas}, journal = {Solar Energy}, year = {2017}, month = {1}, volume = {142}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {171-181}, keywords = {Solar radiationPhotovoltaic energyGIS}, web_url = {http://www.sciencedirect.com/science/article/pii/S0038092X16306089}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2016.12.014}, stag_bib_extends_levelofaccess = {NA}, author = {Huld, T.} } @Article { SchubertHSMTGW2017, title = {Angle Dependence of Solar Cells and Modules: The Role of Cell Texturization}, journal = {IEEE Journal of Photovoltaics}, year = {2017}, month = {1}, volume = {7}, number = {1}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {19-24}, keywords = {photovoltaic}, web_url = {http://ieeexplore.ieee.org/document/7600397/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2614120}, stag_bib_extends_levelofaccess = {NA}, author = {Schubert, M.C. and Hohl-Ebinger, J. and Steinkemper, H. and Muller, B. and Tucher, N. and Geisemeyer, I. and Warta, W.} } @Article { BojkovskiOKMSISFZSSJoHHPV2017, subid = {1095}, title = {Expansion of European research capabilities in humidity measurement}, journal = {18th International Congress of Metrology}, year = {2017}, number = {2017 18th}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {4/06006}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html}, misc2 = {EMPIR 2015: Research Potential}, publisher = {EDP Sciences}, language = {30}, DOI = {10.1051/metrology/201706006}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Sestan, D. and Zvizdić, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Proceedings { ZschiedrichGWHBB2017, subid = {423}, title = {Quantifying parameter uncertainties in optical scatterometry using Bayesian inversion}, journal = {Proc. SPIE}, year = {2017}, volume = {10330}, number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1033004}, keywords = {computational metrology, optical metrology, computational lithography, nanolithography, finite-element methods, nanooptics}, web_url = {https://arxiv.org/pdf/1707.08467}, misc2 = {EMPIR 2014: Industry}, event_place = {Munich}, event_name = {Modeling Aspects in Optical Metrology VI}, event_date = {25-06-2017 to 29-06-2017}, language = {30}, DOI = {10.1117/12.2270596}, stag_bib_extends_levelofaccess = {NA}, author = {Hammerschmidt, M and Weiser, M and Garcia Santiago, X and Zschiedrich, L and Bodermann, B and Burger, S} } @Article { PlimmerOHB2017, subid = {809}, title = {A high-accuracy working standard for absolute pressure from 5 kPa to 130 kPa}, journal = {International Journal of Metrology and Quality Engineering}, year = {2017}, volume = {8}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {26}, keywords = {absolute pressure, calibration, working standard, capacitance diaphragm gauge, resonantsilicon gauge}, misc2 = {EMPIR 2014: Industry}, publisher = {EDP Sciences}, language = {30}, ISSN = {2107-6847}, DOI = {10.1051/ijmqe/2017020}, stag_bib_extends_levelofaccess = {NA}, author = {Boineau, F. and Huret, S. and Otal, P. and Plimmer, M.} } @Article { , title = {Comparison of the performance of a microwave-based and an NMR-based biomaterial moisture measurement instrument}, journal = {ACTA IMEKO}, year = {2016}, month = {12}, day = {30}, volume = {5}, number = {4}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {88-99}, keywords = {moisture measurement, bioenergy, microwave, NMR, Loss-on-Drying}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {International Measurement Confederation (IMEKO)}, address = {Budapest}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v5i4.391}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-05\%20\%282016\%29-04-14/pdf}, author = {{\"O}sterberg, Petri and Heinonen, Martti and Ojanen-Saloranta, Maija and M{\"a}kynen, Anssi and {\"O}sterberg, Petri} } @Article { CuenatCMSHKSWK2016, subid = {249}, title = {Combined anomalous Nernst effect and thermography studies of ultrathin CoFeB/Pt nanowires}, journal = {AIP Advances}, year = {2016}, month = {12}, day = {22}, volume = {7}, number = {5}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {055904}, keywords = {Abstract: Using electrical and thermal measurements, we present a method for characterising the anomalous Nernst effect (ANE) within nanoscale devices implementing perpendicular anisotropy materials. Perpendicularly magnetised CoFeB/Pt nanowires were fabricated in close proximity to Pt heater elements on an electrically insulating substrate. The voltages induced within the magnetic material as a result of the ANE were recorded for increasing heater powers, and for both out-of-plane saturated states of the device. Scanning thermal probe microscopy was used to map the temperature distribution within the region of the device at a range of heater powers. By analysing the results from each thermography measurement, it was possible to correlate the temperature gradient induced at the magnetic nanowire against the anomalous Nernst voltage measured within the device. For the particular material, geometry and substrate used, a Nernst coefficient value KN = 2.3 \(\mu\)V(K.T)-1 was calculated. This combination of measurements can provide a powerful tool to characterise the ANE within a number of nanoscale systems, a necessary task for the future implementation and optimisation of the effect within spin-caloritronic devices.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/1.4973196}, stag_bib_extends_levelofaccess = {NA}, author = {Wells, J. and Selezneva, E. and Krzysteczko, P. and Hu, X. and Schumacher, H.W. and Mansell, R. and Cowburn, R. and Cuenat, A. and Kazakova, O.} } @Article { PenttilaRGPMKMHP2016, subid = {94}, title = {Traceable Coulomb blockade thermometry}, journal = {Metrologia}, year = {2016}, month = {12}, day = {20}, volume = {54}, number = {1}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {69-76}, keywords = {Coulomb blockade thermometry, primary thermometer, traceability, thermodynamic temperature}, web_url = {https://arxiv.org/abs/1609.06943v2}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa4f84}, stag_bib_extends_levelofaccess = {NA}, author = {Hahtela, O and Mykk{\"a}nen, E and Kemppinen, A and Meschke, M and Prunnila, M and Gunnarsson, D and Roschier, L. and Penttil{\"a}, J and Pekola, J} } @Article { GersterSSPGBWULHSP2016, subid = {11}, title = {Robustness of single-electron pumps at sub-ppm current accuracy level}, journal = {Metrologia}, year = {2016}, month = {12}, day = {20}, volume = {54}, number = {1}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {S1-S8}, keywords = {single-electron pumps, small-current measurement,}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/54/1/S1}, stag_bib_extends_levelofaccess = {NA}, author = {Stein, F and Scherer, H and Gerster, T and Behr, R and G{\"o}tz, M and Pesel, E and Leicht, C and Ubbelohde, N and Weimann, T and Pierz, K and Schumacher, H W and Hohls, F} } @Techreport { HultMSMLAVP2016, title = {Metrodecom: JRC-Geel Radionuclide Metrology Sector contribution to WP5 Task 2: Reference materials and standard sources for radiochemical analysis}, journal = {JRC Technical report}, year = {2016}, month = {12}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Reference materials, Radiochemical analysis, standard sources}, web_url = {http://publications.jrc.ec.europa.eu/repository/handle/JRC103355}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {European commission Publication office}, address = {Luxemburg}, language = {30}, ISBN = {978-92-79-63506-9}, ISSN = {1831-9424}, DOI = {10.2789/949534}, stag_bib_extends_levelofaccess = {NA}, author = {Hult, M. and Marissens, G. and Stroh, H. and Marouli, M. and Lutter, G. and Altzitzoglou, T. and Van Ammel, R. and Pomm{\'e}, S.} } @Article { VandervorstDPFLTHVBTFCS2016, subid = {158}, title = {Understanding Physico-Chemical Aspects in the Depth Profiling of Polymer:Fullerene Layers}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {12}, volume = {120}, number = {49}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {28074-28082}, keywords = {ToF-SIMS, GCIB, Ar cluster, quantification, depth profiling, organics, solar cells, polymer, fullerenes}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b09911}, stag_bib_extends_levelofaccess = {NA}, author = {Surana, S. and Conard, T. and Fleischmann, C. and Tait, J.G. and Bastos, J.P. and Voroshazi, E. and Havelund, R. and Turbiez, M. and Louette, P. and Felten, A. and Poleunis, C. and Delcorte, A. and Vandervorst, W.} } @Article { HenaultBRPDBFBH2016, title = {Development of facilities and methods for the metrological characterization of distributed temperature sensing systems based on optical fibres}, journal = {Measurement Science and Technology}, year = {2016}, month = {12}, volume = {28}, number = {1}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {015009}, keywords = {Distributed sensing, Temperature, Metrology, Raman}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/1/015009}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/28/1/015009}, stag_bib_extends_levelofaccess = {NA}, author = {H{\'e}nault, J M and Beck, Y L and Razouk, R and Plumeri, S and Delepine-Lesoille, S and Beaumont, O and Failleau, G and Bertrand, J and Hay, B} } @Article { , title = {Near-unity quantum efficiency of broadband black silicon photodiodes with an induced junction}, journal = {Nature Photonics}, year = {2016}, month = {11}, day = {14}, volume = {-}, number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry}, keywords = {Imaging and sensing, Nanowires, Optical metrology, Optical sensors, X-rays}, web_url = {http://www.nature.com/nphoton/journal/vaop/ncurrent/full/nphoton.2016.226.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Nature}, address = {-}, language = {30}, DOI = {10.1038/nphoton.2016.226}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Juntunen, M.A. and Heinonen, J. and V{\"a}h{\"a}nissi, V. and Repo, P. and Valluru, D. and Savin, H.} } @Article { KraehnertHORH2016, title = {Ellipsometric porosimetry on pore-controlled TiO2 layers}, journal = {Applied Surface Science}, year = {2016}, month = {11}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, keywords = {Spectroscopic ellipsometry; Porous materials; Porosimetry; Multi-sample analysis; Thin film metrology}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York, USA}, language = {30}, ISSN = {0169-4332}, DOI = {10.1016/j.apsusc.2016.11.055}, stag_bib_extends_levelofaccess = {NA}, author = {Kraehnert, Ralph and Hodoroaba, Vasile-Dan and Ortel, Erik and Rosu, Dana-Maria and Hertwig, Andreas} } @Article { PlagFHPFFMAEAFH2016, title = {Results of the Fifth International Spectroradiometer Comparison for Improved Solar Spectral Irradiance Measurements and Related Impact on Reference Solar Cell Calibration}, journal = {IEEE Journal of Photovoltaics}, year = {2016}, month = {11}, volume = {6}, number = {4}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {1004-1011}, keywords = {Intercomparison, irradiance, calibration, solar simulator}, web_url = {http://ieeexplore.ieee.org/document/7576644/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2606698}, stag_bib_extends_levelofaccess = {NA}, author = {Plag, F. and Friederichs, M. and Halwachs, M. and Pravettoni, M. and Fucci, R. and Ferretti, N. and Minuto, A. and Alonso-Alvarez, D. and Ekins-Daukes, N. and Alonso-Alvarez, D. and Friedrich, D. and Haverkamp, E.} } @Article { YoshidaWDKLSGIHTGMB2016, title = {Reassessment of the NH4NO3thermal decomposition technique for calibration of the N2O isotopic composition}, journal = {Rapid Communications in Mass Spectrometry}, year = {2016}, month = {10}, day = {20}, volume = {30}, number = {23}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2487-2496}, keywords = {thermal decomposition, isotopic composition}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0951-4198}, DOI = {10.1002/rcm.7736}, stag_bib_extends_levelofaccess = {NA}, author = {Yoshida, N. and Werner, R.A. and Decock, C. and Kuhn, T. and Lehmann, M.F. and Schleppi, P. and Geilmann, H. and Ibraim, E. and Harris, E. and Toyoda, S. and Gutjahr, W. and Mohn, J. and Brand, W.A.} } @Article { EngertRGPMKHSCLSKMP2016, title = {New Evaluation of T − T2000 from 0.02K to 1K by Independent Thermodynamic Methods}, journal = {International Journal of Thermophysics}, year = {2016}, month = {10}, day = {20}, volume = {37}, number = {12}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, keywords = {Temperature, Thermodynamic Methods, Kelvin}, web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/new-evaluation-of-t-t2000-from-002k-to-1k-by-independent-thermodynamic-methods(dc393a64-8d59-4083-9435-f2bd70eea8ed).html}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-016-2123-4}, stag_bib_extends_levelofaccess = {NA}, author = {Engert, J and Kirste, A. and Shibahara, A. and Casey, A. and Levitin, L.V. and Saunders, J. and Hahtela, O. and Kemppinen, A. and Mykk{\"a}nen, E. and Prunnila, M. and Gunnarsson, D. and Roschier, L. and Meschke, M. and Pekola, J.} } @Article { KhoramshahiRVKHHNN2016, title = {Close-range environmental remote sensing with 3D hyperspectral technologies}, journal = {Earth Resources and Environmental Remote Sensing/GIS Applications VII}, year = {2016}, month = {10}, day = {18}, volume = {10005}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, keywords = {Remote sensing, Unmanned aerial vehicles, Clouds, Radiative energy transfer, Modeling, RGB color model, Radiation, Hyperspectral imaging, LIDAR, Anisotropy}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2571414\&resultClick=1}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {SPIE}, language = {30}, DOI = {10.1117/12.2240936}, stag_bib_extends_levelofaccess = {NA}, author = {Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Kaasalainen, S. and Hakala, T. and Honkavaara, E. and Nevalainen, O. and N{\"a}si, R.} } @Article { BrabanCEFBLPHTPMPVWvTNP2016, title = {A metrological approach to improve accuracy and reliability of ammonia measurements in ambient air}, journal = {Measurement Science and Technology}, year = {2016}, month = {10}, volume = {27}, number = {11}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {115012}, keywords = {ammonia in ambient air, traceability, reference gas standards, optical transfer standard, validation and testing infrastructure}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, address = {Bristol, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/27/11/115012}, stag_bib_extends_levelofaccess = {NA}, author = {Braban, Christine F and Cassidy, Nathan and Ebert, Volker and Ferracci, Valerio and Balslev-Harder, David and Leuenberger, Daiana and Pascale, C{\'e}line and Hieta, Tuomas and Tiebe, Carlo and Peltola, Jari and Martin, Nicholas A and Persijn, Stefan and Vaittinen, Olavi and Wirtz, Klaus and van Wijk, Janneke and Twigg, Marsailidh M and Niederhauser, Bernhard and Pog{\'a}ny, Andrea} } @Article { , title = {Fundamental uncertainty equations for nuclear dating applied to the 140Ba-140La and 227Th-223Ra chronometers}, journal = {Journal of Environmental Radioactivity}, year = {2016}, month = {10}, volume = {162-163}, number = {-}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {358-370}, keywords = {Nuclear chronometry; Uncertainty; CTBT; Non-proliferation; Geochronology; Nuclear medicine; Dosimetry}, web_url = {http://www.sciencedirect.com/science/article/pii/S0265931X16302144}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0265-931X}, DOI = {10.1016/j.jenvrad.2016.06.013}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S0265931X16302144}, author = {Pomm{\'e}, S and Collins, SM and Harms, A and Jerome, SM} } @Article { SmithHRGLI2016, title = {Estimation of background gas concentration from differential absorption lidar measurements}, journal = {Atmospheric Measurement Techniques}, year = {2016}, month = {10}, volume = {9}, number = {10, 2016}, number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions}, pages = {4879-4890}, keywords = {gas concentration, differential absorption, atmosphere, metrology, emission fluxes, lidar, pollutants, measurement}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, address = {G{\"o}ttingen}, language = {30}, ISSN = {18678548}, DOI = {10.5194/amt-9-4879-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, N. and Harris, P. and Robinson, R. and Gardiner, T. and Livina, V. and Innocenti, F.} } @Article { HuangGYKLZF2016, title = {Lumen degradation modeling of white-light LEDs in step stress accelerated degradation test}, journal = {Reliability Engineering \& System Safety}, year = {2016}, month = {10}, volume = {154}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {152-159}, keywords = {Accelerated test, Brownian motion, Degradation test, Light-emitting diodes, Step stress, Wiener process}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {Suite 800, 230 Park Avenue, New York, NY 10169, USA}, language = {30}, ISSN = {0951-8320}, DOI = {10.1016/j.ress.2016.06.002}, stag_bib_extends_levelofaccess = {NA}, author = {Huang, Jianlin and Golubović, Dušan S and Yang, Daoguo and Koh, Sau and Li, Xiupeng and Zhang, G.Q. and Fan, Xuejun} } @Article { RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016, title = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, journal = {Atmospheric Chemistry and Physics}, year = {2016}, month = {9}, day = {23}, volume = {16}, number = {18}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {11915-11935}, keywords = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7324}, DOI = {10.5194/acp-16-11915-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Ramachandran, R. and Fu, X. and Zhang, H. and Feng, X.B. and Wip, D. and Obolkin, V. and Mashyanov, N. and Sena, F. and Gawlik, B.M. and Neves, L.M. and Read, K.A. and Kotnik, J. and Horvat, M. and Skov, H. and Magand, O. and Angot, H. and Dommergue, A. and Garcia, P.E. and Di{\'e}guez, M.D.C and Barbante, C. and Cairns, W. and Brito, J. and Barbosa, H.D.M.J and Morais, F. and Artaxo, P. and W{\"a}ngberg, I. and Munthe, J. and Martin, L. and Labuschagne, C. and Brunke, E.G. and Weigelt, A. and Ebinghaus, R. and Landis, M. and Mannarino, V. and Cinnirella, S. and Carbone, F. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Cossa, D. and Knoery, J. and Marusczak, Nicolas and Nerentorp, M. and Fisicaro, P.} } @Article { , title = {Comb mode filtering silver mirror cavity for spectroscopic distance measurement}, journal = {Review of Scientific Instruments}, year = {2016}, month = {9}, day = {19}, volume = {87}, number = {2016}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {093107}, keywords = {Mirrors, frequency combs, silver, Fabry-Perot interfermoters, piezoelectric transducers}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/87/9/10.1063/1.4962681}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, DOI = {10.1063/1.4962681}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Šm{\'i}d, R. and H{\"a}nsel, A. and Pravdova, L. and Cip, O. and Bhattacharya, N.} } @Article { BennettBHWRBBRC2016, title = {Double differential cross sections for proton induced electron emission from molecular analogues of DNA constituents for energies in the Bragg peak region}, journal = {The Journal of Chemical Physics}, year = {2016}, month = {9}, day = {14}, volume = {145}, number = {10}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {104301}, keywords = {DNA, cross sections, proton impact, tetrahydrofuran, pyrimidine, trimethylphosphate, Bragg peak}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Publishing}, address = {2 Huntington Quadrangle, Ste 1 No 1 Suite 300, Melville 11747-4502 ,United States}, language = {30}, ISSN = {0021-9606, 1089-7690}, DOI = {10.1063/1.4962171}, stag_bib_extends_levelofaccess = {NA}, author = {Bennett, Daniel and Bug, Marion U. and Hilgers, Gerhard and Wang, Mingjie and Rudek, Benedikt and Baek, Woon Yong and Buhr, Ticia and Rabus, Hans and Champion, Christophe} } @Proceedings { , title = {Proficiency Testing for Conducted Immunity with a new Round Robin Test Device}, journal = {International Symposium and Exhibition on Electromagnetic Compatibility Proceedings}, year = {2016}, month = {9}, day = {10}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-100}, keywords = {Electromagnetic Compatibility (EMC), IEC 61000- 4-6, EN ISO 17025, EN ISO 17043, proficiency testing, round robin, test device, conducted immunity, common mode, disturbance signal, Coupling-Decoupling Network (CDN), inter-laboratory comparison, Equipment under Test (EUT), Auxiliary Equipment (AE).}, web_url = {http://www.emceurope.org/2016/index.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Wroclaw / Poland}, event_name = {EMC Europe 2016 Wroclaw International Symposium and Exhibition on Electromagnetic Compatibility}, event_date = {05-09-2016 to 09-09-2016}, language = {30}, ISBN = {978-1-4799-6615-8}, ISSN = {2158-110X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tas, Emrah and Cakir, Soydan and Cetintas, Mustafa and Hamouz, Pavel and Isbring, Thomas and Kokalj, Miha and Lopez, Daniel and Lundgren, Urban and Mandaris, Dwi and Pinter, Borut and Poriz, Martin and Pous, Marc and Pythoud, Fr{\'e}d{\'e}ric and Sen, Osman and Silva, Ferran and Svaboda, Marek and Trincaz, Braise and Zhao, Dongsheng} } @Proceedings { , title = {Convolution and deconvolution of bidirectional scatter distribution function data to enable inter-instrument comparison}, journal = {Proceedings of the 4th CIE Expert Symposium on Colour and Visual Appearance}, year = {2016}, month = {9}, volume = {CIE x043:2016}, number = {-}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {427-431}, keywords = {Bidirectional Scatter Distribution Function, Convolution, Deconvolution}, web_url = {http://div2.cie.co.at/?i_ca_id=985}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {CIE}, address = {Vienna}, event_place = {Prague}, event_name = {4th CIE Expert Symposium on Colour and Visual Appearance}, event_date = {06-09-2016 to 07-11-2016}, language = {30}, ISBN = {978-3-902842-59-6}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Audenaert, J. and Hanselaer, P. and Leloup, F. B.} } @Proceedings { , title = {THE COMPARISON OF A MICROWAVE BASED BIOENERGY MOISTURE MEASUREMENT INSTRUMENT AGAINST THE LOSS-ON-DRYING METHOD}, journal = {Proceedings of XXI IMEKO World Congress, Prague, CZECH REPUBLIC, 2015}, year = {2016}, month = {8}, day = {30}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {moisture measurement, bioenergy, microwave, oven drying, LoD}, web_url = {www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC24-458.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IMEKO}, address = {Budapest, Hungary}, event_place = {Prague. Czech Republic}, event_name = {XXI IMEKO World Congress, Prague, CZECH REPUBLIC, 2015}, event_date = {August 30 - September 4, 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {{\"O}sterberg, P and Heinonen, M and Ojanen-Saloranta, M and M{\"a}kynen, A} } @Proceedings { , title = {Design of delta-sigma feedback loop for quantum voltage digitizer}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, month = {8}, day = {11}, volume = {1}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Delta-sigma modulation, Josephson junctions, measurement, metrology, voltage measurement.}, web_url = {http://ieeexplore.ieee.org/document/7540457/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements 2016, (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540457}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540457/}, author = {Ireland, J and Cryer, A and Williams, JM and Houtzager, E and Hornecker, R and van den Brom, HE} } @Article { , title = {Calibration systems for analogue non-conventional voltage and current transducers}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, month = {8}, day = {11}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, keywords = {Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measure-ment standards, High-Voltage techniques}, tags = {SEG}, web_url = {http://ieeexplore.ieee.org/document/7540488/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, ISSN = {978-1-4673-9134-4}, DOI = {10.1109/CPEM.2016.7540488}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Houtzager, E and Mohns, E and Fricke, S and Ayhan, B and Cayci, H} } @Proceedings { , title = {Accurate Phase Calibration of PMUs and PMU Calibrators}, journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, month = {8}, day = {11}, volume = {2016}, number = {1}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1-2}, keywords = {aperture delay, calibration, phasor measurement unit, phase measurement, PMU, synchrophasor.}, web_url = {http://ieeexplore.ieee.org/document/7540461/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa, Canada}, event_name = {Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540461}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Acanski, M and Rietveld, G and Hoogenboom, D} } @Proceedings { , title = {Fabrication of graphene quantum Hall resistance standard in a cryogen-freee table-top system}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Epitaxial layers, Graphene, measurement standards, microfabrication, quantum hall effect}, web_url = {http://ieeexplore.ieee.org/document/7540516/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540516}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {He, H. and Janssen, T.J.B.M. and Rozhko, S. and Tzalenchuk, A. and Lara-Avila, S. and Yakimova, R. and Kubatkin, S.} } @Proceedings { , title = {Towards a cryogen-free table-top primary resistance standard}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {quantum Hall effect, graphene, primary resistance metrology, cryogenic current comparators.}, web_url = {http://ieeexplore.ieee.org/document/7540654/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540654}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Rhozhko, S. and Williams, J.M. and Ireland, J. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Tzalenchuk, A.} } @Proceedings { , title = {Measurement comparison up to 65 GHz in coaxial 1.85 mm line}, journal = {Proceedings of the Conference on Precision Electromagnetic Measurements}, year = {2016}, month = {8}, day = {11}, volume = {n/a}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-2}, keywords = {high frequency circuits, metrology,}, web_url = {http://ieeexplore.ieee.org/document/7540504/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Melville}, event_place = {Ottawa, Canada}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540504}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ei⊘, C and Allal, D and Huerlimann, P and Ruefenacht, J and Zinal, S} } @Article { , title = {Detector-device-independent QKD: security analysis and fast implementation}, journal = {Journal of Applied Physics}, year = {2016}, month = {8}, day = {9}, volume = {120}, number = {6}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {063101}, note = {Copyright was too long instead of that we will ise the link. (see copyright statment below) Subject to the rights herein granted to AIP Publishing, each Copyright Owner retains ownership of copyright and all other proprietary rights such as patent rights in the Work. Each Copyright Owner retains the following nonexclusive rights to use the Work, without obtaining permission from AIP Publishing, in keeping with professional publication ethics, and provided clear credit is given to its first publication in an AIP Publishing journal. Any reuse must include a full credit line acknowledging AIP Publishing’s publication and a link to the VOR on AIP Publishing’s site. Each Copyright Owner may: 1. Reprint portions of the Work (excerpts, figures, tables) in future works created by the Author, in keeping with professional publication ethics. 2. Post the Accepted Manuscript (AM) to their personal web page or their employer’s web page immediately after acceptance by AIP Publishing. 3. Deposit the AM in an institutional or funder-designated repository immediately after acceptance by AIP Publishing. 4. Use the AM for posting within scientific collaboration networks (SCNs). For a detailed description of our policy on posting to SCNs, please see our Web Posting Guidelines (https://publishing.aip.org/authors/web-posting-guidelines). 5. Reprint the Version of Record (VOR) in print collections written by the Author, or in the Author’s thesis or dissertation. It is understood and agreed that the thesis or dissertation may be made available electronically on the university’s site or in its repository and that copies may be offered for sale on demand. 6. Reproduce copies of the VOR for courses taught by the Author or offered at the institution where the Author is employed, provided no fee is charged for access to the Work. 7. Use the VOR for internal training and noncommercial business purposes by the Author’s employer. 8. Use the VOR in oral presentations made by the Author, such as at conferences, meetings, seminars, etc., provided those receiving copies are informed that they may not further copy or distribute the Work. 9. Distribute the VOR to colleagues for noncommercial scholarly use, provided those receiving copies are informed that they may not further copy or distribute the Work. 10. Post the VOR to their personal web page or their employer’s web page 12 months after publication by AIP Publishing. 11. Deposit the VOR in an institutional or funder-designated repository 12 months after publication by AIP Publishing. 12. Update a prior posting with the VOR on a noncommercial server such as arXiv, 12 months after publication by AIP Publishing.}, keywords = {Quantum cryptography, Polarization, Qubits, Photons, Modulators}, web_url = {https://arxiv.org/pdf/1607.05435.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {0021-8979}, DOI = {10.1063/1.4960093}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-8-10}, author = {Boaron, Alberto and Korzh, Boris and Houlmann, Raphael and Boso, Gianluca and Lim, Charles Ci Wen and Martin, Anthony and Zbinden, Hugo} } @Article { , title = {Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites}, journal = {International Journal of Remote Sensing}, year = {2016}, month = {8}, day = {9}, volume = {37}, number = {19}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {4665-4682}, keywords = {Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites}, web_url = {http://www.tandfonline.com/doi/full/10.1080/01431161.2016.1220030}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Taylor and Francis}, address = {Abingdon}, language = {30}, ISSN = {1366-5901}, DOI = {10.1080/01431161.2016.1220030}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gorrono, JG and Bialek, AB and Green, PDG and Harris, PH and Scanlon, TS and Fox, NPF and Underwood, CU} } @Proceedings { , title = {Calibration of Si-SPAD detectors using the double attenuator technique and a low noise silicon photodiode}, journal = {DGaO Proceedings 2016}, year = {2016}, month = {8}, day = {8}, volume = {117}, number = {none}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {28-29}, keywords = {Calibration, SPAD}, web_url = {http://www.dgao-proceedings.de/download/117/117_p28.pdf}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {DGaO}, address = {Erlangen}, event_place = {Hannover}, event_name = {DGaO - Deutschen Gesellschaft f{\"u}r angewandte Optik}, event_date = {12-05-2016 to 17-05-2016}, language = {30}, ISSN = {1614-8436}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.dgao-proceedings.de/download/117/117_p28.pdf}, author = {Lopez, M. and Porrovecchio, G. and Hofer, H. and Rodiek, B. and Šmid, M. and K{\"u}ck, S.} } @Article { , title = {Characterisation of nitrogen-vacancy based single-photon sources}, journal = {DGaO Proceedings 2016}, year = {2016}, month = {8}, day = {8}, volume = {117}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {117_p32}, keywords = {single-photon source, nitrogen-vacancy in nanodiamonds, calibration, single-photon detectors, antibunching}, web_url = {http://www.dgao-proceedings.de/download/117/117_p32.pdf}, web_url2 = {http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Deutschen Gesellschaft f{\"u}r angewandte Optik e.V.}, address = {Erlangen}, language = {30}, ISSN = {1614-8436}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://nbn-resolving.de/urn:nbn:de:0287-2016-P032-6}, author = {Rodiek, B. and L{\'o}pez, M. and Hofer, H. and Chu, X.-L. and G{\"o}tzinger, S. and K{\"u}ck, S.} } @Article { SvecSSRPNMLKJGFFDMAHBTTVW2016_2, title = {60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {8}, volume = {114}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {167-172}, keywords = {Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.05.014}, stag_bib_extends_levelofaccess = {NA}, author = {Svec, A. and Solc, J. and Silva, L. and Reis, M. and Peyres, V. and Nečemer, M. and Moser, H. and Luca, A. and Klemola, S. and Javornik, A. and Garc{\'i}a-Tora{\~n}o, E. and Ferreux, L.. and Fazio, A. and Dry{\'a}k, P. and Marroyo, B.C. and Arnold, D. and Hult, M. and Burda, O. and Tzika, F. and Tyminski, Z. and Vodenik, B. and W{\"a}tjen, U.} } @Article { , title = {Advances in Large Scale Metrology – Review and Future Trends}, journal = {CIRP Annals Manufacturing Technology}, year = {2016}, month = {8}, volume = {65/I}, number = {2016}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {643-665}, keywords = {Metrology, Measuring Instrument, Uncertainty, Simulation, Modelling, Information}, web_url = {http://www.sciencedirect.com/science/article/pii/S0007850616301895}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Oxford}, language = {30}, DOI = {10.1016/j.cirp.2016.05.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Schmitt, R. and Peterek, M. and Morse, E. and Knapp, W. and Galetto, M. and H{\"a}rtig, F. and Goch, G. and Hughes, B. and Forbes, A. and Estler, W.T.} } @Article { HerrmannPSHM2016, title = {Photovoltaic energy rating data sets for Europe}, journal = {Solar Energy}, year = {2016}, month = {8}, volume = {133}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {349-362}, keywords = {Photovoltaics; Energy rating; Sensitivity analysis; Power matrix}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2016.03.071}, stag_bib_extends_levelofaccess = {NA}, author = {Herrmann, W and Pozza, A and Salis, E and Huld, T and M{\"u}llejans, H} } @Article { SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016, subid = {135}, title = {A clock network for geodesy and fundamental science}, journal = {Nature Communications}, year = {2016}, month = {8}, volume = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {12443}, keywords = {Clock network; geodesy;}, web_url = {https://www.nature.com/articles/ncomms12443}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms12443}, stag_bib_extends_levelofaccess = {NA}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and Doerscher, S. and Haefner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G. and Amy-Klein, A. and Le Targat, R. and Lodewyck, J. and Lopez, O and Pottie, P.-E.} } @Article { , title = {Experimental determination of the oxygen K-shell fluorescence yield using thin SiO2 and Al2O3 foils}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2016}, month = {7}, day = {28}, volume = {124}, number = {1 Oct 2016}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {94-98}, keywords = {fundamental parameter, fluorescence yield, oxygen, XRS}, web_url = {http://www.sciencedirect.com/science/article/pii/S0584854716301732}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier B.V.}, address = {Amsterdam}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2016.08.024}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}nicke, P. and Kolbe, M. and Krumrey, M. and Unterumsberger, R. and Beckhoff, B.} } @Article { , title = {Giant quantum Hall plateaus generated by charge transfer in epitaxial graphene}, journal = {Nature: Scientific Reports}, year = {2016}, month = {7}, day = {26}, volume = {6}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {30296}, keywords = {graphene, measurement, QHE,}, web_url = {http://www.nature.com/articles/srep30296?WT.feed_name=subjects_physical-sciences}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Scientific reports}, language = {30}, DOI = {10.1038/srep30296}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Alexander-Webber, J.A. and Huang, J. and Maude, D.K. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.} } @Article { WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016, title = {Five-year records of Total Mercury Deposition flux at GMOS sites in the Northern and Southern Hemispheres}, journal = {Atmospheric Chemistry and Physics Discussions}, year = {2016}, month = {7}, day = {20}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {1-33}, keywords = {mercury, wet deposition flux,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7375}, DOI = {10.5194/acp-2016-517}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}ngberg, I. and Walters, C. and Vard{\`e}, M. and Spandow, P. and Somerset, V. and Sena, F. and Islas, M.R. and Obolkin, V. and Munthe, J. and Mkololo, T. and Mashyanov, N. and Martin, L. and Magand, O. and Labuschagne, C. and Kotnik, J. and Horvat, M. and Hansson, K. and Hagestr{\"o}m, U. and Gawlik, B. and Garcia, P.E. and Fu, X. and Feng, X.B. and Ebinghaus, R. and Dommergue, A. and Di{\'e}guez, M.D.C. and Comero, S. and Cairns, W. and Arcega-Cabrera, F. and Brunke, E.G. and Barbante, C. and Angot, H. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Weigelt, A. and Yang, X. and Fisicaro, P.} } @Proceedings { , title = {Receiver Algorithm for Decoding Constellation Modulation}, journal = {Advanced Photonics 2016 SPPCom}, year = {2016}, month = {7}, day = {18}, number = {2016}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {SpTu1F.3}, keywords = {Coherent communications Fiber optics communications Modulation}, web_url = {https://www.osapublishing.org/abstract.cfm?uri=SPPCom-2016-SpTu1F.3}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Optical Society of America}, address = {Washington, D.C.}, event_place = {Vancouver, Canada}, event_name = {Advanced Photonics}, event_date = {18-07-2016}, language = {30}, ISBN = {978-1-943580-14-9}, ISSN = {N/A}, DOI = {10.1364/SPPCOM.2016.SpTu1F.3}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dash, S. S. and Pythoud, F and B, B and Josten, A and Leuchtmann, P and Hillerkuss, D and Leuthold, J} } @Proceedings { , title = {Effects of Connectors and Improper Mounting of Air Lines in TRL Calibration}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, day = {15}, volume = {NA}, number = {NA}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {NA}, keywords = {connector effects, precision air line, TRL calibration, vector network analyzer.}, web_url = {http://ieeexplore.ieee.org/document/7540506/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {NA}, language = {30}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540506}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mubarak, F. and Hoffmann, J.} } @Proceedings { , title = {Verification concepts in S-parameter measurements}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, day = {15}, volume = {NA}, number = {NA}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {NA}, keywords = {Verification, scattering parameter, vector network analyzer.}, web_url = {http://ieeexplore.ieee.org/document/7540508/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {NA}, language = {30}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540508}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mubarak, F. and Zeier, M. and Hoffmann, J. and Ridler, N.M. and Salter, M.J. and Kuhlmann, K.} } @Proceedings { BeckhoffPMHK2016, title = {Fundamental parameter determination to improve spectroscopical methods}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, month = {7}, day = {10}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, keywords = {X-ray fluorescence, atomic fundamental parameters, fluorescence yields, optical constants, spectroscopy}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Ottawa}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, DOI = {10.1109/CPEM.2016.7540520}, stag_bib_extends_levelofaccess = {NA}, author = {Beckhoff, B. and Pollakowski, B. and Muller, M. and Honicke, P. and Kolbe, M.} } @Proceedings { , title = {Uncertainty Evaluation of Balanced S-Parameter Measurements}, journal = {Conference on Precision Electromagnetic Measurements, Ottawa, Canada, 10 – 15 July 2016}, year = {2016}, month = {7}, day = {10}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {N/A}, keywords = {Balanced devices, electromagnetic simulation, Monte Carlo method, scattering parameters, uncertainty analysis, signal integrity, vector network analyzer.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7540616}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, USA}, event_place = {Ottawa, Canada}, event_name = {Conference on Precision Electromagnetic Measurements 2016 (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, DOI = {10.1109/CPEM.2016.7540616}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ziade, F. and Hudlicka, M. and Salter, M. and Pavlicek, T. and Allal, D.} } @Proceedings { , title = {A Nonlinear Verification Device for Nonlinear Vector Network Analyzers}, journal = {Proceedings Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, month = {7}, day = {10}, volume = {1}, number = {1}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-2}, keywords = {Impedance matching, electromagnetic modeling, measurement uncertainty, microwave integrated circuits, nonlinear network analysis, semiconductor diodes.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7540467\&isnumber=7539723}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Westin Hotel, Ottawa, Ontario, Canada}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 16-07-2016}, language = {30}, ISBN = {N/A}, ISSN = {05891485}, DOI = {10.1109/CPEM.2016.7540467}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Humphreys, D. A. and Rajabi, M. and Schreur, D. and Nielsen, T.} } @Article { , title = {Comparison at the sub-100 fW optical power level of calibrating a single-photon detector using a high-sensitive, low-noise silicon photodiode and the double attenuator technique}, journal = {Metrologia}, year = {2016}, month = {7}, day = {8}, volume = {53}, number = {4}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {1115-1122}, keywords = {detection efficiency, Si-SPAD, calibration, comparison}, web_url = {http://iopscience.iop.org/journal/0026-1394}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Oxford}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1115}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Porrovecchio, G. and Šmid, M. and Lopez, M. and Hofer, H. and Rodiek, B. and K{\"u}ck, S.} } @Article { , title = {Reference data sets for testing metrology software}, journal = {Metrologia}, year = {2016}, month = {7}, day = {6}, volume = {53}, number = {4}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {1091-1100}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1091}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1091}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kok, GJPK and Harris, PMH and Smith, IMS and Forbes, ABF} } @Article { , title = {A second generation of low thermal noise cryogenic silicon resonators}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {7}, day = {4}, volume = {723}, number = {1}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {012031}, keywords = {ultrastable laser, thermal noise, coating, silicon resonator}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012031/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {1742-6596}, DOI = {10.1088/1742-6596/723/1/012031}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Matei, D and Legero, T and Grebing, C and H{\"a}fner, S and Lisdat, C and Weyrich, R and Zhang, W and Sonderhouse, L and Robinson, J M and Riehle, F and Ye, J and Sterr, U} } @Article { , title = {Irradiation-induced degradation of PTB7 investigated by valence band and S 2p photoelectron spectroscopy}, journal = {Nanotechnology}, year = {2016}, month = {7}, day = {1}, volume = {27}, number = {32}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {324005}, keywords = {organic photo voltaics, XPS, UPS}, web_url = {http://iopscience.iop.org/article/10.1088/0957-4484/27/32/324005}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0957-4484}, DOI = {10.1088/0957-4484/27/32/324005}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Darlatt, E and Muhsin, B and Roesch, R and Lupulescu, C and Roth, F and Kolbe, M and Gottwald, A and Hoppe, H and Richter, M} } @Article { MerimaaWWMJGKNTLHLGP2016, title = {Frequency Comparison of171Yb+Ion Optical Clocks at PTB and NPL via GPS PPP}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2016}, month = {7}, volume = {63}, number = {7}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {981-985}, keywords = {Frequency transfer, GPS precise point positioning (PPP), optical clock}, web_url = {https://ieeexplore.ieee.org/document/7398135/keywords}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2016.2524988}, stag_bib_extends_levelofaccess = {NA}, author = {Merimaa, M. and Wallin, A. and Whibberley, P. B. and Margolis, H. S. and Jones, J. M. and Godun, R. M. and King, S. A. and Nisbet-Jones, P. B. R. and Tamm, C. and Lipphardt, B. and Huntemann, N. and Leute, J. and Gill, P. and Peik, E.} } @Proceedings { StyblikovaKHPD2016, title = {Use of a nanocrystalline core for a precise non-invasive AC current measurement}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, keywords = {AC current sensor, nanocrystalline material, non-invasive measurement, phase displacement, ratio error.}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Ottawa, ON, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540492}, stag_bib_extends_levelofaccess = {NA}, author = {Styblikova, R. and Knenicky, M and Hlavacek, J. and Prochazka, R. and Draxler, K.} } @Proceedings { , title = {Characterization and Optimization of Ultrasonic Tests for Inspection of Fiber-Reinforced Plastic Composites in Energy Related Applications, 19th World Conference on Non-Destructive Testing 13-17 June 2016, Munich}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Energy Generation}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-8}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we4d5.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hosseini, SH and Segur, DS and Boehm, RB and Gohlke, DG and Heckel, TH and Riemer, SR and Brackrock, DB and Gaal, MG} } @Proceedings { , title = {A Calibration Method of the Linearity of Lock In Amplifiers}, journal = {CPEM 2016 Digest}, year = {2016}, month = {7}, volume = {N/A}, number = {N/A}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {549-550}, keywords = {Impedance bridge, lock in amplifier, linearity, phase sensitive detector, resistive divider}, web_url = {http://ieeexplore.ieee.org/document/7540691/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {CPEM 2016}, address = {Ottawa}, event_place = {The Westin Ottawa. Ottawa, Ontario (Canada).}, event_name = {Conference on Precision Electromagnetics Measurements 2016}, event_date = {10-07-2016 50 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540691}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Raso Alonso, F{\'e}lix isidro and Hortelano0 Garc{\'i}a, Alexandra and Izquierdo Garc{\'i}a, Mª Mar} } @Proceedings { , title = {RF wafer probing with improved contact repeatability using nanometer positioning}, journal = {Microwave Measurement Conference (ARFTG), 2016 87th ARFTG}, year = {2016}, month = {6}, day = {30}, number = {N/A}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {N/A}, keywords = {Probes, Standards, Frequency measurement, Radio frequency, Calibration, Microwave measurement,}, web_url = {https://hal.archives-ouvertes.fr/hal-02083251/document}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {San Francisco CA USA}, event_name = {Microwave Measurement Conference (ARFTG), 2016 87th ARFTG}, event_date = {27-05-2016 to 27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, DOI = {10.1109/ARFTG.2016.7501967}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Daff{\'e}, K. and Dambrine, G. and von Kleist-Retzow, F. and Haddadi, K.} } @Proceedings { OliveiraNKRVNHHT2016, title = {Geometric and Reflectance Signature Characterization of Complex Canopies using Hyperspectral Stereoscopic Images from UAV and Terrestrial Platforms}, journal = {ISPRS - International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences}, year = {2016}, month = {6}, day = {17}, volume = {XLI-B7}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {77-82}, keywords = {Hyperspectral, Radiometry, Photogrammetry, Geometry, Matching, Uncertainty}, web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B7/77/2016/isprs-archives-XLI-B7-77-2016.pdf}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, address = {Gottingen}, event_place = {Prague, Czech Republic}, event_name = {XXIII ISPRS Congress}, event_date = {12-07-2016 to 19-07-2016}, language = {30}, ISSN = {2194-9034}, DOI = {10.5194/isprsarchives-XLI-B7-77-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Oliveira, R. and N{\"a}si, R. and Khoramshahi, E. and Rosnell, T. and Viljanen, N. and Nevalainen, O. and Hakala, T. and Honkavaara, E. and Tommaselli, A.} } @Article { , title = {Consistency analysis of multidimensional gonio-spectrophotometric measurements in interlaboratory comparisons}, journal = {Metrologia}, year = {2016}, month = {6}, day = {14}, volume = {53}, number = {4}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1024-1030}, keywords = {BRDF, goniospectrophotometry, interlaboratory comparison}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1024/meta}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {Online ISSN: 1681-7575, Print ISSN: 0026-1394}, DOI = {10.1088/0026-1394/53/4/1024}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, A and Campos, J and Bernad, B and Pons, A and Hernanz, M L and Mart{\'i}nez-Verd{\'u}, F M and H{\"o}pe, A} } @Article { , title = {High-performance near- and mid-infrared crystalline coatings}, journal = {Optica}, year = {2016}, month = {6}, day = {13}, volume = {3}, number = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {647}, keywords = {(300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings; (310.1860) Deposition and fabrication; (140.4780) Optical resonators.}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington, D.C. 20036-1012 USA}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.3.000647}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {COLE, G D and ZHANG, W and BJORK, B J and FOLLMAN, D and HEU, P and DEUTSCH, C and SONDERHOUSE, L and ROBINSON, J and FRANZ, C and ALEXANDROVSKI, A and NOTCUTT, M and HECKL, O H and YE, J and ASPELMEYER, M} } @Article { , title = {Uncertainty propagation in computationally expensive models: A survey of sampling methods and application to scatterometry}, journal = {Measurement}, year = {2016}, month = {6}, day = {8}, volume = {in press, corrected proof}, number = {in press, corrected proof}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {smart sampling, statistical inverse problem, scatterometry}, tags = {MAT}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116302901}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {-}, DOI = {10.1016/j.measurement.2016.06.009}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Heidenreich, S and Gross, H and B{\"a}r, M and Wright, L} } @Article { SterrAKGHVL2016, title = {A transportable optical lattice clock}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {6}, volume = {723}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {012020}, keywords = {time and frequency metrology, transportable optical lattice clock, chronometric geodesy}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012020/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/723/1/012020}, stag_bib_extends_levelofaccess = {NA}, author = {Sterr, U. and Al-Masoudi, A. and Koller, S. and Grotti, J. and H{\"a}fner, S. and Vogt, S. and Lisdat, C.} } @Proceedings { , title = {Traceable High Impedance Calibration Standards}, journal = {87th ARFTG Microwave Measurement Conference (ARFTG)}, year = {2016}, month = {5}, day = {27}, volume = {n/a}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Calibration standards, characterization, electromagnetic simulation, microwave measurement, scattering parameters}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7501942\&isnumber=7501936}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {San Francisco, CA, USA}, event_name = {87th ARFTG Microwave Measurement Conference (ARFTG)}, event_date = {27 May 2016}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/ARFTG.2016.7501942}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Haase, Martin and Hoffmann, Karel and Hudlička, Martin} } @Proceedings { , title = {Maximizing the Benefit of Existing Equipment for Nonlinear and Communication Measurements}, journal = {N/A}, year = {2016}, month = {5}, day = {27}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Nonlinear measurements, oscilloscope, sampling, analogue to digital conversion}, web_url = {http://www.arftg.org/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {San Francisco, CA, USA}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30}, stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART}, author = {Humphreys, D. A. and Raffo, A. and Bosi, G. and Vannini, G. and Schreurs, D. and Gebremicael, K. N. and Morris, K.} } @Proceedings { , title = {Impact of Microwave Measurement Uncertainty on the Nonlinear Embedding Procedure}, journal = {N/A}, year = {2016}, month = {5}, day = {27}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Microwave measurements uncertainty, microwave transistors, nonlinear embedding, power amplifiers, vector-calibrated nonlinear measurements.}, web_url = {http://www.arftg.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {San Francisco, CA, USA}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30}, stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART}, author = {Bosi, G. and Raffo, A. and Avolio, G. and Schreurs, D. and Humphreys, D. A.} } @Article { , title = {Fundamentals of multiplexing with digital PCR}, journal = {Biomolecular Detection and Quantification}, year = {2016}, month = {5}, day = {27}, volume = {10}, number = {Special issue on dPCR}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {15-23}, keywords = {dPCR, Digital PCR, Duplex, Higher order multiplexing, Multiplexing}, web_url = {http://www.sciencedirect.com/science/article/pii/S2214753516300092}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {2214-7535}, DOI = {10.1016/j.bdq.2016.05.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S2214753516300092}, author = {Whale, AS and Huggett, JF and Tzonev, S} } @Article { , title = {Realization of a timescale with an accurate optical lattice clock}, journal = {Optica}, year = {2016}, month = {5}, day = {25}, volume = {3}, number = {6}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {563-569}, keywords = {optical clocks, SI units, caesium fountain clocks, metrology, atom optics, spectroscopy, high resolution}, web_url = {http://arxiv.org/abs/1511.03888}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Optical Society of America}, address = {Washington DC}, language = {30}, ISSN = {n/a}, DOI = {10.1364/OPTICA.3.000563}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-5-25}, author = {Grebing, C and Al-Masoudi, A and D{\"o}rscher, S and H{\"a}fner, S and Gerginov, V and Weyers, S and Lipphardt, B and Sterr, U and Lisdat, C} } @Proceedings { , title = {Comparison of an NMR-based Bioenergy Moisture Measurement Instrument against the Loss-on-Drying Method}, journal = {Proceedngs of the 11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances, Florence, ITALY, 2016}, year = {2016}, month = {5}, day = {23}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {285-296}, keywords = {moisture measurement, bioenergy, NMR, oven drying, LoD}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Edifir-Edizione}, address = {Florence}, event_place = {Florence, Italy}, event_name = {International Conference on Electromagnetic Wave Interaction with Water and Moist Substances, ISEMA 2016}, event_date = {May 23 - 27, 2016}, language = {30}, ISBN = {978-88-7970-800-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Osterberg, P and Heinonen, M and Ojanen-Saloranta, M and M{\"a}kynen, A} } @Proceedings { , title = {Influence of dielectric support on military radiated emission tests above 30 MHz}, journal = {2016 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)}, year = {2016}, month = {5}, day = {21}, volume = {01}, number = {-}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {709-711}, keywords = {Radiated Emission, REI 02, Support, MIL-STD- 46IF}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7522843\&newsearch=true\&queryText=RE102\%20support}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Shenzhen}, event_name = {2016 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)}, event_date = {17-05-2016 to 21-05-2016}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1109/APEMC.2016.7522843}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Şen, Osman and \c{C}akır, Soydan and CELEP, Murat and \c{C}ınar, Mehmet and HAMID, Ramiz and \c{C}etintaş, Mustafa} } @Article { WangBRdBBRBH2016, title = {Cross sections for ionization of tetrahydrofuran by protons at energies between 300 and 3000 keV}, journal = {Physical Review A}, year = {2016}, month = {5}, day = {20}, volume = {93}, number = {5}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {DNA cross sections, proton impact, tetrahydrofuran, Bragg peak}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {1 Research Road,Ridge, NY 11961-2701, (631) 591-4000, United States}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.93.052711}, stag_bib_extends_levelofaccess = {NA}, author = {Wang, Mingjie and Bennett, Daniel and Rudek, Benedikt and de Vera, Pablo and Bug, Marion and Buhr, Ticia and Rabus, Hans and Baek, Woon Yong and Hilgers, Gerhard} } @Proceedings { , title = {Radiation of the coaxial-microstrip transition in precise microwave measurements}, journal = {43rd meeting of the Czech elektrotechnical society}, year = {2016}, month = {5}, day = {19}, volume = {n/a}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {microwave measurement, microstrip, radiation, canyon}, web_url = {web.cvut.cz/ces/mt/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Czech electrotechnical society}, address = {Prague}, event_place = {Prague, Czech Republic}, event_name = {43rd meeting of the Czech elektrotechnical society}, event_date = {19 May 2016}, language = {27}, ISBN = {978-80-02-02654-9}, ISSN = {n/a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hoffmann, Karel} } @Proceedings { , title = {Traceable Calibration with 1.0mm Coaxial Standards}, journal = {2016 87th ARFTG Microwave Measurement Conference (ARFTG)}, year = {2016}, month = {5}, volume = {May 2016}, number = {1}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Coaxial, S-parameters, transmission, reflection, vector network analyzer}, web_url = {http://ieeexplore.ieee.org/document/7501943/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York}, event_place = {San Francisco}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27.5.2016}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/ARFTG.2016.7501943}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hoffmann, J and Wollensack, M and Ruefenacht, J and Stalder, D and Zeier, M} } @Article { , title = {Mini array of quantum Hall devices based on epitaxial graphene}, journal = {Journal of Applied Physics}, year = {2016}, month = {5}, volume = {119}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {174504}, keywords = {QHE, Graphene, measurement,}, web_url = {http://arxiv.org/abs/1512.03163}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.4948675}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Novikov, S. and Lebedeva, N. and H{\"a}m{\"a}l{\"a}inen, J. and Iisakka, I. and Immonen, P. and Manninen, A.J. and Satrapinski, A.} } @Article { , title = {Four-wave dark-field electron holography for imaging strain fields}, journal = {Journal of Physics D: Applied Physics}, year = {2016}, month = {5}, volume = {J. Phys. D: Appl. Phys. 49 (2016) 244003 (8pp)}, number = {J. Phys. D: Appl. Phys. 49 (2016) 244003 (8pp)}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {J. Phys. D: Appl. Phys. 49 (2016) 244003 (8pp)}, keywords = {Four-wave dark-field electron holography strain fields}, web_url = {http://iopscience.iop.org/article/10.1088/0022-3727/49/24/244003/meta}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, address = {IOP Publishing}, language = {30}, ISSN = {J. Phys. D: Appl. Phys. 49 (2016) 244003 (8pp)}, DOI = {10.1088/0022-3727/49/24/244003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Denneulin, T and H{\"y}tch, M} } @Article { , title = {Diffusion-induced grain boundary migration as mechanism for grain growth and defect annihilation in chalcopyrite thin films}, journal = {Acta Materialia}, year = {2016}, month = {4}, day = {10}, volume = {111}, number = {-}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {377-384}, keywords = {X-ray diffraction, Physical vapor deposition (PVD), Stacking faults, Grain boundary migration, CuInSe2}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier Ltd.}, address = {Amsterdam}, language = {30}, ISSN = {1359-6454}, DOI = {10.1016/j.actamat.2016.03.073}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Stange, H. and Brunken, S. and Greiner, D. and Heinemann, M. D. and Kaufmann, C. A. and Schmidt, S. S. and B{\"a}cker, J.-P. and Klaus, M. and Genzel, C. and Mainz, R.} } @Proceedings { , title = {JRP SIB60 “Metrology for Long Distance Surveying”-a concise survey on major project results}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {March 30-April 1, 2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pollinger, F. and Bauch, A. and Leute, J. and Meiners-Hagen, K. and Mildner, J. and Guillory, J. and Wallerand, J.-P. and Jokela, J. and Kallio, U. and Koivula, H. and Lahtinen, S. and Poutanen, M. and Astrua, M. and Francese, C. and Zucco, M. and Eusebio, L. and Marques, F. and Pires, C. and Saraiva, F. and Pelligrino, O. and Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M. and Kupko, V. and Neyezhmakov, P. and Bergstrand, S. and van den Berg, S.A. and Kersten, T. and Krawinkel, T.} } @Proceedings { , title = {Spectroscopic Inline Thermometry}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {Submission 69}, keywords = {EMRP JRP SIB60 Surveying, refractive index of air, air temperature, laser spectroscopy}, web_url = {www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_69.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {FIG}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {30-03-2016 to 01-04-2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_69.pdf}, author = {Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M.} } @Article { , title = {Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150044}, keywords = {high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150044}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0044}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wooliams, E.R and Anhalt, K and Ballico, M and Bloembergen, P and Bourson, F and Briaudeau, S and Campos, J and Cox, M.G and del Campo, D and Dong, W and Dury, M.R and Gavrilov, V and Grigoryeva, I and Hernanz, M.L and Jahan, F and Khlevnoy, B and Khromchenko, V and Lowe, D.H and Lu, X and Machin, G and Mantilla, J.M and Martin, M.J and McEvoy, H.C and Rougie, B and Saldi, M and Salim, S.G.R and Sasajima, N and Taubert, D.R and Todd, A.D.W and Van den Bossche, R} } @Article { HainsworthKHJ2016_2, subid = {380}, title = {The existence of a lateral size effect and the relationship between indentation and scratch hardness in copper}, journal = {Philosophical Magazine}, year = {2016}, month = {3}, day = {24}, volume = {96}, number = {32-34}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {3396-3413}, keywords = {Nano-scratch testing, nano-scratch hardness, lateral size effects}, web_url = {https://pure.coventry.ac.uk/ws/portalfiles/portal/10344470/Nigel_Jennett_Manuscript_revised.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1478-6435, 1478-6443}, DOI = {10.1080/14786435.2016.1146828}, stag_bib_extends_levelofaccess = {NA}, author = {Kareer, A. and Hou, X.D. and Jennett, N.M. and Hainsworth, S.V.} } @Proceedings { , title = {Approaching the Shannon Limit Through Constellation Modulation}, journal = {Optical Fiber Communication Conference}, year = {2016}, month = {3}, day = {20}, volume = {N/A}, number = {2016}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {Th2A.46}, keywords = {Coherent communications Fiber optics communications Modulation}, web_url = {https://www.osapublishing.org/abstract.cfm?uri=OFC-2016-Th2A.46}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Optical Society of America}, address = {Washington, D.C.}, event_place = {Anaheim, California}, event_name = {Optical Fiber Communication Conference}, event_date = {20-03-2016}, language = {30}, ISBN = {978-1-943580-07-1}, ISSN = {N/A}, DOI = {10.1364/OFC.2016.Th2A.46}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dash, S. S. and Pythoud, F and Baeuerle, B and Josten, A and Hillerkuss, D and Leuchtmann, P and Leuthold, J} } @Article { , title = {What are the correct L-subshell photoionization cross sections for quantitative X-ray spectroscopy?}, journal = {X-ray Spectrometry}, year = {2016}, month = {3}, day = {16}, volume = {45}, number = {4}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {207–211}, keywords = {photoionization cross sections, xrs, fundamental parameters}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/xrs.2691/full}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {John Wiley \& Sons, Ltd}, language = {30}, ISSN = {1097-4539}, DOI = {10.1002/xrs.2691}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}nicke, P and Kolbe, M and Beckhoff, B} } @Proceedings { , title = {BER Estimation from EVM for QPSK and 16-QAM Coherent Optical Systems}, journal = {2016 IEEE 6th International Conference on Photonics (ICP)}, year = {2016}, month = {3}, day = {14}, volume = {n/a}, number = {n/a}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {1-3}, keywords = {coherent optical system, error vector magnitude, bit error rate, metrology}, web_url = {http://ieeexplore.ieee.org.ezproxy.techlib.cz/stamp/stamp.jsp?tp=\&arnumber=7510025}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Kuching, Sarawak, Malaysia}, event_name = {2016 IEEE 6th International Conference on Photonics (ICP)}, event_date = {14-16 March 2016}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/ICP.2016.7510025}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hudlička, Martin and Lundstr{\"o}m, Carl and Humphreys, David and Fatadin, Irshaad} } @Article { , title = {Coherent cancellation of photothermal noise in GaAs/Al0.92Ga0.08As Bragg mirrors}, journal = {Metrologia}, year = {2016}, month = {3}, day = {9}, volume = {53}, number = {2}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {860}, keywords = {photothermal noise, AlGaAs, laser frequency stabilization, Fabry-P{\'e}rot cavities, gravitational waves}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/2/860/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/2/860}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Chalermsongsak, T and Hall, E D and Cole, G D and Follman, D and Seifert, F and Arai, K and Gustafson, E K and Smith, J R and Aspelmeyer, M and Adhikari, R X} } @Article { KovarSLTMSHSS2016, title = {Distribution of radionuclides in an iron calibration standard for a free release measurement facility}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {96-100}, keywords = {246 kg reference standard, free release measurement facility, Distribution of radionuclides, iron calibration}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804315302396}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.11.010}, stag_bib_extends_levelofaccess = {NA}, author = {Kov{\'a}ř, P. and Šur{\'a}ň, J. and Lutter, G. and Tzika, F. and Marissens, G. and Stroh, H. and Hult, M. and Skala, L. and Sud, J.} } @Article { PacynaHJDCBBBPHBGEPF2016, title = {Importance of Integration and Implementation of Emerging and Future Mercury Research into the Minamata Convention}, journal = {Environmental Science \& Technology}, year = {2016}, month = {3}, volume = {50}, number = {6}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {2767-2770}, keywords = {Mercury, Minamata Convention,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0013-936X, 1520-5851}, DOI = {10.1021/acs.est.6b00573}, stag_bib_extends_levelofaccess = {NA}, author = {Pacyna, J. and Horvat, M. and Jaffe, D. and Driscoll, C.T. and Chen, C. and Bustamante, P. and Blum, J. and Basu, N. and Pierce, A. and Hammerschmidt, C.R. and Bank, M.S. and Gustin, M.S. and Evers, D.C. and Pirrone, N. and Fisicaro, P.} } @Article { , title = {Investigation of CVD graphene topography and surface electrical properties}, journal = {Surface Topography: Metrology and Properties}, year = {2016}, month = {2}, day = {29}, volume = {4}, number = {2}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {025001}, keywords = {graphene, Raman spectroscopy, Metrology, scanning probe microscopy techniques}, web_url = {http://iopscience.iop.org/article/10.1088/2051-672X/4/2/025001/pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {n/a}, DOI = {10.1088/2051-672X/4/2/025001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wang, R and Pearce, R and Gallop, J and Patel, T and Zhao, F and Pollard, A and Klein, N and Jackman, R and Zurutuza, A and Hao, L} } @Article { , title = {Detection of Rare Drug Resistance Mutations by Digital PCR in a Human Influenza A Virus Model System and Clinical Samples}, journal = {Journal Of Clinical Microbiology}, year = {2016}, month = {2}, day = {28}, volume = {54}, number = {2}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {392-400.}, keywords = {Digital PCR, dPCR, Droplet, Influenza, Antimicrobial Resistance, AMR, Rare, Mutation, Trace, qPCR, Quantitative PCR, SNP, Single Nucleotide Polymorphism, H275Y, Oseltamivir, Tamiflu}, web_url = {http://jcm.asm.org/content/54/2/392.long}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {American Society for Microbiology}, address = {Washington DC}, language = {30}, ISSN = {0095-1137}, DOI = {10.1128/JCM.02611-15}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Whale, A. S. and Bushell, C. and Grant, P.R. and Cowen, S. and Gutierrez-Aguirre, I. and O'Sullivan, D. M. and Zel, J. and Milavec, M. and Foy, C. A. and Nastouli, E. and Garson, J. A. and Huggett, H. F.} } @Article { , title = {Primary current-sensing noise thermometry in the millikelvin regime}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {2}, day = {22}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150054}, keywords = {noise, thermometry, PLTS-2000, SQUID, primary, uncertainty}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150054}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society Publishing}, address = {London}, language = {30}, ISSN = {1471-2962}, DOI = {10.1098/rsta.2015.0054}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-22}, author = {Shibahara, A and Hahtela, O and Engert, J and van der Vliet, H and Levitin, L V and Casey, A and Lusher, C P and Saunders, J and Drung, D and Schurig, Th} } @Article { , title = {A Novel Coordinate Measurement System Based on Frequency Scanning Interferometry}, journal = {Journal of the CMSC [reproduced in Quality Digest]}, year = {2016}, month = {2}, day = {18}, volume = {9}, number = {1 (Spring 2016)}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {6pp}, keywords = {FSI, coordinate metrology, SI, traceable}, web_url = {http://www.qualitydigest.com/inside/cmsc-article/021816-novel-coordinate-measurement-system-based-frequency-scanning\#}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Coordinate Metrology Society}, address = {Weatherford}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.qualitydigest.com/inside/cmsc-article/021816-novel-coordinate-measurement-system-based-frequency-scanning\#}, author = {Hughes, B and Campbell, M and Veal, D} } @Article { , title = {Sampling Depths, Depth Shifts and Depth Resolutions for Bin + Ion Analysis in Argon Gas Cluster Depth Profiles}, journal = {Journal of Physical Chemistry B}, year = {2016}, month = {2}, day = {17}, volume = {120}, number = {9}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {2604–2611}, web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b12697}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ACS}, address = {Washington DC}, language = {30}, DOI = {10.1021/acs.jpcb.5b12697}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-17}, author = {Havelund, R. and Seah, M.P. and Gilmore, I.S.} } @Article { TammLSHP2016, title = {Single-Ion Atomic Clock with3\(\times\)10−18Systematic Uncertainty}, journal = {Physical Review Letters}, year = {2016}, month = {2}, volume = {116}, number = {6}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, keywords = {Atomic Clock}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.116.063001}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.116.063001}, stag_bib_extends_levelofaccess = {NA}, author = {Tamm, C. and Lipphardt, B. and Sanner, C. and Huntemann, N. and Peik, E.} } @Article { , title = {A folded‑sandwich polarization‑entangled two‑color photon pair source with large tuning capability for applications in hybrid quantum systems}, journal = {Applied Physics B}, year = {2016}, month = {1}, day = {30}, volume = {122}, number = {February 2016}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {33}, keywords = {Entangled Photons Source, Quantum Hybrid Systems}, web_url = {https://link.springer.com/article/10.1007/s00340-015-6275-x}, web_url2 = {http://link.springer.com/journal/340}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer-Verlag}, address = {Berlin Heidelberg}, language = {30}, ISSN = {1432-0649}, DOI = {10.1007/s00340-015-6275-x}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dietz, O. and M{\"u}ller, C. and Krei{\ss}l, T. and Herzog, U. and Kroh, T. and Ahlrichs, A. and Benson, O.} } @Article { OzgurAHYaCCY2016, title = {Application of the differential Fabry–Perot interferometer in angle metrology}, journal = {Measurement Science and Technology}, year = {2016}, month = {1}, day = {20}, volume = {27}, number = {3}, number2 = {SIB58: Angles: Angle metrology}, pages = {035201}, keywords = {Angle metrology, Differential Fabry–Perot interferometry, small angle generators, autocollimators, Synchrotron and X-FEL optics}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/27/3/035201}, stag_bib_extends_levelofaccess = {NA}, author = {{\"O}zg{\"u}r, B. and Akg{\"o}z, A. and Hamid, R. and Yandayan, T. and Şahin, E. and \c{C}elik, M. and \c{C}etintaş, M. and Yandyan, T.} } @Article { HansenM2016_2, title = {Imaging scatterometry for flexible measurements of patterned areas}, journal = {Optics Express}, year = {2016}, month = {1}, day = {13}, volume = {24}, number = {2}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1109}, keywords = {Imaging scatterometry flexible measurements patterned areas}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.24.001109}, stag_bib_extends_levelofaccess = {NA}, author = {Hansen, P.R. and Madsen, M.H.} } @Article { , title = {Alignment-free characterization of 2D gratings}, journal = {Applied Optics}, year = {2016}, month = {1}, day = {7}, volume = {55}, number = {2}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {317-322}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-55-2-317}, misc2 = {EMPIR 2014: Industry}, publisher = {OSA Publishing}, address = {Washington}, language = {30}, DOI = {10.1364/AO.55.000317}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-1-7}, stag_bib_extends_persistent_identifier = {https://arxiv.org/ftp/arxiv/papers/1509/1509.07623.pdf}, author = {Madsen, M.H and Boher, P and Hansen, P.E and J{\o}rgensen, J.F} } @Article { VelazquezFCPH2016, title = {Zernike polynomials for photometric characterization of LEDs}, journal = {Journal of Optics}, year = {2016}, month = {1}, volume = {18}, number = {2}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {1-9}, keywords = {goniophotometry, light-emitting diodes, Zernike polynomials, photometry}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom}, language = {30}, ISSN = {2040-8978, 2040-8986}, DOI = {10.1088/2040-8978/18/2/025605}, stag_bib_extends_levelofaccess = {NA}, author = {Velazquez, J L and Ferrero, A and Campos, J and Pons, A and Hernanz, M L} } @Article { , title = {Differential phase-contrast dark-field electron holography for strain mapping}, journal = {Ultramicroscopy}, year = {2016}, month = {1}, volume = {160}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {98-109}, keywords = {Holography, Strain, Dark-field}, web_url = {http://ac.els-cdn.com/S0304399115300413/1-s2.0-S0304399115300413-main.pdf?_tid=1483b9e4-2c9c-11e6-bcb1-00000aacb360\&acdnat=1465296135_21b142ecc9403c0b9422c6e875ce4c82}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2015.10.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Denneulin, TD and Houdellier, FH and H{\"y}tch, MH} } @Article { HammererSLLS2016, title = {Quantum Algorithmic Readout in Multi-Ion Clocks}, journal = {Physical Review Letters}, year = {2016}, month = {1}, volume = {116}, number = {1}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, keywords = {Multi-Ion Clocks}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.116.013002}, stag_bib_extends_levelofaccess = {NA}, author = {Hammerer, K. and Schmidt, P. O. and Leroux, I. D. and L{\"o}rch, N. and Schulte, M.} } @Techreport { TerauchiKSBWWADGAAHUWSJKKFSBSS2016, subid = {415}, title = {Final report of CCQM-K129 'Measurement of Mole Fractions of Cu, In, Ga and Se in Cu(In,Ga)Se2 Films}, journal = {Metrologia}, year = {2016}, month = {1}, volume = {53}, number = {1A}, number2 = {14SIP05: TF-STANDARD: Developing a Standard for Valid Methodology for the Characterisation of Functional Alloy Thin Films}, pages = {08011-08011}, keywords = {CIGS, Cu(In,Ga)Se2, mole fractions, key comparison CCQM-K129}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1A/08011\&\#10;https://www.bipm.org/utils/common/pdf/final_reports/QM/K129/CCQM-K129.pdf}, misc2 = {EMPIR 2014: Support for Impact}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/1A/08011}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, A.S. and Kim, K.J. and Jang, J.S. and Suh, J.K. and Wirth, T. and Unger, W. and Hodoroaba, V.D. and Araujo, J.R. and Archanjo, B.S. and Galhardo, C.E. and Damasceno, J. and Achete, C.A. and Wang, H. and Wang, M. and Bennett, J. and Simon, D. and Kurokawa, A. and Terauchi, S. and Fujimoto, T. and Streeck, C. and Beckhoff, B. and Spencer, S. and Shard, A.} } @Article { , title = {Repeatability and reproducibility of specular gloss meters in theory and practice}, journal = {Journal of Coatings Technology and Research}, year = {2016}, volume = {13}, number = {6}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {941-951}, keywords = {Specular gloss, Gloss meter, Interinstrument agreement}, web_url = {http://link.springer.com/article/10.1007/s11998-016-9813-5}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {American Coatings Association}, address = {Washington, DC20001}, language = {30}, ISBN = {1935-3804}, ISSN = {1547-0091}, DOI = {10.1007/s11998-016-9813-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-12-1}, author = {Leloup, F. B. and Audenaert, J. and Obein, G. and Ged, G. and Hanselaer, P.} } @Article { , title = {Estimates of the difference between thermodynamic temperature and the ITS-90 in the range 118 K to 303 K}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {16}, keywords = {primary thermometry, acoustic gas thermometry, ITS-90}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society Publishing}, address = {London}, language = {30}, ISSN = {1364-503X}, DOI = {10.1098/rsta.2015.0048}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Underwood, R and de Podesta, M and Sutton, G and Stanger, L and Rusby, R and Harris, P and Morantz, P and Machin, G} } @Proceedings { , title = {Measurement of goniofluorescence in photoluminiscent materials}, journal = {CIE Proceeding}, year = {2016}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, keywords = {Goniofluorescence, fluorescence, photoluminescence, spectrophotometry}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {International Comission on Illumination}, address = {Serrano 144}, event_place = {Manchester/UK}, event_name = {28th Session CIE}, event_date = {June 28 - July 4, 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferrero, A and Bernad, B and Velazquez, J L and Pons, A and Hernanz, M L and Jaanson, P and Martinez-Verdu, F M and Chorro, E and Perales, E and Campos, J} } @Proceedings { , title = {The Propagation Constant of Coaxial Offset Shorts with Rough Surfaces}, journal = {CPEM 2014 Digest}, year = {2016}, volume = {2014}, number = {2014}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {14-15}, keywords = {attenuation constant, calibration, offset short, phase constant, propagation constant, vector network analyzer}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {n/a}, event_place = {Rio de Janeiro, Brazil}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {25-08-2014 to 29-08-2014}, language = {30}, ISBN = {978-1-4799-5205-2}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898235}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Hoffmann, J and Ruefenacht, J and Zeier, M} } @Proceedings { , title = {Comparison of methods for measurement of equivalent source match}, journal = {Proceedings of the 45th European Microwave Conference}, year = {2016}, volume = {2015}, number = {2015}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {730-733}, keywords = {Vector Network Analyzer, splitter, equivalent source match, calibration standard, connector}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {n/a}, event_place = {Paris, France}, event_name = {European Microwave Conference}, event_date = {07-09-2015 to 10-09-2015}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/EuMC.2015.7345867}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hoffmann, J and Wollensack, M and Ruefenacht, J and Zeier, M} } @Article { , title = {Extended S-parameters for imperfect test ports}, journal = {Metrologia}, year = {2016}, volume = {52}, number = {1}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {121-129}, keywords = {vector network analyzer, S-parameter, connector}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP}, address = {n/a}, language = {30}, ISSN = {n/a}, DOI = {10.1088/0026-1394/52/1/121}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-19}, author = {Hoffmann, J and Wollensack, M and Ruefenacht, J and Zeier, M and Zeier, Markus} } @Article { , title = {Fundamental aspects of Arn+ SIMS profiling of common organic semiconductors}, journal = {Surface and Interface Analysis}, year = {2016}, volume = {1}, number = {46}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {54-57}, keywords = {depth profiling, sputter yield, ion yield, matrix effect, OPV, P3HT, PCDTBT, PCBM}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5621/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Wiley Online Library}, address = {New Jersey NYC}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.5621}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Fleischmann, C. and Conard, T. and Havelund, R. and Franquet, A. and Poleunis, C. and Voroshazi, E. and Delcorte, A. and Vandervorst, W.} } @Article { , title = {Towards a dosimetric framework for therapeutic ultrasound}, journal = {International Journal of Hyperthermia}, year = {2016}, volume = {31}, number = {2}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {182-192}, keywords = {High intensity focused ultrasound, modelling, quality assurance, thermal ablation, ultrasound}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Taylor and Francis}, address = {Abingdon, UK}, language = {30}, ISSN = {0265-6736}, DOI = {10.3109/02656736.2014.997311}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaw, A and ter Haar, G and Haller, J and Wilkens, V} } @Article { , title = {Qualifying label components for effective biosensing by advanced high-throughput SEIRA methodology}, journal = {Physical Chemistry Chemical Physics}, year = {2016}, volume = {17}, number = {14}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {9471-9}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-22-15-17948}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Royal Society of Chemistry}, address = {Piccadilly London}, language = {30}, ISSN = {1463-9076}, DOI = {10.1039/c4cp05944a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Hornemann, A and Eichert, D and Flemig, S and Ulm, G and Beckhoff, B} } @Article { , title = {Annihilation of structural defects in chalcogenide absorber films for high-efficiency solar cells}, journal = {Energy \& Environmental Science}, year = {2016}, volume = {9}, number = {5}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1818-1827}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, XRD, XRF, in-situ, planar defects, TEM}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {1754-5692}, DOI = {10.1039/c6ee00402d}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-18}, author = {Mainz, R. and Simsek Sanli, E. and Stange, H. and Azulay, D. and Brunken, S. and Greiner, D. and Hajaj, S. and Heinemann, M. D. and Kaufmann, C. A. and Klaus, M. and Ramasse, Q. M. and Rodriguez-Alvarez, H. and Weber, A. and Balberg, I. and Millo, O. and van Aken, P. A. and Abou-Ras, D.} } @Article { , title = {The application of a Cavity Ring-Down Spectrometer to measurements of ambient ammonia using traceable Primary Standard Gas Mixtures}, journal = {Applied Physics B Lasers and Optics}, year = {2016}, volume = {122}, number = {219}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {Not Applicable}, keywords = {ammonia, cavity ring-down spectroscopy, collisional broadening, cross interference, Primary Standard Gas Mixtures, gravimetry}, web_url = {http://link.springer.com/article/10.1007/s00340-016-6486-9}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer}, address = {Chennai}, language = {30}, ISSN = {Not Applicable}, DOI = {10.1007/s00340-016-6486-9}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Martin, N A and Ferracci, V and Cassidy, N and Hoffnagle, J A} } @Article { , title = {Equipment, measurement and dose—a survey for therapeutic ultrasound}, journal = {Journal of Therapeutic Ultrasound}, year = {2016}, volume = {4}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {7}, keywords = {Therapeutic ultrasound, Dosimetry, Exposimetry, Survey}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {BioMed Central}, address = {London}, language = {30}, ISSN = {2050-5736}, DOI = {10.1186/s40349-016-0051-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaw, A and Martin, E and Haller, J and ter Haar, G} } @Proceedings { LiDHRVAR2016, subid = {80}, title = {Development of a Reference Wafer for On-wafer Testing of Extreme Impedance Devices}, journal = {IEEE XPlore}, year = {2016}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Standards, Calibration, Impedance, Nanoscale devices, Impedance measurement, Probes, Transmission line measurements, extreme impedance measurement, Calibration, on-wafer measurement, nano-scale, co-planar waveguide, RF nanotechnology}, web_url = {http://epubs.surrey.ac.uk/813783/1/Votsi_88th_ARFTG_Paper_Summary\%20\%28002\%29.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, address = {USA \& Canada}, event_place = {Austin, TX, USA}, event_name = {Microwave Measurement Conference (ARFTG)}, event_date = {08-12-2016 to 09-12-2016}, language = {30}, DOI = {10.1109/ARFTG.2016.7839719}, stag_bib_extends_levelofaccess = {NA}, author = {Votsi, H. and Roch-Jeune, I. and Haddadi, K. and Li, C. and Dambrine, G. and Aaen, P.H. and Ridler, N.} } @Article { , title = {Doppler-free spectroscopy on Cs D 1 line with a dual-frequency laser}, journal = {Optics letters}, year = {2016}, volume = {41}, number = {13}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {2982-2985}, keywords = {CPT, vapor cell,frequency stability}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-13-2982}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {OSA}, address = {Washington}, language = {30}, ISSN = {0146-9592}, DOI = {10.1364/OL.41.002982}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-13-2982}, author = {Hafiz, M A and Coget, G and de Clercq, E and Boudot, R} } @Article { , title = {Experimental determination of (p, \(\rho\), T) data for binary mixtures of methane and helium}, journal = {Journal of Chemical Thermodynamics}, year = {2016}, volume = {96}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {1–11}, keywords = {methane; helium; natural gas thermodynamic characterization; density; single-sinker densimeter; GERG-2008 equation of state}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0021-9614}, DOI = {10.1016/j.jct.2015.12.006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hern{\'a}ndez-G{\'o}mez, R. and Tuma, D. and Segovia, J.J. and Chamorro, C.R.} } @Article { , title = {Accurate experimental (p, \(\rho\), T) data and virial coefficients for the (methane and helium) binary system}, journal = {Journal of Chemical Thermodynamics}, year = {2016}, volume = {101}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {168-179}, keywords = {methane; helium; natural gas thermodynamic characterization; density; single-sinker densimeter; GERG-2008 equation of state}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0021-9614}, DOI = {10.1016/j.jct.2016.05.024}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hern{\'a}ndez-G{\'o}mez, R. and Tuma, D. and Villama{\~n}{\'a}n, R. and Chamorro, C.R.} } @Proceedings { , title = {A Comparison of the Josephson Impedance Bridges of PTB and SP}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest}, year = {2016}, volume = {n / a}, number = {n / a}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {7540584 (2 pp.)}, keywords = {Impedance bridge, Josephson array, Josephson impedance bridge, Josephson voltage standard.}, web_url = {http://ieeexplore.ieee.org/document/7540584/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {Electronic ISSN: 2160-0171}, DOI = {10.1109/CPEM.2016.7540584}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540584/}, author = {Eklund, G and Bergsten, T and Hagen, T and Palafox, L and Behr, R} } @Proceedings { , title = {Moisture measurement setup for wood based materials and biomasses}, journal = {International Congress of Metrology 08008 (2015)}, year = {2016}, volume = {International Congress of Metrology 08008 (2015)}, number = {International Congress of Metrology 08008 (2015)}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {4}, keywords = {moisture, biomass, loss-on-drying, SI traceability}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08008.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {17th International Congress of Metrology, 08008 (2015)}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/20150008008}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ojanen-Saloranta, M. and Sairanen, H. and Salminen, J. and Kajastie, H. and Heinonen, M.} } @Proceedings { , title = {New Approach for Measuring Moisture in Solids Using Radio Frequency and Microwave}, journal = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances}, year = {2016}, volume = {11th}, number = {2016}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {297}, keywords = {dielectric permittivity, capacitive cell, coaxial cell, moisture measurement}, web_url = {http://www.isema2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Edifir-Edizioni}, address = {Firenze}, event_place = {Firenze (Italy)}, event_name = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances}, event_date = {23-05-2016 to 27-05-2016}, language = {30}, ISBN = {978-88-7970-800-5}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ben Ayoub, MW and Georgin, E and Rochas, J F and Hubert, S and Achard, P and Neves, L and Sabouroux, P} } @Proceedings { , title = {First metrological applications of the PTB 1 V Josephson Arbitrary Waveform Synthesizer}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {153}, keywords = {Josephson arbitrary waveform synthesizer comparison thermal converter ac-dc transfer difference}, web_url = {http://ieeexplore.ieee.org/document/7540602/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, DOI = {10.1109/CPEM.2016.7540602}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Palafox, L and Behr, R and Kieler, O and Lee, J and Budovsky, I and Bauer, S and Hagen, T} } @Proceedings { , title = {Systematic Error Analysis in a Josephson Impedance Bridges}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {179}, keywords = {impedance, Josephson array, programmable Josephson system, Bridge circuits, Impedance, Uncertainty, Transient analysis, Standards, Measurement uncertainty, Timing}, web_url = {http://ieeexplore.ieee.org/document/7540627/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540627}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540627/}, author = {Hagen, T and Palafox, L and Behr, R} } @Proceedings { , title = {Comparison of the frequency dependence of capacitance ratios between LNE and PTB}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, keywords = {Impedance bridge, Josephson array, Josephson impedance bridge}, web_url = {http://ieeexplore.ieee.org/document/7540585/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540585}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Hagen, T and Th{\'e}venot, O and S{\'e}ron, O and Khan, S and Palafox, L and Behr, R} } @Proceedings { , title = {Implementation of an impedance bridge based on pulse-driven Josephson arrays for arbitrary impedance ratios and phase angles}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, keywords = {Bridge circuits, Impedance, Impedance measurement, Frequency measurement, Temperature measurement, Resistors, Standards}, web_url = {http://ieeexplore.ieee.org/document/7540626/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540626}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Bauer, S and Behr, R and Hagen, T and Kieler, O and Palafox, L and Schurr, J} } @Article { AlacaOLHWT2016, subid = {922}, title = {Determination of the Elastic Behavior of Silicon Nanowires within a Scanning Electron Microscope}, journal = {Journal of Nanomaterials}, year = {2016}, volume = {2016}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {1-6}, keywords = {Elastic Behavior of Silicon Nanowires}, web_url = {https://www.hindawi.com/journals/jnm/2016/4905838/}, misc2 = {EMPIR 2014: Industry}, publisher = {Hindawi Limited}, language = {30}, ISSN = {1687-4110, 1687-4129}, DOI = {10.1155/2016/4905838}, stag_bib_extends_levelofaccess = {NA}, author = {Wollschl{\"a}ger, N. and Tasdemir, Z. and H{\"a}usler, I. and Leblebici, Y. and {\"O}sterle, W. and Alaca, B.E.} } @Article { , title = {In vivo synthesized 34S enriched amino acid standards for species specific isotope dilution of proteins}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, volume = {2016}, number = {31}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1830-1835}, keywords = {characterization of protein standards,protein hydrolysis, amino acid quantification,species specific isotope dilution analysis (IDA),Reverse isotope dilution mass spectrometry (IDMS),plasma mass spectrometry (ICP-MS),cysteic acid,methionine sulfone, lysozyme standards, ceruloplasmin standards}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {The Royal Society of Chemistry}, address = {Cambridge, United Kingdom}, language = {30}, DOI = {10.1039/c6ja00039h}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hermann, Gerrit and Hyrup M{\o}ller, Laura and Gammelgaard, Bente and Hohlweg, Jonas and Mattanovich, Diethard and Hann, Stephan and Koellensperger, Gunda} } @Proceedings { , title = {Investigation of UV-Induced Degradation of Different Types of WPVS Reference Solar Cells}, journal = {Proceedings of the 32nd European PV Solar Energy Conference and Exhibition ( 32nd EU PVSEC)}, year = {2016}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {2277 - 2281}, keywords = {Calibration, Degradation, Encapsulation, Durability, Characterisation, Characterization}, web_url = {https://www.eupvsec-proceedings.com/proceedings?paper=37311}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Munich, Germany}, event_name = {32nd European Photovoltaic Solar Energy Conference and Exhibition (EU PVSEC 2016)}, event_date = {20-24 June 2016}, language = {30}, ISBN = {3-936338-41-8}, DOI = {10.4229/EUPVSEC20162016-5BV.4.34}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kroeger, I. and Hohl-Ebinger, J. and Brachmann, S. and Winter, S.} } @Article { , title = {Metrological challenges for measurements of key climatological observables: oceanic salinity and pH, and atmospheric humidity. Part 1: overview}, journal = {Metrologia}, year = {2016}, volume = {53}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {R1-R11}, keywords = {seawater salinity, seawater pH, relative humidity, traceability}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1/R1}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Physics}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/1/R1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Feistel, R and Wielgosz, R and Bell, S A and Cam{\~o}es, M F and Cooper, J R and Dexter, P and Dickson, A G and Fisicaro, P and Harvey, A H and Heinonen, M and Hellmuth, O and Kretzschmar, H-J and Lovell-Smith, J W and McDougall, T J and Pawlowicz, R and Ridout, P and Seitz, S and Spitzer, P and Stoica, D and Wolf, H} } @Article { , title = {Metrological challenges for measurements of key climatological observables. Part 4: atmospheric relative humidity}, journal = {Metrologia}, year = {2016}, volume = {53}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {R40–R59}, keywords = {relative humidity, meteorology, metrology, IAPWS, BIPM, definitions, climate}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1/R40/meta}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Physics}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/1/R40}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lovell-Smith, J W and Feistel, R and Harvey, A H and Hellmuth, O and Bell, S A and Heinonen, M and Cooper, J R} } @Article { , title = {Integration of biogas in the natural gas grid: thermodynamic characterisation of a biogas-like mixture}, journal = {Journal of Chemical Thermodynamics}, year = {2015}, month = {12}, day = {28}, volume = {84}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {60-66}, keywords = {biogas; thermodynamic characterization; density; single sinker densimeter; GERG- 2008}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.jct.2014.12.028}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hernandez-Gomez, R. and Fernandez-Vicente, T. E. and Martin Gonzalez, M. C. and Modejar, M. E. and Chamorro, C. R.} } @Article { , title = {PERIODICITY ANALYSIS OF GAMMA RADIATION MEASUREMENTS IN THESSALONIKI, NORTHERN GREECE, IN THE PERIOD 1988–2015}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {12}, day = {24}, volume = {Radiation Protection Dosimetry 2015; doi: 10.1093/rpd/ncv513}, number = {Radiation Protection Dosimetry 2015; doi: 10.1093/rpd/ncv513}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {not available (advance access)}, keywords = {Time series analysis , Gamma radiation measurements, Periodicity analysis}, web_url = {http://rpd.oxfordjournals.org/content/early/2015/12/23/rpd.ncv513.abstract}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Oxford University Press (OUP)}, address = {Oxford}, language = {30}, ISSN = {Online ISSN 1742-3406 - Print ISSN 0144-8420}, DOI = {10.1093/rpd/ncv513}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {CLOUVAS, A and LEONTARIS, F and XANTHOS, S and HADGILEONTIADIS, L} } @Article { , title = {A multi-thermogram-based Bayesian model for the determination of the thermal diffusivity of a material}, journal = {Metrologia}, year = {2015}, month = {12}, day = {16}, volume = {53}, number = {1}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {1-9}, keywords = {inverse problem, Bayesian framework, Metropolis–Hastings, measurement uncertainty, prior distributions, thermal diffusivity}, tags = {MAT}, web_url = {-}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {BIPM}, address = {S{\`e}vres}, language = {30}, ISSN = {-}, DOI = {10.1088/0026-1394/53/1/S1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Allard, A. and Fischer, N. and Ebrard, G. and Hay, B. and Harris, P. and Wright, L. and Rochals, D. and Mattout, J.} } @Article { , title = {High accuracy experimental determination of copper and zinc mass attenuation coe cients in the 100 eV to 30 keV photon energy range}, journal = {Metrologia}, year = {2015}, month = {12}, day = {15}, volume = {53}, number = {1}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1-13}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1/7/meta}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/1/7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-15}, author = {M{\'e}nesguen, YM and Gerlach, MG and Pollakowski, BP and Unterumsberger, RU and Haschke, MH and Beckhoff, BB and L{\'e}py, MCL} } @Article { , title = {Traceable methods for vertical scale characterization of dynamic stroboscopic scanning white-light interferometer measurements}, journal = {Applied Optics}, year = {2015}, month = {12}, day = {9}, volume = {54}, number = {35}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {10397-10403}, keywords = {Stroboscopic scanning white-light interferometry (SSWLI),3D imaging of oscillating samples,Traceability of the vertical displacement measurement, metrology, uncertainties}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-54-35-10397}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {OSA Publishing}, address = {Washington, D.C.}, language = {30}, ISSN = {n/a}, DOI = {10.1364/AO.54.010397}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-9}, author = {Heikkinen, V and Kassmakov, I and Sepp{\"a}, J and Paulin, T and Nolvi, A and Lassila, A and H{\ae}ggstr{\"o}m, E} } @Article { , title = {How to efficiently characterize special effect coatings}, journal = {Journal of the Optical Society of America A}, year = {2015}, month = {12}, day = {3}, volume = {33}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1-8}, keywords = {Metrology, BSDF, BRDF, BTDF, Color measurement, Color vision, and Colorimetry}, web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-33-1-1}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Optical Society of America}, address = {Washington, D.C.}, language = {30}, ISSN = {1084-7529}, DOI = {10.1364/JOSAA.33.000001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Strothk{\"a}mper, C. and Hauer, K.-O. and H{\"o}pe, A.} } @Proceedings { , title = {Performance assessment of VNA calibration schemes for millimeter-wave and submillimeter-wave frequencies, using the 33 GHz - 50 GHz band}, journal = {Proc. of the 86th Microwave Measurement Conference (ARFTG)}, year = {2015}, month = {12}, day = {3}, volume = {86}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-8}, keywords = {Vector network analyzer, Calibration method, millimeter wave}, web_url = {ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7381470}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Atlanta, Georgia, USA}, event_name = {86th Microwave Measurement Conference (ARFTG)}, event_date = {3-4 December 2015}, language = {30}, ISBN = {978-1-4673-9246-4}, ISSN = {n/a}, DOI = {10.1109/ARFTG.2015.7381470}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7381470}, author = {Dražil, Karel and Pavliš, Adam and Hudlička, Martin} } @Proceedings { , title = {Calibration/Verification Standards for Measurement of Extremely High Impedances}, journal = {Proc. of the 86th Microwave Measurement Conference (ARFTG)}, year = {2015}, month = {12}, day = {3}, volume = {86}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {CST, High impedances, HFSS, Higher order modes, Measurement standards, Microwave connectors, Resistors, Scanning microwave microscopy, Thin film devices}, web_url = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=7381474}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Atlanta, Georgia, USA}, event_name = {86th Microwave Measurement Conference (ARFTG)}, event_date = {3-4 December 2015}, language = {30}, ISBN = {978-1-4673-9246-4}, ISSN = {n/a}, DOI = {10.1109/ARFTG.2015.7381474}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=7381474}, author = {Haase, Martin and Hoffmann, Karel} } @Article { , title = {Microwave method for high-frequency properties of graphene}, journal = {IET Circuits, Devices and Systems}, year = {2015}, month = {12}, day = {3}, volume = {9}, number = {6}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {397 - 402}, keywords = {graphere, metrology,}, web_url = {http://ieeexplore.ieee.org/document/7339730/}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York City}, language = {30}, ISSN = {1751-858X}, DOI = {10.1049/iet-cds.2015.0114}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-3}, author = {Hao, L and Gallop, J and Liu, Q and Chen, J} } @Article { , title = {Self-supporting graphene films and their applications}, journal = {IET Circuits, Devices \& Systems}, year = {2015}, month = {12}, day = {3}, volume = {9}, number = {6}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {420 - 427}, keywords = {thermal properties, atomic force microscopy, chemical vapour deposition, copper, foils, graphene, mechanical properties, micromechanical resonators, monolayers, scanning electron microscopy}, web_url = {http://ieeexplore.ieee.org/document/7339736/}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York CIty}, language = {30}, ISSN = {1751-858X}, DOI = {10.1049/iet-cds.2015.0149}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-3}, author = {Goniszewski, S and Gallop, J and Adabi, M and Gajewski, K and Shaforost, E and Klein, N and Sierakowski, A and Chen, J and Gotszalk, T and Chen, Y and Hao, L} } @Article { SterrHDAL2015, title = {Noise and instability of an optical lattice clock}, journal = {Physical Review A}, year = {2015}, month = {12}, volume = {92}, number = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {063814}, keywords = {time and frequency metrology, optical lattice clock, ultra-stable laser, stability}, web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.92.063814}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {1050-2947, 1094-1622}, DOI = {10.1103/PhysRevA.92.063814}, stag_bib_extends_levelofaccess = {NA}, author = {Sterr, U. and H{\"a}fner, S. and D{\"o}rscher, S. and Al-Masoudi, A. and Lisdat, C.} } @Article { SmerziSHAEPLKLPK2015, title = {Satisfying the Einstein–Podolsky–Rosen criterion with massive particles}, journal = {Nature Communications}, year = {2015}, month = {11}, day = {27}, volume = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {8984}, keywords = {quantum mechanics, entanglement, heisenberg limit}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms9984}, stag_bib_extends_levelofaccess = {NA}, author = {Smerzi, A. and Santos, L. and Hammerer, K. and Arlt, J. and Ertmer, W. and Pezz{\`e}, L. and L{\"u}cke, B. and Kruse, I. and Lange, K. and Peise, J. and Klempt, C.} } @Proceedings { FerreroVHCP2015, title = {Photometric Characterization Of Extended Sources By Subsource Goniospectroradiometry}, journal = {Proceedings of the CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, year = {2015}, month = {11}, day = {26}, volume = {1}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {24-33}, keywords = {GONIOSPECTRORADIOMETRY, OLED, photometry, near-field, sub-source}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Commission Internationale de L'Eclairage}, address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A, 1010 Vienna, Austria}, event_place = {Braunschweig, Germany}, event_name = {CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, event_date = {26-11-2015 to 26-11-2015}, language = {30}, ISBN = {978-3-902842-28-2}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Vel{\'a}zquez, J.L. and Hernanz, M.L. and Campos, J. and Pons, A.} } @Article { , title = {Silicon double spring for the simultaneous calibration of probing forces and deflections in the micro range}, journal = {Measurement Science and Technology}, year = {2015}, month = {11}, day = {24}, volume = {27}, number = {2016}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {015601 / 9 pp}, keywords = {double spring, probing force calibration, bending force, bending deflection, stiffness}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing Ltd.}, address = {UK}, language = {30}, DOI = {10.1088/0957-0233/27/1/015601}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brand, U. and Li, Z. and Gao, S. and Hahn, S. and Hiller, K.} } @Article { , title = {A clock network for geodesy and fundamental science}, journal = {Nature Communication}, year = {2015}, month = {11}, day = {24}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, web_url = {arxiv.org/abs/1511.07735}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and D{\"o}rscher, S. and H{\"a}fner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G.} } @Article { HogstromLSH2015, title = {Comsol Simulations as a Tool in Validating a Measurement Chamber}, journal = {International Journal of Thermophysics}, year = {2015}, month = {11}, day = {23}, volume = {36}, number = {12}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {3474-3486}, keywords = {Adsorption, Fluid flow, Mass transfer, Numerical simulation, Radiosonde}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-015-2000-6}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}gstr{\"o}m, R. and Lakka, A. and Sairanen, H. and Heinonen, M.} } @Article { , title = {Thermoelectric properties of currently available Au/Pt thermocouples related to the valid reference function}, journal = {Int. J. Metrol. Qual. Eng.}, year = {2015}, month = {11}, day = {23}, volume = {6}, number = {3}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {303}, keywords = {Au/Pt thermocouple, reference function, temperature scale}, web_url = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Dr. A. CHARKI}, address = {EDP Sciences - France 17, Avenue du Hoggar Parc d'Activit{\'e} de Courtabœuf BP 112 91944 Les Ulis Cedex A France}, language = {30}, DOI = {10.1051/ijmqe/2015016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, author = {Edler, F. and Arifovic, N. and Atance, G. and Dinu, C. and Elliott, C. J. and Izquierdo, C. G. and Hodzic, N. and Kalisz, S. and Pearce, J.V. and Simic, S. and Strnad, R. and Taubert, D.} } @Article { , title = {A tutorial on Bayesian Normal linear regression}, journal = {Metrologia}, year = {2015}, month = {11}, day = {18}, volume = {52}, number = {6}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {878 - 892}, keywords = {Bayesian inference, prior knowledge, conjugate prior distribution, linear regression, Normal inverse Gamma distribution, Gaussian measurement error, sonic nozzle calibration}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/6/878/meta}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {BIPM}, address = {S{\`e}vres}, language = {30}, ISSN = {-}, DOI = {10.1088/0026-1394/52/6/878}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klauenberg, K. and Wuebbeler, G. and Mickan, B. and Harris, P. and Elster, C.} } @Article { SourgenCBDJSH2015, title = {Submillimetre thermistors for balloon-borne applications up to lower stratosphere: preliminary characterization with 0.02 K uncertainty}, journal = {Meteorological Applications}, year = {2015}, month = {11}, day = {18}, volume = {22}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {836-841}, keywords = {calibration; thermistors; uncertainty; stratosphere; metrological characterization}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Wiley}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1504}, stag_bib_extends_levelofaccess = {NA}, author = {Sourgen, D. and Coeur-Joly, G. and Bordereau, J. and Deuz{\'e}, T. and Jouin, D. and Sparasci, F. and Hertzog, A.} } @Article { , title = {Analysis of thermal radiation in ion traps for optical frequency standards}, journal = {Metrologia}, year = {2015}, month = {11}, day = {12}, volume = {52}, number = {6}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {842-856}, keywords = {blackbody radiation shift, ion traps, optical atomic clocks, ion clocks, thermal and high frequency finite element method modelling}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/6/842}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, BIPM}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/52/6/842}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Doležal, M and Balling, P and Nisbet-Jones, P B R and King, S A and Jones, J M and Klein, H A and Gill, P and Lindvall, T and Wallin, A E and Merimaa, M and Tamm, C and Sanner, C and Huntemann, N and Scharnhorst, N and Leroux, I D and Schmidt, P O and Burgermeister, T and Mehlst{\"a}ubler, T E and Peik, E} } @Article { , title = {Inter-comparison of halocarbons in an atmospheric dry whole air sample}, journal = {Elementa}, year = {2015}, month = {11}, day = {3}, volume = {3}, number = {N/A}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {N/A}, keywords = {None supplied}, web_url = {https://www.elementascience.org/articles/75}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {BioOne}, address = {Washington DC}, language = {30}, ISSN = {2325-1026}, DOI = {10.12952/journal.elementa.000075}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rhoderick, G C and Hall, B D and Harth, C M and Kim, J S and Lee, J and Montzka, S A and Muhle, J and Reimann, S and Vollmer, M K and Weiss, R F} } @Techreport { , title = {Global Geodetic Observing System (GGOS) Requirements for Core Sites}, journal = {CDDIS: NASA's Archive of Space Geodesy Data}, year = {2015}, month = {11}, day = {1}, volume = {Revision 2}, number = {Draft 3.4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {GNSS, SLR, DORIS, VLBI, global network}, web_url = {http://cddis.gsfc.nasa.gov/docs/2015/SiteRecDoc_Rev2_D3.4.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {NASA Goddard Space Flight Center}, address = {Greenbelt}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Appleby, G. and Behrend, D. and Bergstrand, S. and Donovan, H. and Emerson, C. and Esper, J. and Hase, H. and Long, J. and Ma, C. and McCormick, D. and Noll, C. and Pavlis, E. and Ferrage, P. and Pearlman, M. and Saunier, J. and Stowers, D. and Wetzel, S.} } @Article { , title = {Alignment position method for SPAD detector calibration and homogeneity}, journal = {International Journal of Scientific Reports}, year = {2015}, month = {11}, volume = {1}, number = {7}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {271-274}, keywords = {SPAD detector, Detection efficiency, Alignment position, Homogeneity}, web_url = {http://www.sci-rep.com/index.php/scirep}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Medip Academy}, address = {Ahmedabad}, language = {30}, ISSN = {2454-2156}, DOI = {10.18203/issn.2454-2156.IntJSciRep20151253}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dhoska, K. and Hofer, H. and Lopez, M. and K{\"u}barsepp, T. and K{\"u}ck, S.} } @Article { , title = {Online validation of Chebyshev geometric element algorithms using the TraCIM system}, journal = {Journal of Mechanical Engineering and Automation}, year = {2015}, month = {11}, volume = {5}, number = {3}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {94-111}, keywords = {Chebyshev, Minimum-Zone, TraCIM, Software Validation, Geometrical Elements, Coordinate Metrology}, tags = {MAT}, web_url = {http://article.sapub.org/10.5923.j.jmea.20150503.02.html}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Scientific \& Academic Publishing (SAP)}, address = {Rosemead}, language = {30}, ISSN = {2163-2413}, DOI = {10.5923/j.jmea.20150503.02}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hutzschenreuter, DH and H{\"a}rtig, FH and Wendt, KW and Lunze, UL and L{\"o}we, HL} } @Article { , title = {Effect of Na presence during CuInSe2 growth on stacking fault annihilation and electronic properties}, journal = {Applied Physics Letters}, year = {2015}, month = {10}, day = {14}, volume = {107}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {152103}, keywords = {Stacking faults, Cu(In,Ga)Se2, thin films, solar cells, XRD, GIXRD, GDOES, grain growth, optical pump terahertz probe spectroscopy}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {AIP Publishing LLC}, address = {College Park}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4933305}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Stange, H. and Brunken, S. and Hempel, H. and Rodriguez-Alvarez, H. and Sch{\"a}fer, N. and Greiner, D. and Scheu, A. and Lauche, J. and Kaufmann, C. A. and Unold, T. and Abou-Ras, D. and Mainz, R.} } @Article { , title = {Sudden stress relaxation in compound semiconductor thin films triggered by secondary phase segregation}, journal = {Physical Review B}, year = {2015}, month = {10}, day = {12}, volume = {92}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {155310}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, stress relaxation, recrystallization, grain growth, in-situ, XRD, XRF}, web_url2 = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.155310}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Physical Society}, address = {College Park}, language = {30}, ISSN = {2469-9969}, DOI = {10.1103/PhysRevB.92.155310}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mainz, R. and Rodriguez-Alvarez, H. and Klaus, M. and Thomas, D. and Lauche, J. and Weber, A. and Heinemann, M. D. and Brunken, S. and Greiner, D. and Kaufmann, C. A. and Unold, T. and Schock, H.-W. and Genzel, C.} } @Article { , title = {ToF-SIMS analysis of a polymer microarray composed of poly(meth)acrylates with C6 derivative pendant groups}, journal = {Surface and interface Analysis}, year = {2015}, month = {10}, day = {11}, volume = {48}, number = {4}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {19th January 2016}, keywords = {surface analysis; polymer microarray; multivariate analysis; high-throughput surface characterisation}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5959/pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wiley}, address = {Hoboken}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.5959}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Hook, A.L and Scurr, D.J} } @Article { , title = {Domain wall magneto-Seebeck effect}, journal = {Physical Review B}, year = {2015}, month = {10}, day = {6}, volume = {92}, number = {14}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {140405}, keywords = {Spincaloritronics, magnetic domain wall, spin-Seebeck}, web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.140405}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {New York}, language = {30}, ISSN = {1098-0121}, DOI = {10.1103/PhysRevB.92.140405}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Krzysteczko, P. and Hu, X. and Liebing, N. and Sievers, S. and Schumacher, H. W.} } @Article { , title = {Simultaneous dynamic electrical and structural measurements of functional materials}, journal = {Review of Scientific Instruments}, year = {2015}, month = {10}, day = {5}, volume = {83}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {103901}, keywords = {Piezoelectric fields, Interferometers, Ferroelectric materials, Polarization, Diffractometers}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/86/10/10.1063/1.4931992}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {0034-6748}, DOI = {10.1063/1.4931992}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vecchini, CV and Thompson, PT and Stewart, MS and Muniz-Piniella, AMP and McMitchell, SRCM and Wooldridge, JW and Lepadatu, SL and Bouchenoire, LB and Brown, SB and Wermeille, DW and Bikondoa, OB and Lucas, CAL and Hase, TH and Lesourd, ML and Dontsov, DD and Cain, MGC} } @Proceedings { , title = {NON-INVASIVE TEMPERATURE ESTIMATION ON TMM BASED ON THE ECHO-SHIFT METHOD}, journal = {Proceedings of the 46th Spanish Congress on Acoustics.}, year = {2015}, month = {10}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1.609-1.616}, keywords = {Ultrasound, Diagnostic, Temperature measurement}, web_url = {http://www.sea-acustica.es}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Sociedad Espa{\~n}ola de Ac{\'u}stica}, address = {Madrid}, event_place = {Valencia (Spain)}, event_name = {46th Spanish Congress on Acoustics}, event_date = {21-23 October 2015}, language = {30}, ISSN = {2340-7441 (Digital version)}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.congresotecniacustica.info/Fchrs/Publicacion Oficial Congreso.pdf}, author = {Chinchurreta, F and Hekkenhberg, R} } @Article { , title = {Secondary ionisations in a wall-less ion-counting nanodosimeter: quantitative analysis and the effect on the comparison of measured and simulated track structure parameters in nanometric volumes.}, journal = {The European Physical Journal D}, year = {2015}, month = {10}, volume = {69}, number = {239}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {1-18}, keywords = {Nanodosimetry, track structure, Monte Carlo}, web_url = {http://link.springer.com/article/10.1140\%2Fepjd\%2Fe2015-60176-6}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {EDP Sciences}, address = {Orsay}, language = {30}, ISSN = {1434-6060 (print) ; 1434-6079 (online)}, DOI = {10.1140/epjd/e2015-60176-6}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hilgers, G. and Bug, M. and Gargioni, E. and Rabus, H.} } @Proceedings { , title = {Metrology for MRI Safety}, year = {2015}, month = {9}, day = {21}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://cfmetrologie.edpsciences.org}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {EDP Sciences}, address = {Les Ulis}, event_place = {Paris, France}, event_name = {17th International Congress of Metrology}, event_date = {September 21-24, 2015}, language = {30}, DOI = {10.1051/metrology/20150009001}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ittermann, B and Bottauscio, O and Hand, J and de Pooter, J and de Prez, L and Rabus, H and Seifert, F and Szymanowski, H and Weidemann, G and Zilberti, L} } @Article { , title = {METefnet: developments in metrology for moisture in materials}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15003}, keywords = {Development - Moisture in materials}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bell, S and Aro, A and Arpino, F and Aytekin, S and Cortellessa, G and Dell’Isola, M and Ferenč{\'i}kov{\'a}, Z and Fernicola, V and Gavioso, R and Georgin, E and Heinonen, M and Hudoklin, D and Jalukse, L and Karab{\"o}ce, N and Leito, I and M{\"a}kynen, A and Miao, P and Nielsen, J and Nicolescu, I and Rudolfov{\'a}, M and Ojanen-Saloranta, M and {\"O}sterberg, P and {\O}stergaard, P and Rujan, M and Sega, M and Strnad, R and Vachova, T} } @Proceedings { , title = {Metrology for ammonia in ambient air–concept and first results of the EMRP project MetNH3}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {2015}, number2 = {ENV55: MetNH3: Metrology for ammonia in ambient air}, pages = {07003}, keywords = {ammonia, reference gas mixture, reference gas generator, dilution, absolute spectroscopic measurements, sampling, gas cylinders}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07003/metrology_metr2015_07003.html}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {EDP Sciences - Web of Conferences}, address = {Les Ulis Cedex}, event_place = {Paris, France}, event_name = {17th International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/201507003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pog{\'a}ny, A. and Balslev-Harder, D. and Braban, C. F. and Cassidy, N. and Ebert, V. and Ferracci, V. and Hieta, T. and Leuenberger, D. and L{\"u}ttschwager, N. and Martin, N. and Pascale, C. and Tiebe, C. and Twigg, M. M. and Vaittinen, O. and van Wijk, J. and Wirtz, K. and Niederhauser, B.} } @Proceedings { , title = {Industrial implementation of the new NIR laser-based sensor for measuring surface moisture in poiymers}, journal = {Proceedings of the 17th International Congress of Metrology 2015}, year = {2015}, month = {9}, day = {21}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {11003}, keywords = {moisture, surcace moisture, NIR laser, polymer}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_11003/metrology_metr2015_11003.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences, 2015}, event_place = {Paris}, event_name = {17th International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/201511003}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hudoklin, D and Mu{\~n}oz Lopez, I and Begeš, G and Drnovšek, J and Beguš, S} } @Article { , title = {First steps in development of a new transfer standard, for moisture measurement, based on radio-frequency wave and micro-wave.}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15008}, keywords = {Moisture, high frequencies, micro-waves, metrology, transfer standard.}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15008/metrology_metr2015_15008.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Georgin, E and Rochas, JF and Achard, P and Hubert, S and Ben Ayoub, MW and Sabouroux, P} } @Proceedings { BettsBHCWKG2015, title = {Fast Current Mapping of Photovoltaic Devices Using Compressive Sampling}, journal = {Proceedings of the 31st European Photovoltaic Solar Energy Conference and Exhibition}, year = {2015}, month = {9}, day = {18}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {29-34}, keywords = {Simulation, Characterisation, Characterization, Compressed Sensing}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {WIP}, address = {Munich}, event_place = {Hamburg, Germany}, event_name = {31st European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {14-09-2015 to 18-09-2015}, language = {30}, ISBN = {3-936338-39-6}, ISSN = {2196-0992}, DOI = {10.4229/EUPVSEC20152015-1AO.2.3}, stag_bib_extends_levelofaccess = {NA}, author = {Betts, TR and Bliss, M and Hall, S and Cashmore, M and Wu, X and Koutsourakis, G and Gottschalg, G} } @Article { , title = {The determination of wear volumes by chromatic confocal measurements during twin-disc tests with cast iron and steel}, journal = {Wear}, year = {2015}, month = {9}, day = {15}, volume = {338–339}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {95–104}, keywords = {Profile measurements, Chromatic confocal probe, Twin-disc tests, Wear, Friction}, web_url = {http://www.sciencedirect.com/science/article/pii/S004316481500318X}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier }, language = {30}, ISSN = {0043-1648}, DOI = {10.1016/j.wear.2015.05.011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hemming, BH and Andersson, PA} } @Proceedings { , title = {Scatterometric characterization of diffractive optical elements}, journal = {Proceedings of SPIE}, year = {2015}, month = {9}, day = {10}, volume = {9173}, number = {-}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {91730I}, keywords = {scatterometry, diffractive optical elements}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1901269}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {SPIE}, address = {Bellingham}, event_place = {San Diego}, event_name = {SPIE Optics+Photonics 2014}, event_date = {17-21 August, 2014}, language = {30}, ISBN = {9781628412000}, ISSN = {0277-786X}, DOI = {10.1117/12.2061699}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Saastamoinen, Toni and Husu, Hannu and Laukkanen, Janne and Siitonen, Samuli and Turunen, Jari and Lassila, Antti} } @Article { , title = {Errors and uncertainty in the topography gained via frequency-domain analysis}, journal = {Optics Express}, year = {2015}, month = {9}, day = {7}, volume = {23}, number = {18}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, pages = {24057-24070}, keywords = {frequency-domain analysis}, web_url = {https://www.osapublishing.org/view_article.cfm?gotourl=https\%3A\%2F\%2Fwww\%2Eosapublishing\%2Eorg\%2FDirectPDFAccess\%2F8F4A3C0C-9409-1227-C41EA2E30AFE86F0_326786\%2Foe-23-18-24057\%2Epdf\%3Fda\%3D1\%26id\%3D326786\%26seq\%3D0\%26mobile\%3Dno\&org=}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {OSA Publishing}, address = {Washington, D.C}, language = {30}, ISSN = {24057}, DOI = {10.1364/OE.23.0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.osapublishing.org/view_article.cfm?gotourl=https\%3A\%2F\%2Fwww\%2Eosapublishing\%2Eorg\%2FDirectPDFAccess\%2F8F4A3C0C-9409-1227-C41EA2E30AFE86F0_326786\%2Foe-23-18-24057\%2Epdf\%3Fda\%3D1\%26id\%3D326786\%26seq\%3D0\%26mobile\%3Dno\&org=}, author = {Henning, A. J. and Giusca, C. L. and Claverley, James} } @Article { , title = {BAYESIAN APPROACH TO THE STATISTICAL INVERSE PROBLEM OF SCATTEROMETRY: COMPARISON OF THREE SURROGATE MODELS}, journal = {International Journal for Uncertainty Quantification}, year = {2015}, month = {9}, day = {1}, volume = {5}, number = {6}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {511–526}, keywords = {scatterometry, Bayesian inference, stochastic partial differential equations, collocation, inverse problem}, tags = {MAT}, web_url = {-}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Begell House}, address = {Danbury}, language = {30}, ISSN = {-}, DOI = {10.1615/Int.J.UncertaintyQuantification.2015013050}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heidenreich, S. and Gross, H. and B{\"a}r, M.} } @Article { , title = {3-D Printed Metal-Pipe Rectangular Waveguides}, journal = {IEEE Transactions on Components, Packaging and Manufacturing Technology}, year = {2015}, month = {9}, day = {1}, volume = {5}, number = {9}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1339 - 1349}, keywords = {3-D printing, additive manufacturing, fused deposition modeling (FDM), metal-pipe rectangular waveguide (MPRWG), rapid manufacturing, rectangular waveguide, stereolithography apparatus (SLA).}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7217811}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, USA}, language = {30}, ISSN = {N/A}, DOI = {10.1109/TCPMT.2015.2462130}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {D’Auria, M. and Otter, W. J. and Hazell, J and Gillatt, B. T. W. and Long-Collins, C. and Ridler, N. M. and Lucyszyn, S.} } @Proceedings { , title = {Propagation automatique des incertitudes: application aux techniques auto-talonnage des analyseurs de seau vectoriel}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, volume = {2015}, number = {2015}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {12006}, keywords = {-}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/contents/contents.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, event_place = {Paris}, event_name = {International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {37}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/20150012006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Allal, D and Hall, B and Vincent, P and Litwin, A and Ziad{\'e}, F and Allal, Djamel} } @Article { ViefhausNSRHAHPYY2015, title = {A new compact soft x-ray spectrometer for resonant inelastic x-ray scattering studies at PETRA III}, journal = {Review of Scientific Instruments}, year = {2015}, month = {9}, volume = {86}, number = {9}, number2 = {SIB58: Angles: Angle metrology}, pages = {093109}, keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4930968}, stag_bib_extends_levelofaccess = {NA}, author = {Viefhaus, J. and Nordgren, J. and Siewert, F. and Reininger, R. and Hage, A. and Ag{\aa}ker, M. and Hahn, U. and Peters, H. B. and Yin, Z. and Yandayan, Tanfer} } @Article { QuetelKHFEBB2015, title = {Who should take responsibility for decisions on internationally recommended datasets? The case of the mass concentration of mercury in air at saturation}, journal = {Metrologia}, year = {2015}, month = {8}, day = {27}, volume = {52}, number = {5}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {L25-L30}, keywords = {Who should take responsibility for decisions on internationally recommended datasets? The case of the mass concentration of mercury in air at saturation}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/52/5/L25}, stag_bib_extends_levelofaccess = {NA}, author = {Qu{\'e}tel, C.R. and Kim, K.H. and Horvat, M. and Fisicaro, P. and Ent, H. and Brewer, P.J. and Brown, R.J.C.} } @Article { HolzwarthBHRMLGDG2015, title = {Characterization of a 450 km baseline GPS carrier-phase link using an optical fiber link}, journal = {New Journal of Physics}, year = {2015}, month = {8}, day = {26}, volume = {17}, number = {8}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {083044}, keywords = {frequency transfer, global positioning system, optical fiber link, atomic clock}, web_url = {http://iopscience.iop.org/article/10.1088/1367-2630/17/8/083044/pdf}, web_url2 = {http://arxiv.org/abs/1505.02144}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/17/8/083044}, stag_bib_extends_levelofaccess = {NA}, author = {Holzwarth, R. and Bauch, A. and H{\"a}nsch, T.W. and Raupach, S.M.F. and Matveev, A. and Leute, J. and Grebing, C. and Droste, S. and Grosche, G.} } @Article { , title = {Validation of a calibration set-up for radiosondes to fulfil GRUAN requirements}, journal = {Measurement Science and Technology}, year = {2015}, month = {8}, day = {26}, volume = {26}, number = {10}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {105901}, keywords = {Radiosonde, calibration, GRUAN, humidity, traceability, uncertainty}, web_url = {http://iopscience.iop.org/article/10.1088/0957-0233/26/10/105901}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing Ltd}, address = {UK}, language = {30}, ISSN = {0957-0233/15/105901}, DOI = {10.1088/0957-0233/26/10/105901}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-26}, author = {Sairanen, H. and Heinonen, M. and H{\"o}gstr{\"o}m, R.} } @Article { KimNHLAHLHMLHJBCPYKSPPHK2015, title = {A Facile Route for Patterned Growth of Metal–Insulator Carbon Lateral Junction through One-Pot Synthesis}, journal = {ACS Nano}, year = {2015}, month = {8}, day = {25}, volume = {9}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {8352-8360}, keywords = {amorphous carbon, bottom-up growth, graphene, graphene growth from polymer, graphene-based heterostructure}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Chemical Society (ACS)}, address = {Washington, USA}, language = {30}, ISSN = {1936-0851, 1936-086X}, DOI = {10.1021/acsnano.5b03037}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, Kwang S. and Novoselov, Konstantin S. and Hwang, Chanyong and Lee, Zonghoon and Ahn, Jong-Hyun and Han, Sang Woo and Lee, Tae Geol and Hyun, Seung and Mishchenko, Artem and Lee, Seoung-Ki and Huh, Sung and Jeon, Gumhye and Byun, Jinseok and Chae, Dong-Hun and Park, Hyo Ju and Yu, Seong Uk and Kim, Yong-Jin and Son, Jin Gyeong and Park, Jaesung and Park, Beomjin and Hong, Byung Hee and Kim, Jin Kon} } @Article { , title = {Depth resolution at organic interfaces sputtered by argon gas cluster ions: the effect of energy, angle and cluster size}, journal = {Analyst}, year = {2015}, month = {8}, day = {25}, volume = {140}, number = {19}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {6508-6516}, web_url = {http://pubs.rsc.org/en/content/articlelanding/2015/an/c5an01473e\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {0003-2654}, DOI = {10.1039/C5AN01473E}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-25}, author = {Seah, M.P. and Spencer, S.J. and Havelund, R. and Gilmore, I.S. and Shard, A.G.} } @Article { , title = {MEMS-based voltage detector}, journal = {Sensors and Actuators A: Physical}, year = {2015}, month = {8}, day = {24}, volume = {234}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {99-103}, keywords = {Capacitive sensors; MEMS; Readout; Pull-in; Noise; Voltage measurement}, web_url = {https://www.researchgate.net/publication/282373168_MEMS-based_voltage_detector}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {n/a}, DOI = {10.1016/j.sna.2015.08.011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-8-17}, author = {Helist{\"o}, P and Sepp{\"a}, H and Manninen, A} } @Article { , title = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system}, journal = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system}, year = {2015}, month = {8}, day = {19}, volume = {2}, number = {3}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {035015}, keywords = {graphene, Quantum Hall, cryogen-free, measurement}, web_url = {http://iopscience.iop.org/2053-1583/2/3/035015/video/abstract}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/2/3/035015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Rozhko, S. and Antonov, I. and Tzalenchuk, A. and Williams, J. M. and Melhem, Z. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R.} } @Article { , title = {Determination of the Boltzmann constant k from the speed of sound in helium gas at the triple point of water}, journal = {Metrologia}, year = {2015}, month = {8}, day = {19}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S263–S273}, keywords = {Acoustic resonance, Boltzmann constant, Definition of the kelvin, Microwave resonance, Quasi-sphere, Speed of sound, Triaxial ellipsoid}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S263/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/0026-1394/52/5/S263}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pitre, L and Risegari, L and Sparasci, F and Plimmer, M D and Himbert, M E and Giuliano Albo, P A} } @Article { , title = {Brief bursts of infrasound may improve cognitive function - An fMRI study}, journal = {Hearing Research}, year = {2015}, month = {8}, day = {7}, volume = {328 (2015)}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {87-93}, keywords = {Auditory system; Cognitive processing; Infrasound; N-back; Working memory; fMRI}, web_url = {http://www.sciencedirect.com/science/article/pii/S0378595515001628}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, address = {Philadelphia}, language = {30}, DOI = {10.1016/j.heares.2015.08.001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-5-31}, author = {Weichenberger, Markus and Bauer, Martin and K{\"u}hler, Robert and Hensel, Johannes and Br{\"u}hl, R{\"u}diger and Ihlenfeld, Albrecht and Ittermann, Bernd and Gallinat, J{\"u}rgen and Koch, Christian and Sander, Tilmann and K{\"u}hn, Simone} } @Proceedings { , title = {LED-based field radiometer for sensor web in-situ measurements}, journal = {IEEE International Workshop on Metrology for Aerospace, MetroAeroSpace 2015 - Proceedings 08/2015}, year = {2015}, month = {8}, volume = {2}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {radiometer, LED, vicarious calibration, sensor web, in-situ}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7180675}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {IEEE}, event_place = {Benevento, Italy}, event_name = {2nd IEEE International Workshop on Metrology for Aerospace, MetroAeroSpace 2015}, event_date = {04-06-2015 to 05-06-2015}, language = {30}, DOI = {10.1109/MetroAeroSpace.2015.7180675}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Taralli, ET and Filippo, RF and Brida, GB and Rajteri, MR and Hall, SRGH and Bialek, AB and Greenwell, CG and Fox, NF} } @Techreport { , title = {A Guide to Bayesian Inference for Regression Problems}, journal = {-}, year = {2015}, month = {7}, day = {30}, volume = {-}, number = {-}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {-}, tags = {MAT}, web_url = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {PTB}, address = {Brunswick \& Berlin}, institution = {-}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, author = {Elster, C. and Klauenberg, K. and Walzel, M. and Wuebbeler, G. and Harris, P. and Cox, M. and Matthews, C. and Smith, I. and Wright, L. and Allard, A. and Fischer, N. and Cowen, S. and Ellison, S. and Wilson, P. and Pennecchi, F. and Kok, G. and Van der Veen, A. and Pendrill, L.R.} } @Article { , title = {Measuring Compositions in Organic Depth Profiling: Results from a VAMAS Interlaboratory Study}, journal = {Journal of Physical Chemistry (B)}, year = {2015}, month = {7}, day = {23}, volume = {119}, number = {33}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {10784–10797}, web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b05625}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ACS}, address = {Washington DC}, language = {30}, DOI = {10.1021/acs.jpcb.5b05625}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-6}, author = {Shard, A. and Havelund, R. and Spencer, S. and Gilmore, I. and Alexander, M.R. and Angerer, T.B. and Aoyagi, S. and Barnes, J.P. and Benayad, A. and Bernasik, A. and Ceccone, G. and Counsell, J.D.P and Deeks, C. and Fletcher, J.S. and Graham, D.J. and Heuser, C. and Lee, T.G. and Marie, C. and Marzec, M.M. and Mishra, G. and Rading, D. and Renault, O. and Scurr, D.J and Shon, H.K. and Spampinato, V. and Tian, H. and Wang, F. and Winograd, N. and Wu, K. and Wucher, A.} } @Article { , title = {Assessment of computational tools for MRI RF dosimetry by comparison with measurements on a laboratory phantom}, journal = {Physics in Medicine \& Biology}, year = {2015}, month = {7}, day = {6}, volume = {60}, number = {14}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {5655–5680}, keywords = {MRI, dosimetry, computational modelling, near field measurements}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {Online ISSN: 1361-6560 / Print ISSN: 0031-9155}, DOI = {10.1088/0031-9155/60/14/5655}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bottauscio, O. and Cassar{\`a}, A. M. and Hand, J. W. and Giordano, D. and Zilberti, L. and Borsero, M. and Chiampi, M. and Weidemann, G.} } @Article { , title = {Online validation of comparison algorithms using the TraCIM system}, journal = {Journal of mechanical Engineering and Automation}, year = {2015}, month = {7}, volume = {2}, number = {7}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {312-327}, keywords = {Comparison, TraCIM, weighted mean, expanded measurement uncertainty, En value, largest consistent subset, En criterion, Grubbs’ test.}, tags = {MAT}, web_url = {http://www.ethanpublishing.com/uploadfile/2015/0806/20150806111104726.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Scientific \& Academic Publishing (SAP)}, address = {Rosemead}, language = {30}, ISSN = {2163-2413}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"a}rtig, FH and Tang, JT and Hutzschenreuter, DH and Wendt, KW and Kniel, KK and Shi, ZS} } @Proceedings { BlattnerKJSHB2015, title = {Measurement uncertainty of photometric measurements considering the requirements of the new international standard CIE S 025 / E:2015 ''Test Method for LED Lamps, LED Luminaires and LED Modules}, journal = {Proceedings of the 28th Session of the CIE Manchester, United Kingdom, 28 June – 4 July 2015}, year = {2015}, month = {7}, volume = {1}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {797-811}, keywords = {measurement uncertainty, LED, CIE S 025, Test Method for LED lamps, international standard}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Commission Internationale de L'Eclairage}, address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A, 1010 Vienna, Austria}, event_place = {Manchester, UK}, event_name = {28th Session of the CIE}, event_date = {28-06-2015 to 04-07-2015}, language = {30}, ISBN = {978-3-902842-55-8}, stag_bib_extends_levelofaccess = {NA}, author = {Blattner, P. and Kr{\"u}ger, U. and Jordan, W. and Steudtner, W. and Hornischer, R. and Bechter, W.} } @Article { , title = {High-bandwidth transfer of phase stability through a fiber frequency comb}, journal = {Optics Express}, year = {2015}, month = {6}, day = {30}, volume = {23}, number = {15}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {19771-19776}, web_url = {http://arxiv.org/abs/1505.02084}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Scharnhorst, N. and W{\"u}bbena, J. B. and Hannig, S. and Jakobsen, K. and Kramer, J. and Leroux, I. D. and Schmidt, P. O.} } @Article { , title = {Imaging microwave and DC magnetic fields in a vapor-cell Rb atomic clock}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, day = {30}, volume = {64}, number = {12}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {3629-3637}, keywords = {Atomic clocks, diode lasers, microwave measurements, microwave resonators, microwave spectroscopy, optical pumping}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7140794}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, NY, USA}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2444261}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1505.07739}, author = {Affolderbach, C. and Du, G.-X. and Bandi, T. and Horsley, A. and Treutlein, P. and Mileti, G.} } @Article { , title = {Coherent precession in arrays of dipolar-coupled soft magnetic nanodots}, journal = {Journal of Applied Physics}, year = {2015}, month = {6}, day = {25}, volume = {117}, number = {24}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {7/243905}, keywords = {nanodot, VNA-FMR, precessional mode}, web_url = {http://scitation.aip.org/content/aip/journal/jap}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publisching}, address = {NY}, language = {30}, ISSN = {0021-8979 (print) ; 1089-7550 (online)}, DOI = {10.1063/1.4923160}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hu, X.K and Dey, H. and Liebing, N. and Schumacher, H.W. and Csaba, G. and Orlov, A. and Bernstein, G.H. and Porod, W.} } @Proceedings { , title = {Length characterization of a piezoelectric actuator travel with a mode-locked femtosecond laser}, journal = {Proceedings SPIE 9525, Optical Measurement Systems for Industrial Inspection IX}, year = {2015}, month = {6}, day = {22}, volume = {9525}, number = {95254K}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {piezoelectric actuator, passive cavity, mode-locked laser}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {SPIE}, event_place = {Munich, Germany}, event_name = {SPIE Optical Measurement Systems for Instrustrial Inspection IX, World of Photonics}, event_date = {22-06-2015 to 25-06-2015}, language = {30}, ISBN = {9781628416855}, DOI = {10.1117/12.2190745}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Pradova, L. and Lesundak, A. and Hucl, V. and Cizek, M. and Mikel, B. and Hrabina, J. and Rerucha, S. and Cip, O. and Lazar, J.} } @Proceedings { , title = {The statistical inverse problem of scatterometry: Bayesian inference and the effect of different priors}, journal = {Proc. SPIE 9526, Modeling Aspects in Optical Metrology V, 95260U (June 21, 2015)}, year = {2015}, month = {6}, day = {21}, volume = {9526}, number = {Modeling Aspects in Optical Metrology V}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {Uncertainty quantification, Diffraction gratings, Hybrid metrology}, tags = {MAT}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2344591}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Society of Photo-Optical Instrumentation Engineers (SPIE)}, address = {Munich}, event_place = {Munich}, event_name = {SPIE Modeling Aspects in Optical Metrology V}, event_date = {21-06-2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1117/12.2185707}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heidenreich, S and Gross, H and Wurm, M and Bodermann, B and B{\"a}r, M} } @Article { , title = {Obtaining the Transfer Function of optical instruments using large calibrated reference objects}, journal = {Optics Express}, year = {2015}, month = {6}, day = {16}, volume = {23}, number = {13}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, pages = {16617-16627}, keywords = {Transfer Function, Coherence Scanning Interferometer}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-23-13-16617}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {OSA Publishing}, address = {Washington, D.C}, language = {30}, ISSN = {16617}, DOI = {10.1364/OE.23.016617}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-23-13-16617}, author = {Henning, A. J. and Huntley, J. M. and Giusca, C. L.} } @Article { , title = {Parts-per-trillion level detection of nitrogen dioxide by cantilever-enhanced photoacoustic spectroscopy}, journal = {Optics Letters}, year = {2015}, month = {6}, day = {16}, volume = {40}, number = {13}, number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments}, pages = {2933-2936}, keywords = {Spectrometers, Spectroscopy; photothermal and visible, Laser sensors.}, web_url = {-}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {OSA}, address = {Washington, DC}, language = {30}, ISSN = {-}, DOI = {10.1364/OL.40.002933}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Peltola, J. and Hieta, T. and Vainio, M.} } @Proceedings { , title = {Application of PMUs for monitoring a 50 kV distribution grid}, journal = {Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 2015}, year = {2015}, month = {6}, day = {15}, volume = {n/a}, number = {n/a}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1-5}, keywords = {phasor measurement units, smart grids, renewable energy sources}, web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {n/a}, address = {n/a}, event_place = {Lyon, France}, event_name = {23rd International Conference and Exhibition on Electricity Distribution (CIRED)}, event_date = {14-06-15 to 15-06-15}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf}, author = {Rietveld, G and Jongepier, A and van Seters, J and Visser, M and Liu, P and Acanski, M and Hoogenboom, D and van den Brom, H. E.} } @Article { , title = {Calibration of Wideband Digital Real-time Oscilloscopes}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, day = {1}, volume = {64}, number = {6}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {1716 - 1725}, keywords = {Oscilloscopes, Real-time systems, Sampling, Numerical analysis, Prime numbers, Metrology, Allan Variance, delay measurement, convolution.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7072541\&isnumber=7104190}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Institute of Electrical and Electronic Engineers}, address = {Piscataway}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2407471.}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/servlet/opac?punumber=19}, author = {Humphreys, D. A. and Hudlička, M. and Fatadin, I.} } @Article { SuomalainenSNMMLLKHEDBHW2015, title = {Performance of a Modular Wideband HVDC Reference Divider for Voltages up to 1000 kV}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {1390-1397}, keywords = {Voltage measurement, Calibration, Resistors, HVDC transmission, Uncertainty, Voltage control, Resistance}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2408795}, stag_bib_extends_levelofaccess = {NA}, author = {Suomalainen, E.P. and Schmidt, M. and Nieminen, T. and Merev, A. and Meisner, J. and Lucas, W. and Lehtonen, T. and Kl{\"u}ss, J. and Houtzager, E. and Elg, A.P. and Dedeoğlu, S. and Bergman, A. and H{\"a}llstr{\"o}m, J. and Weber, C.} } @Article { NieminenKHBE2015, title = {Traceability and Characterization of a 1000 kV HVDC Reference Divider}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {1709-1715}, keywords = {Resistors, Resistance, Calibration, Uncertainty, Voltage measurement, Measurement uncertainty, HVDC transmission}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2410373}, stag_bib_extends_levelofaccess = {NA}, author = {Nieminen, T. and Kharezy, M. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Elg, A.P.} } @Article { , title = {Design and Calibration of a Compact Quasi-Optical System for Material Characterization in Millimeter/Sub-millimeter Wave Domain}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {1438-1445}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2014.2376115}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kazemipour, A. and Hudlicka, M. and Yee, S.-K. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Article { , title = {Die neue Neubiberger Pfeilerstrecke}, journal = {Zeitschrift für Vermessungswesen: ZfV}, year = {2015}, month = {6}, volume = {140}, number = {6}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {357-364}, keywords = {EDM-Kalibrierung, Messgr{\"o}{\ss}e L{\"a}nge, Mess und Eichgesetz, Ringversuch, R{\"u}ckf{\"u}hrung}, web_url = {http://geodaesie.info/zfv/heftbeitrag/5166}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Wi{\ss}ner-Verlag}, address = {Augsburg}, language = {43}, DOI = {10.12902/zfv-0086-2015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heunecke, O.} } @Proceedings { , title = {Impact of the ecodesign directive on traceability in power transformer loss measurements}, journal = {Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution (CIRED), Lyon, France}, year = {2015}, month = {6}, volume = {2015}, number = {-}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, pages = {1-5}, keywords = {Loss measurement, Load loss, efficiency, losses, Ecodesign Directive, power transformers, reactors, ELPOW, high voltage, current transformers}, web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_1538_final.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {International Conference and Exhibition on Electricity Distribution}, address = {-}, event_place = {Lyon, France}, event_name = {International Conference and Exhibition on Electricity Distribution}, event_date = {June 2015}, language = {30}, ISBN = {-}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rietveld, G and Houtzager, E and Zhao, D} } @Article { , title = {Topographical orientation effects on friction and wear in sliding DLC and steel contacts, Part 1: Experimental}, journal = {Wear}, year = {2015}, month = {6}, volume = {330–331}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {3–22}, keywords = {Friction, Wear, Topography, Orientation, Modelling}, web_url = {http://www.sciencedirect.com/science/article/pii/S0043164815001234}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, ISSN = {0043-1648}, DOI = {10.1016/j.wear.2015.02.014}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Holmberg, KH and Laukkanen, AL and Roikainen, HR and Waudby, RW and Stachowiak, GS and Wolski, MW and Podsiadlo, PP and Gee, MG and Nunn, JN and Gachot, CG and Li, LL} } @Article { , title = {MODELING ASPECTS TO IMPROVE THE SOLUTION OF THE INVERSE PROBLEM IN SCATTEROMETRY}, journal = {Discrete and Continuous Dynamical Systems Series S}, year = {2015}, month = {6}, volume = {8}, number = {3}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {497-519}, keywords = {critical dimensions, uncertainty, lithography, scatterometry, inverse problem}, tags = {MAT}, web_url = {http://www.aimsciences.org/journals/displayArticlesnew.jsp?paperID=10417}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {American Institute of Mathematical Sciences}, address = {Springfield, MO}, language = {30}, ISSN = {-}, DOI = {10.3934/dcdss.2015.8.497}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gross, H and Heidenreich, S and Henn, M-A and B{\"a}r, M} } @Proceedings { , title = {Auditory cortex activation by infrasonic and low-frequency sound of equalized individual loudness}, journal = {Euronoise 2015}, year = {2015}, month = {5}, day = {31}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {2577-2582}, keywords = {Infrasound, loudness, MEG}, web_url = {http://www.conforg.fr/euronoise2015/output_directory/data/articles/000402.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Maastricht (Nederlands)}, event_name = {Euronoise 2015, Maastricht}, event_date = {3rd June 2015}, language = {30}, ISSN = {2226-5147}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"u}hler, Robert and Bauer, Martin and Hensel, Johannes and Koch, Christian and Sander-Th{\"o}mmes, Tillmann} } @Proceedings { , title = {MEG and fMRI localization of infrasonic and low-frequency sound}, journal = {Proccedings of the ISMRM 2015 - International Society for Magnetic Resonance in Medicine}, year = {2015}, month = {5}, day = {30}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, web_url = {http://www.ismrm.org/15/}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Toronto, Ontario, Canada}, event_name = {ISMRM 23rd Annual Meeting \& Exhibition}, event_date = {30 May-05 June 2015}, language = {30}, ISSN = {1545-4428}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Weichenberger, M. and Br{\"u}hl, R. and Bauer, M. and K{\"u}hler, R. and Ihlenfeld, A. and Hensel, J. and Koch, C. and Ittermann, B. and K{\"u}hn, S. and Sander-Th{\"o}mmes, T.} } @Article { , title = {The Effect of Bilayer Regions on the Response of Epitaxial Graphene Devices to Environmental Gating}, journal = {Carbon}, year = {2015}, month = {5}, day = {23}, volume = {93}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {896–902}, keywords = {grapheme, metrology, scanning Kelvin probe microscopy}, web_url = {http://www.sciencedirect.com/science/article/pii/S0008622315004686}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {n/a}, DOI = {10.1016/j.carbon.2015.05.061}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-5-23}, author = {Hill-Pearce, R. E. and Eless, V and Lartsev, A and Martin, N. A. and Barker-Snook, I. L. and Helmore, J. J. and Yakimova, R. and Gallop, J. C. and Hao, L} } @Proceedings { , title = {Microstrip open: Problematic calibration standard}, journal = {Proc. of the 85th Microwave Measurement Conference (ARFTG)}, year = {2015}, month = {5}, day = {22}, volume = {n/a}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {microstrip open, calibration standard, radiation}, web_url = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=7162921}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Phoenix, Arizona, USA}, event_name = {Proc. of the 85th Microwave Measurement Conference (ARFTG)}, event_date = {22 May 2015}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/ARFTG.2015.7162921}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Haase, Martin and Hoffmann, Karel and Skvor, Zbynek} } @Proceedings { , title = {An active reference spring array for in-situ calibration of the normal spring constant of AFM cantilevers}, journal = {Proc. SPIE 9517, Smart Sensors, Actuators, and MEMS VII; and Cyber Physical Systems, 951719 (May 21, 2015); doi:10.1117/12.2178850; http://dx.doi.org/10.1117/12.2178850}, year = {2015}, month = {5}, day = {21}, volume = {Proc. SPIE 9517}, number = {Proc. SPIE 9517}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {951719}, keywords = {Calibration ; Microelectromechanical systems ; Reactive ion etching ; Simulations ; Fabrication}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, event_place = {Barcelona, Spain}, event_name = {Smart Sensors, Actuators, and MEMS VII and Cyber Physical Systems}, event_date = {2015-May-04}, language = {30}, DOI = {10.1117/12.2178850}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gao, S. and Brand, U. and Hahn, S. and Hiller, K.} } @Proceedings { , title = {Smart sensors and calibration standards for high precision metrology}, journal = {'' Smart sensors and calibration standards for high precision metrology '', Proc. SPIE 9517, Smart Sensors, Actuators, and MEMS VII; and Cyber Physical Systems, 95170V (May 21, 2015); doi:10.1117/12.2179455; http://dx.doi.org/10.1117/12.2179455}, year = {2015}, month = {5}, day = {21}, volume = {9517}, number = {9517}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {95170V}, keywords = {Calibration ; Metrology ; Smart sensors ; Silicon ; Sensors ; Microtechnology ; Dimensional metrology ; Equipment and services ; Fabrication}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, event_place = {Barelona, Spain}, event_name = {Smart Sensors, Actuators, and MEMS VII; and Cyber Physical Systems}, event_date = {May 4, 2015}, language = {30}, DOI = {10.1117/12.2179455}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Brand, U. and Gao, S. and Li, Z. and XU, M. and Buetefisch, S. and Peiner, E. and Frueauf, J. and Hiller, K.} } @Article { , title = {Edge-Mode Resonance-Assisted Switching of Nanomagnet Logic Elements}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {5}, day = {21}, volume = {51}, number = {11}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {4/3401004}, keywords = {Ferromagnetic resonance (FMR) mode, microwave-assisted magnetization switching (MAS), nanomagnet logic (NML), simulation}, web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=20}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2015.2435901}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hu, X.K. and Dey, H. and Liebing, N. and Csaba, G. and Orlov, A. and Bernstein, G.H. and Porod, W. and Krzysteczko, P. and Sievers, S. and Schumacher, H.W.} } @Article { , title = {The portable device for continual measurement of radon progenies on filter using the detector Timepix}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {19}, volume = {164}, number = {4}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {493-496}, keywords = {Timepix, EEC, radon progenies}, web_url = {http://rpd.oxfordjournals.org/content/164/4/493.long}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Oxford University Press}, address = {Oxford}, language = {30}, ISSN = {1742-3406}, DOI = {10.1093/rpd/ncv343}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://rpd.oxfordjournals.org/content/164/4/493.abstract}, author = {Bul{\'a}nek, BB and Hůlka, JH and J{\'i}lek, KJ and Štekl, IŠ} } @Article { SuranKBAMSHTLT2015, title = {A new large-volume metal reference standard for radioactive waste management}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {13}, volume = {168}, number = {3}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {293-299}, keywords = {reference materials, calibration, ionizing radiation, free release measurement}, web_url = {http://rpd.oxfordjournals.org}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv309}, stag_bib_extends_levelofaccess = {NA}, author = {Šur{\'a}ň, J. and Kov{\'a}ř, P. and Burda, O. and Arnold, D. and Marissens, G. and Stroh, H. and Hult, M. and Tzika, F. and Listkowska, A. and Tyminski, Z.} } @Article { , title = {Frequency and time transfer for metrology and beyond using telecommunication network fibres}, journal = {Comptes Rendus Physique}, year = {2015}, month = {5}, day = {8}, volume = {16}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {531–539}, keywords = {Time and frequency metrology Optical links Frequency stabilized lasers Fibre optics}, web_url = {www.sciencedirect.com}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1016/j.crhy.2015.04.005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopez, O. and K{\'e}f{\'e}lian, F. and Jiang, H. and Haboucha, A. and Bercy, A. and Stefani, F. and Chanteau, B. and Kanj, A. and Rovera, D. and Achkar, J. and Chardonnet, C and Pottie, P.-O. and Amy-Klein, A. and Santarelli, G.} } @Article { , title = {Characterization of a large-area pyroelectric detector from 300 GHz to 30 THz}, journal = {Journal of Infrarred, Millimeter, and Terahertz Waves}, year = {2015}, month = {5}, day = {5}, volume = {36}, number = {7}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {654-661}, keywords = {Far infrared detectors, Terahertz detectors, Radiometry, Metrological instrumentation, Infrared and far infrared lasers, Optics}, web_url = {http://link.springer.com/article/10.1007\%2Fs10762-015-0163-7}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer US}, address = {New York}, language = {30}, ISSN = {1866-6892}, DOI = {10.1007/s10762-015-0163-7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {M{\"u}ller, Ralf and Gutschwager, Berndt and Hollandt, J{\"o}rg and Kehrt, Mathias and Monte, Christian and M{\"u}ller, Ralph and Steiger, Andreas} } @Techreport { , title = {Guideline for the detection efficiency calibration of Si-SPAD}, journal = {project SIQUTE website www.ptb.de/empr/siqute-home.html}, year = {2015}, month = {5}, day = {2}, volume = {xxxx}, number = {xxx}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {13}, keywords = {Calibration, single-photon avalanche diode,}, web_url = {www.ptb.de/empr/siqute-home.html}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {The Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, institution = {The Physikalisch-Technische Bundesanstalt}, language = {30}, ISBN = {none}, ISSN = {none}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\'o}pez, Marco and Helmuth Hofer, Helmuth and K{\"u}ck, Stefan} } @Article { , title = {8 \(\times\) 10−17 fractional laser frequency instability with a long room-temperature cavity}, journal = {Optics Letters}, year = {2015}, month = {5}, volume = {40}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {2112 - 2115}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-9-2112}, web_url2 = {https://arxiv.org/abs/1502.02608}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1364/OL.40.002112}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-5-31}, author = {Hafner, Sebastian and Falke, Stephan and Grebing, Christian and Vogt, Stefan and Legero, Thomas and Merimaa, Mikko and Lisdat, Christian and Sterr, Uwe} } @Article { , title = {Automatic minimisation of micromotion in a 88Sr+ optical clock}, journal = {Measurement Science \& Technology}, year = {2015}, month = {5}, volume = {26}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0957-0233/26/7/075203}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barwood, GP and Huang, G and Klein, HA and Gill, P} } @Article { , title = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, journal = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, year = {2015}, month = {5}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Dirac-point physics, epitaxial graphene, magneto-transport, measurement, graphene, hall effect, electron-hole puddles,}, web_url = {http://arxiv.org/abs/1505.03747}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1103/PhysRevB.92.075407}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, J. and Alexander-Webber, J.A. and Baker, A.M.R. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.} } @Article { , title = {First on-line isotopic characterization of N2O above intensively managed grassland}, journal = {Biogeosciences}, year = {2015}, month = {4}, day = {29}, volume = {12}, number = {N/A}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2517-2531}, keywords = {None supplied.}, web_url = {http://www.biogeosciences.net/12/2517/2015/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus Publications}, address = {Gottingen}, language = {30}, ISSN = {1726-4189}, DOI = {10.5194/bg-12-2517-2015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wolf, B and Merbold, L and Decock, C and Tuzson, B and Harris, E and Six, J and Emmenegger, L and Mohn, J} } @Article { , title = {Mapping the Optical Absorption of a Substrate-Transferred Crystalline AlGaAs Coating at 1.5um}, journal = {Classical and Quantum Gravity}, year = {2015}, month = {4}, day = {27}, volume = {32}, number = {10}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {105008}, keywords = {gravitational wave detectors, absorption, crystalline coating}, web_url = {http://iopscience.iop.org/article/10.1088/0264-9381/32/10/105008/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0264-9381}, DOI = {10.1088/0264-9381/32/10/105008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Steinlechner, J and Martin, I W and Bell, A and Cole, G and Hough, J and Penn, S and Rowan, S and Steinlechner, S} } @Article { , title = {Multiphoton luminescence imaging of chemically functionalized multi-walled carbon nanotubes in cells and solid tumors†}, journal = {ChemComm}, year = {2015}, month = {4}, day = {24}, volume = {51}, number = {45}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {9366-9369}, keywords = {N/A}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/CC/c5cc02675j\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Royal Society of Chemistry}, address = {Picadilly UK}, language = {30}, ISSN = {N/A}, DOI = {10.1039/c5cc02675j}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Rubio, N. and Hirvonen, L.M. and Chong, E.Z. and Wang, J.T.W. and Bourgognon, M. and Kafa, H. and Hassan, H.A.F.M. and Al-Jamal, W.T. and McCarthy, D. and Hogstrand, C. and Festy, F. and Al-Jamal, K.T.} } @Article { , title = {Critical Review of Industrial Techniques for Thermal Conductivity Measurements of Thermal Protection Materials}, journal = {International Journal of Thermophysics}, year = {2015}, month = {4}, day = {23}, volume = {36}, number = {7}, number2 = {SIB52: Thermo: Metrology for thermal protection materials}, pages = {1530-1544}, keywords = {Guarded heat-flow meter, Guarded hot-plate apparatus, High temperature, Laser-flash instrument, Measuring device, Thermal conductivity, Thermal insulation material, Transient hot wire, Transient plane source}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1863-x}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Link}, language = {30}, ISSN = {1572-9567}, DOI = {10.1007/s10765-015-1863-x}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hammerschmidt, UHS and Hameury, JH and Strnad, RS and Turz{\'o}-Andras,, ETA and Wu, JW} } @Article { , title = {A GPU Computational Code for Eddy-Current Problems in Voxel-Based Anatomy}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2015}, month = {4}, day = {22}, volume = {51}, number = {3}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {Biological effects of electromagnetic radiation, boundary element (BE) method, eddy currents, finite element (FE) method, magnetic resonance imaging (MRI).}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2363140}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bottauscio, O and Chiampi, M and Hand, J and Zilberti, L} } @Article { , title = {EXPERIMENTAL INVESTIGATION OF IONISATION TRACK STRUCTURE OF CARBON IONS AT HIL WARSAW}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {4}, day = {20}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, web_url = {http://rpd.oxfordjournals.org/content/early/2015/04/20/rpd.ncv191.abstract}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1093/rpd/ncv191}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bantsar, A and Hilgers, G. and Pszona, S. and Rabus, H. and Szeflinski, Z.} } @Article { , title = {Measurement Infrastructure to Support the Reliable Operation of Smart Electrical Grids}, journal = {IEEE transactions on instrumentation and measurement}, year = {2015}, month = {4}, day = {20}, volume = {64}, number = {6}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1355 - 1363}, keywords = {smart grid, metrology, synchrophasor, phasor measurement unit, revenue metering, power quality, grid modelling, electrical grids}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7089250}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, address = {n/a}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2406056}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rietveld, Gert and Braun, Jean-Pierre and Martin, Ricardo and Wright, Paul and Heins, Weibke and Ell, Nikola and Clarkson, Paul and Zisky, Norbert} } @Article { , title = {Infrasonic and low-frequency insert earphone hearing threshold}, journal = {JASA}, year = {2015}, month = {4}, day = {10}, volume = {137 (2015-April)}, number = {4}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {EL347-EL353}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1121/1.4916795}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"u}hler, R and Fedtke, T and Hensel, J} } @Article { , title = {Outgassing rate measurements with the difference method in framework of EMRP IND12}, journal = {Vacuum}, year = {2015}, month = {4}, day = {8}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {Outgassing rate measurement, Outgassing reference probes, Outgassing reference samples}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2015.03.033}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hauer, V. and Battes, K. and Fl{\"a}mmich, M. and Lerardi, V. and Jousten, K. and Šetina, J.} } @Article { , title = {Sensing earth's rotation with a helium-neon ring laser operating at 1.15 \(\mu\)m}, journal = {Opt. Lett.}, year = {2015}, month = {4}, day = {8}, volume = {40}, number = {8}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {1705}, keywords = {(120.5790) Sagnac effect; (140.3370) Laser gyroscopes; (140.3560) Lasers, ring.}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-8-1705}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington, DC, USA}, language = {30}, ISSN = {1539-4794}, DOI = {10.1364/OL.40.001705}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schreiber, U and Thirkettle, R and Hurst, R and Follman, D and Cole, G and Aspelmeyer, M and Wells, J-P} } @Article { , title = {Optical frequency dissemination for metrology applications}, journal = {Comptes Rendus Physique}, year = {2015}, month = {4}, day = {8}, volume = {16}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {524-530}, keywords = {Optical fiber link Frequency transfer Optical atomic clock Lasers}, web_url = {www.sciencedirect.com}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1016/j.crhy.2015.03.011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Droste, S. and Udem, T. and Holzwarth, R. and Haensch, T. W.} } @Article { , title = {Highly reproducible absolute quantification of Mycobacterium tuberculosis complex by digital PCR}, journal = {Analytical Chemistry}, year = {2015}, month = {4}, day = {7}, volume = {87}, number = {7}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {3706-13}, keywords = {digital PCR, tuberculosis, molecular diagnostics, extraction, purification, platform, primer, precision, bias, genomic DNA, mycobacterium, reproducibility, mycobacterium tuberculosis, mycobacterium bovis, infection, infectious disease}, web_url = {http://pubs.acs.org/doi/abs/10.1021/ac5041617}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {ACS Publications}, address = {Washington}, language = {30}, ISSN = {1520-6882}, DOI = {10.1021/ac5041617}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Devonshire, AS and Honeyborne, I and Gutteridge, A and Whale, AS and Nixon, G and Wilson, P and Jones, G and McHugh, TD and Foy, CA and Huggett, JF} } @Article { , title = {Bayesian analysis of a flow meter calibration problem}, journal = {Metrologia}, year = {2015}, month = {4}, day = {1}, volume = {52}, number = {2}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {392-399}, keywords = {Bayesian analysis, prior knowledge, posterior distribution, calibration, flow meter, least squares, regression}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/2/392/meta}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {BIPM}, address = {S{\`e}vres}, language = {30}, ISSN = {-}, DOI = {10.1088/0026-1394/52/2/392}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kok, G. J. P. and Van der Veen, A. M. H. and Harris, P. M. and Smith, I. M. and Elster, C.} } @Article { MartinezCWHCL2015, title = {Dual-sweep frequency scanning interferometry using four wave mixing}, journal = {IEEE Photonics Technology Letters}, year = {2015}, month = {4}, volume = {27}, number = {7}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {733-736}, keywords = {distance measurements, sweep laser applications, four wave mixing, FSI}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7014240}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, DOI = {10.1109/LPT.2015.2390779}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Martinez, Juan and Campbell, Michael and Warden, Matthew and Hughes, Ben and Copner, Nigel and Lewis, Andrew} } @Article { , title = {Flow Cytometry - Reference Procedure for the Measurement of Stem Cell Concentrations in Apheresis Products}, journal = {PTB mitteilungen - Traceable Dynamic Measurement of Mechanical Quantities}, year = {2015}, month = {4}, volume = {2}, number = {02 2015}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {70-73}, keywords = {quantitative measurement, stem cells, reference procedure, flow cytometry}, web_url = {www.ptb.de/cms/resources/internet/publikationen/ptb_mitteilungen/mitt2015/Heft2/PTB-Mitteilungen_2015_Heft_2.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Physikalisch-Technische Bundesanstalt (ed.)}, address = {Brunswick \& Berlin}, language = {30}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.ptb.de/cms/resources/internet/publikationen/ptb_mitteilungen/mitt2015/Heft2/PTB-Mitteilungen_2015_Heft_2.pdf}, author = {Neukammer, J. and Kammel, M. and H{\"o}ckner, J. and Kummrow, A. and Ruf, A.} } @Article { , title = {Detection efficiency calibration of single-photon silicon avalanche photodiodes traceable using double attenuator technique}, journal = {Journal of Modern Optics}, year = {2015}, month = {3}, day = {27}, volume = {62}, number = {S2}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {S21-S27}, keywords = {detection efficiency, Si-SPAD, photon statistics}, web_url = {http://www.tandfonline.com/loi/tmop20}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Taylor \& Francis.}, address = {London}, language = {30}, ISSN = {0950-0340}, DOI = {10.1080/09500340.2015.1021724}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\'o}pez, M. and Hofer, H. and K{\"u}ck, S.} } @Article { AzumaBBBBBCDFFHKKKMMMMNNPRRSSVWWZ, title = {Improved measurement results for the Avogadro constant using a 28Si-enriched crystal}, journal = {Metrologia}, year = {2015}, month = {3}, day = {25}, volume = {52}, number = {2}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, keywords = {fundamental constants, Avogadro constant, kilogram}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0026-1394/52/2/360}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Azuma, Y and Barat, P and Bartl, G and Bettin, H and Borys, M and Busch, I and Cibik, L and D’Agostino, G and Fujii, K and Fujimoto, H and Hioki, A and Krumrey, M and Kuetgens, U and Kuramoto, N and Mana, G and Massa, E and Mee{\ss}, R and Mizushima, S and Narukawa, T and Nicolaus, A and Pramann, A and Rabb, S A and Rienitz, O and Sasso, C and Stock, M and Vocke Jr, R D and Waseda, A and Wundrack, S and Zakel, S} } @Article { , title = {Status and Strategy for Moisture Metrology in European Metrology Institutes}, journal = {Int. J. Thermophysics}, year = {2015}, month = {3}, day = {22}, volume = {36}, number = {8}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {2185-2198}, keywords = {Certified reference materials · Measurement traceability · Moisture content · Strategy · Water content}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1859-6}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer International Publishing AG}, address = {Teddington}, language = {30}, ISSN = {NA}, DOI = {10.1007/s10765-015-1859-6}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bell, S and Bose, N and Bosma, R and Buzoianu, M and Carroll, P and Frenicola, V and Georgin, E and Heinonen, M and Kentved, A and Melvad, C and Nielsen, J} } @Article { , title = {Improvements to the volume measurement of 28Si spheres to determine the Avogadro constant}, journal = {IEEE Transaction on Instrumentation and Measurement}, year = {2015}, month = {3}, day = {19}, volume = {64}, number = {6}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {1650-1656}, keywords = {Avogadro constant, diameter measurement, optical interferometer, silicon crystal, spectroscopic ellipsometer, volume measurement.}, web_url = {http://ieeexplore.ieee.org/xpl/abstractCitations.jsp?arnumber=7063918\&refinements\%3D4294557292\%26filter\%3DAND\%28p_IS_Number\%3A7104190\%29}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institution of Electrical and Electrical Engineering (IEEE)}, address = {Piscataway}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2401212}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {INSPEC 15111473}, author = {Kuramoto, N.K. and Azuma, Y. A and Inaba, H. I. and Hong, F-L. H. and Fujii, K. F} } @Article { , title = {Interference Cancellation for Hollow-Core Fiber Reference Cells}, journal = {IEEE TIM (Transactions on Instrumentation and Measurement)}, year = {2015}, month = {3}, day = {13}, volume = {64}, number = {6}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {1595 - 1599}, keywords = {Frequency measurement standards, infrared spectra, interference cancellation, measurement techniques, metrology, optical fiber spectroscopy, spectroscopy.}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2408800}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Sepp{\"a}, J and Merimaa, M and Manninen, A and Triches, M and Hald, J and Lassila, A} } @Proceedings { , title = {Upgrade of goniospectrophtometer GEFE for near-field scattering and fluorescence radiance measurements}, journal = {Measuring, Modeling, and Reproducing Material Appearance 2015}, year = {2015}, month = {3}, day = {13}, volume = {9393}, number = {93980E}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {93980E-1 - 93980E-11}, keywords = {Goniospectrophotometry, BSSRDF, BRDF, fluorescence, sparkle, translucency, appearance}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, address = {Bellingham WA, USA}, event_place = {San Francisco, California, USA}, event_name = {IS\&T/SPIE Electronic Imaging}, event_date = {9-10 February 2015}, language = {30}, ISBN = {9781628414882}, ISSN = {0277-786X}, DOI = {10.1117/12.2077084}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bernad, B and Ferrero, A and Pons, A and Hernanz, M. L. and Campos, J} } @Article { ReimannSHHRRV2015, title = {Modern inhalation anesthetics: Potent greenhouse gases in the global atmosphere}, journal = {Geophysical Research Letters}, year = {2015}, month = {3}, day = {13}, volume = {42}, number = {5}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {1606-1611}, keywords = {inhalation, anaesthetics}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0094-8276}, DOI = {10.1002/2014GL062785}, stag_bib_extends_levelofaccess = {NA}, author = {Reimann, S. and Schoenenberger, F. and Hofstetter, D. and Hill, M. and Rhee, T.S. and Rigby, M. and Vollmer, M.K.} } @Article { , title = {Measurements with phase measurement units (PMUs) in the Greek Transmission System}, year = {2015}, month = {3}, number = {263}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, misc2 = {EMRP A169: Call 2009 Energy}, language = {44}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Holiastou, M.} } @Article { BrunnerHRV2015, title = {First Observations of the Fourth Generation Synthetic Halocarbons HFC-1234yf, HFC-1234ze(E), and HCFC-1233zd(E) in the Atmosphere}, journal = {Environmental Science \& Technology}, year = {2015}, month = {3}, volume = {49}, number = {5}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2703-2708}, keywords = {synthetic halocarbons}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0013-936X, 1520-5851}, DOI = {10.1021/es505123x}, stag_bib_extends_levelofaccess = {NA}, author = {Brunner, D. and Hill, M. and Reimann, S. and Vollmer, M.K.} } @Article { , title = {Investigation of self-validating thermocouples with integrated fixed-point units}, journal = {International Journal of Metrology and Quality Engineering (IJMQE)}, year = {2015}, month = {2}, day = {23}, volume = {6}, number = {1}, number2 = {IND01: HiTeMS: High temperature metrology for industrial applications (>1000 \(^{\circ}\)C)}, pages = {7/103}, keywords = {Thermocouple, miniature fixed point, self-validation}, web_url = {http://www.metrology-journal.org/}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {EDP Sciences 2015,}, address = {F-91944 Les Ulis Cedex A}, language = {30}, ISSN = {2107-6839}, DOI = {10.1051/ijmqe/2015003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on unknown-1-1}, author = {Edler, F and Haupt, S and Mokdad, S A and Failleau, G and Sadli, M} } @Article { , title = {¹³C- and ¹H-detection under fast MAS for the study of poorly available proteins: application to sub-milligram quantities of a 7 trans-membrane protein.}, journal = {Journal of Biomolecular NMR}, year = {2015}, month = {2}, day = {21}, volume = {62}, number = {1}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {17-23}, keywords = {7 trans-membrane proteins Poorly available proteins Fast magic angle spinning Heteronuclear detection 13C-detection Low sample volumes}, web_url = {http://link.springer.com/article/10.1007\%2Fs10858-015-9911-1}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer}, address = {Berlin}, language = {30}, DOI = {10.1007/s10858-015-9911-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Watts, Anthony and Judge, Peter J. and Asilmovska, Lubica and Pfeil, Marc Philipp and Higman, Victoria A. and Varga, Krisztina and Taylor, Garrick F. and Dannatt, Hugh R W} } @Article { , title = {Numerical Prediction of Temperature Elevation Induced around Metallic Hip Prostheses by Traditional, Split, and Uniplanar Gradient Coils}, journal = {Magnetic Resonance in Medicine}, year = {2015}, month = {2}, day = {17}, volume = {early view}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {temperature elevation; hip prostheses; gradient coils}, tags = {MAT}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {1522-2594}, DOI = {10.1002/mrm.25687}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, L and Bottauscio, O and Chiampi, M and Hand, J and Sanchez Lopez, H and Br{\"u}hl, R and Crozier, S} } @Article { , title = {Two-photon interference from a quantum dot microcavity: Persistent pure dephasing and suppression of time jitter}, journal = {Physical Review B}, year = {2015}, month = {2}, day = {12}, volume = {91}, number = {7}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {075413}, keywords = {Two-photon interference , indistinguishability, Hong-Ou-Mandel interference,Purcell enhancements}, web_url = {http://journals.aps.org/prb/}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {Washington}, language = {30}, ISSN = {1098-0121}, DOI = {10.1103/PhysRevB.91.075413}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Unsleber, Sebastian and McCutcheon, Dara P. S. and Dambach, Michael and Lermer, Matthias and Gregersen, Niels and H{\"o}fling, Sven and M{\o}rk, Jesper and Schneider, Christian and Kamp, Martin} } @Article { RoyROHCJIWG2015, title = {Optical Spin-Transfer-Torque-Driven Domain-Wall Motion in a Ferromagnetic Semiconductor}, journal = {Physical Review Letters}, year = {2015}, month = {2}, day = {11}, volume = {114}, number = {6}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, keywords = {Optical Spin-Transfer-Torque-Driven Domain-Wall Motion in a Ferromagnetic Semiconductor}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society (APS)}, address = {1 Research Rd, Ridge, NY 11961, USA}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.114.067202}, stag_bib_extends_levelofaccess = {NA}, author = {Roy, P. E. and Ramsay, A. J. and Otxoa, R. M. and Haigh, J. A. and Campion, R. P. and Janda, T. and Irvine, A. C. and Wunderlich, J. and Gallagher, B. L.} } @Article { , title = {Reference-free, depth-dependent characterization of nanolayers and gradient systems with advanced grazing incidence X-ray fluorescence analysis}, journal = {pss(a) - ALTECH Proc}, year = {2015}, month = {2}, day = {5}, volume = {212}, number = {3}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {523-528}, keywords = {GIXRF, XRR, depth profiling, ultra-shallow implants, nanolaminates, tetralactam macrocycle self-assembled multilayers}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/pssa.201400204/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Wiley}, address = {Honoken}, language = {30}, DOI = {10.1002/pssa.201400204}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Honicke, P. and Detlefs, B. and Muller, M. and Darlatt, E. and Nolot, E. and Grampeix, H. and Beckhoff, B.} } @Article { ZuccaHB, title = {Quantities affecting the behavior of vibrational magnetostrictive transducers}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {2}, day = {2}, volume = {51}, number = {11}, number2 = {ENG02: Harvesting: Metrology for Energy Harvesting}, keywords = {Electromagnetic measurements, Electromagnetic modeling, Energy harvesting .}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2359248}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, Mauro and Hadadian, Arash and Bottauscio, Oriano} } @Article { ZikmundRKHA, title = {Precise scalar calibration of a tri-axial Braunbek coil system}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {2}, day = {2}, volume = {51}, number = {1}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2357783}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zikmund, A. and Ripka, P. and Ketzler, R. and Harcken, H. and Albrecht, M.} } @Article { , title = {The Matrix Effect in Organic Secondary Ion Mass Spectrometry}, journal = {International Journal of Mass Spectrometry}, year = {2015}, month = {2}, day = {1}, volume = {377}, number = {1}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {599-609}, keywords = {Secondary ion mass spectrometry; Matrix effects; Quantitation; Composition; Depth profile}, web_url = {http://www.sciencedirect.com/science/article/pii/S138738061400253X}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Science Direct/Elsevier}, address = {Amsterdam Netherlands}, language = {30}, ISSN = {1046-2023}, DOI = {10.1016/j.ijms.2014.06.027}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-2-1}, author = {Shard, A.G. and Spencer, S.J. and Smith, S.A. and Havelund, R. and Gilmore, I.S.} } @Article { ElgHK2015, title = {Optimization of field grading for a 1000 KV wide-band voltage divider}, journal = {Journal of Electrostatics}, year = {2015}, month = {2}, volume = {73}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {140-150}, keywords = {HVDC transmission; Electromagnetic fields; Finite element methods; Voltage dividers; Voltage measurement}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3886}, DOI = {10.1016/j.elstat.2014.11.005}, stag_bib_extends_levelofaccess = {NA}, author = {Elg, A.P. and H{\"a}llstr{\"o}m, J. and Kl{\"u}ss, J.} } @Techreport { , title = {Progress Report of the Department ‘Fundamentals of Dosimetry’}, journal = {CCRI(I) working documents}, year = {2015}, month = {2}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arndt, A. and Baek, W. Y. and Bennett, D. and Bug, M. U. and Buhr, T. and Hilgers, G. and Nettelbeck, H. and Pfl{\"u}ger, T. and Rabus, H. and Rahm, J. and Ren, X. and Rudek, B. and Sellner, S. and Szymanowski, H. and Wang, M. and Weyland, M.} } @Article { ZhaoMRHHO2015_2, title = {Principal Component Compression Method for Covariance Matrices Used for Uncertainty Propagation}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {2}, volume = {64}, number = {2}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {356-365}, keywords = {Covariance matrix, Fourier transforms, frequency-domain measurements, measurement uncertainty, principal component analysis (PCA), timebase drift correction, time-domain measurements, timing jitter, uncertainty propagation}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2014.2340640}, stag_bib_extends_levelofaccess = {NA}, author = {Zhao, D. and Mubarak, F.A. and Rodriguez-Higuero, M. and Harris, P.M. and Humphreys, D.A. and Ojasalo, K.} } @Article { , title = {En route to traceable reference standards for surface group quantifications by XPS, NMR and fluorescence spectroscopy.}, journal = {Analyst}, year = {2015}, month = {1}, day = {28}, volume = {140}, number = {6}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/AN/C4AN02248C\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {0003-2654}, DOI = {10.1039/c4an02248c}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hennig, A. and Dietrich, P. M. and Hemmann, F. and Thiele, T. and Borcherding, H. and Hoffmann, A. and Schedler, U. and J{\"a}ger, C. and Resch-Genger, U. and Unger, W. E. S.} } @Article { MalikBPTHH2015, title = {Specific absorption rate in neonates undergoing magnetic resonance procedures at 1.5 T and 3 T}, journal = {NMR in Biomedicine}, year = {2015}, month = {1}, day = {16}, volume = {28}, number = {3}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {344-352}, keywords = {specific absorption rate; neonatal MRI; RF safety; electromagnetic simulations}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {1099-1492}, DOI = {10.1002/nbm.3256}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Malik, Shaihan J. and Beqiri, Arian and Price, Anthony N. and Teixeira, Jose Nuno and Hand, Jeffrey W. and Hajnal, Joseph V.} } @Article { , title = {Contact-free sheet resistance determination of large area graphene layers by an open}, journal = {Journal of Applied Physics}, year = {2015}, month = {1}, day = {9}, volume = {117}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {024501}, keywords = {graphene, dielectic thin films, quartz, electrical resistivity, microwaves}, web_url = {http://scitation.aip.org/content/aip/journal/jap/117/2/10.1063/1.4903820}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {n/a}, DOI = {10.1063/1.4903820}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaforost, O and Wang, K and Goniszewski, S and Adabi, M and Guo, Z and Hanham, S and Gallop, J and Hao, L and Klein, N} } @Article { , title = {A novel NIR laser-based sensor for measuring the surface moisture in polymers}, journal = {Sensors and Actuators A: Physical}, year = {2015}, month = {1}, day = {1}, volume = {221}, number = {-}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {53-59}, keywords = {Surface moisture sensor, Near-infrared laser, Optical fiber, Embedded system}, web_url = {http://www.sciencedirect.com/science/article/pii/S092442471400466X}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {New York}, language = {30}, ISSN = {0924-4247}, DOI = {10.1016/j.sna.2014.10.032}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-2}, author = {Beguš, Samo and Begeš, Gaber and Drnovšek, Janko and Hudoklin, Domen} } @Article { , title = {Frequency Noise Processes in a Strontium Ion Optical Clock}, journal = {J. Phys. B: At. Mol. Opt. Phys}, year = {2015}, month = {1}, volume = {48}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {http://iopscience.iop.org/0953-4075/48/3/035401/}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0022-3700}, DOI = {10.1088/0953-4075/48/3/035401}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barwood, GP and Huang, G and King, SA and Klein, HA and Gill, P} } @Article { , title = {Considerations for digital PCR as an accurate molecular diagnostic tool}, journal = {Clinical Chemistry}, year = {2015}, month = {1}, volume = {61}, number = {1}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {79-88}, keywords = {digital PCR, molecular diagnostic, nucleic acid, DNA, error, reproducibility, bias, translation, clinical, reference materials, partition size,}, web_url = {http://www.clinchem.org/content/61/1/79.long}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Association For Clinical Chemistry}, address = {Washington}, language = {30}, ISSN = {1530-8561}, DOI = {10.1373/clinchem.2014.221366}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Huggett, JF and Cowen, S and Foy, CA} } @Proceedings { , title = {Metrological traceability for metrological sensors illustrated through examples}, journal = {none}, year = {2015}, day = {10}, volume = {none}, number = {none}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {none}, keywords = {traceability, meteorology, measurement uncertainty, weather stations, calibration, temperature, humidity, pressure}, web_url = {https://www.wmo.int/pages/prog/www/CIMO/cimo-teco-meteorex.html}, web_url2 = {https://www.wmo.int/pages/prog/www/IMOP/publications/IOM-109_TECO-2012/Session4/O4_01_Dobre_Metrological_Traceability_Examples.pdf}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {none}, address = {none}, event_place = {Brussels}, event_name = {TECO 2012 - WMO technical conference on meteorological and environmental instruments and methods of observation}, event_date = {16-18 October 2012}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dobre, M. and Bell, S and del Campo, D. and Hudoklin, D. and Heinonen, M. and Lopardo, G. and Merlone, A.} } @Article { , title = {Optical frequency standard using acetylene-filled hollow-core photonic crystal fibers}, journal = {Optics Express}, year = {2015}, volume = {23}, number = {9}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {11227-11241}, web_url = {https://www.osapublishing.org/oe/}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1364/OE.23.011227}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Triches, Marco and Michieletto, Mattia and Hald, Jan and Lyngs{\o}, Jens K. and L{\ae}gsgaard, Jesper and Bang, Ole} } @Proceedings { WeidemannSHSWI2015, title = {A system for in situ S-parameter measurements of MR transmit arrays}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2015}, volume = {23}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/15/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Toronto, Ontario, Canada}, event_name = {ISMRM 23rd Annual Meeting \& Exhibition}, event_date = {30 May-05 June 2015}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Weidemann, Gerd and Seifert, Frank and Hoffmann, Werner and Seemann, Rainer and Waxmann, Patrick and Ittermann, Bernd} } @Proceedings { WeidemannSHI2015, title = {RF current measurements in implanted wires in phantoms by fiber optic current clamps}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2015}, volume = {23}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/15/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Toronto, Ontario, Canada}, event_name = {ISMRM 23rd Annual Meeting \& Exhibition}, event_date = {30 May-05 June 2015}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Weidemann, Gerd and Seifert, Frank and Hoffmann, Werner and Ittermann, Bernd} } @Proceedings { WeidemannSHPI2015, title = {A method for the measurement of the RF power radiated by 7T transmit coils}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2015}, volume = {23}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/15/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Toronto, Ontario, Canada}, event_name = {ISMRM 23rd Annual Meeting \& Exhibition}, event_date = {30 May-05 June 2015}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Weidemann, Gerd and Seifert, Frank and Hoffmann, Werner and Pfeiffer, Harald and Ittermann, Bernd} } @Proceedings { HallHT2015, title = {So, You Need Reliable Magnetic Measurements You Can Use With Confidence? How the Magnetic Measurement Capabilities at NPL Can Help}, journal = {Journal of Magnetics}, year = {2015}, volume = {18(3)}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {ambient field cancellation, magnetic noise, magnetic capability, properties with stress}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {South Korea}, event_name = {ICM}, event_date = {2012}, ISSN = {1226-1750}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hall, Michael and Harmon, Stuart and Thomas, Owen} } @Proceedings { BosseBDFFHKKW2015, title = {Challenges in nanometrology: high precision measurement of position and size}, year = {2015}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, keywords = {traceability, measurement uncertainty, New SI, interferometry, line scale length encoder, straightness, photomask, CD metrology, signal modeling, reference}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Ilmenau, Germany}, event_name = {58th IWK Ilmenau Scientific Colloquium}, event_date = {12 September 2014}, DOI = {10.1515/teme-2015-0002}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bosse, Harald and Bodermann, Bernd and Dai, Gaoliang and Fl{\"u}gge, Jens and Frase, Carl Georg and H{\"a}{\ss}ler-Grohn, Wolfgang and K{\"o}chert, Paul and K{\"o}ning, Rainer and Weichert, Christoph} } @Proceedings { , title = {Imaging the Static Magnetic Field Distribution in a Vapor Cell Atomic Clock}, year = {2015}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {21-24}, keywords = {Atomic clocks, Magnetic field measurement, Microwave resonators, Microwave spectroscopy, Optical pumping.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Denver CO, USA}, event_name = {2015 JOINT CONFERENCE OF THE IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM \& European Frequency and Time Forum}, event_date = {13-17 April 2015}, language = {30}, DOI = {10.1109/FCS.2015.7138785}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Affolderbach, C. and Du, G.-X. and Bandi, T. and Horsley, A. and Treutlein, P. and Mileti, G.} } @Proceedings { , title = {Provisional Assessment of Candidate High-Temperature Thermal Conductivity Reference Materials in the EMRP “Thermo” Project}, journal = {32nd International Thermal Conductivity Conference and 20th International Thermal Expansion Symposium}, year = {2015}, volume = {N/A}, number = {N/A}, number2 = {SIB52: Thermo: Metrology for thermal protection materials}, pages = {142-153}, keywords = {thermal conductivity, reference material, provisional assessment, high temperature, dimensional stability, mechanical stability, chemical stability, uniformity}, web_url = {http://docs.lib.purdue.edu/thermal/2014/steady/5/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Purdue University Press}, address = {West Lafayette, IN, USA}, event_place = {Purdue University, West Lafayette, Indiana, USA}, event_name = {32nd International Thermal Conductivity Conference}, event_date = {Apr. 27 - May 1, 2014}, language = {30}, ISBN = {Print ISBN: 978-1-62671-050-4; ePUB ISBN: 978-1-62671-051-1; ePDF ISBN: 978-1-62671-052-8}, ISSN = {N/A}, DOI = {10.5703/1288284315555}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wu, J. and Morrell, R. and Fry, T. and Gnaniah, S. and Dohil, D. and Dawson, A. and Hameury, J. and Koenen, A. and Hammerschmidt, U. and Turz{\'o}-Andr{\'a}s, E. and Strnad, R. and Blahut, A.} } @Article { , title = {Development of on-line FTIR spectroscopy for siloxane detection in biogas to enhance carbon contactor management}, journal = {Tantala}, year = {2015}, volume = {141}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {128-36}, keywords = {Adsorption; Biogas; CHP; Interference; Landfill; VOCs}, tags = {EnG}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/25966392}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.talanta.2015.03.063}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hepburn, C. A. and Vale, P and Brown, A. S. and Simms, N. J. and McAdam, E. J.} } @Proceedings { , title = {Measurement requirements for biogas specifications}, journal = {17 International Congress of Metrology}, year = {2015}, number2 = {ENG54: Biogas: Metrology for biogas}, keywords = {Biogas}, tags = {EnG}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08006.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {17 International Congress of Metrology}, event_date = {21 September 2015}, language = {30}, DOI = {10.1051/metrology/201508006}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {van der Veen, Adriaan M. H. and Brown, Andrew S. and Heinonen, Martti and Murugan, Arul and Haloua, Frederique and Arrhenius, Karine and Li, Jianrong} } @Article { , title = {Goniochromatic and Sparkle properties of effect pigmented samples in multidimensional configuration}, journal = {Proceedings of SPIE}, year = {2015}, volume = {9398}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {93980O}, keywords = {Goniochromatism; Effect Pigments; Multidimensional; Sparkle; Graininess}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2208034}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, address = {Bellingham}, language = {30}, ISSN = {0277-786X}, DOI = {10.1117/12.2078727}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}pe, A. and Hauer, K. O. and Teichert, S. and Hunerhoff, D. and Strothk{\"a}mper, C.} } @Proceedings { , title = {Measuring and specifying goniochromatic colors}, journal = {Proceedings of 23rd Congress of the International Commission for Optics}, year = {2015}, volume = {1}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1}, keywords = {Goniochormatism, Color measurements, BRDF}, web_url = {http://hdl.handle.net/10261/111907}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {International Commission for Optics}, address = {Orlando}, event_place = {Santiago de Compostela, Spain}, event_name = {23rd Congress of the International Commission for Optics}, event_date = {26-29/08/2014}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ferrero, A. and Campos, J. and Perales, E. and Rabal, A. and Mart{\'i}nez-Verd{\'u}, F. and Pons, A. and Chorro, E. and Hernanz, M.L.} } @Article { , title = {Comparison of Molecular Iodine Spectral Properties at 514.7 and 532 nm Wavelengths}, journal = {Measurement Science Review}, year = {2015}, volume = {14}, number = {4}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {10.2478, p 213-218}, keywords = {laser spectroscopy, metrology, molecular iodine, absorption cells, frequency doubling, interferometry}, web_url = {http://www.degruyter.com/view/j/msr.2014.14.issue-4/msr-2014-0029/msr-2014-0029.xml}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {De Gruyter Open Sp. z o.o.}, address = {Berlin}, language = {30}, DOI = {10.2748/msr-2014-0029}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hrabina, J. and Acef, O. and du Burck, F. and Chiodo, N. and Candela, Y. and Sarbort, M. and Hola, M. and Lazar, J.} } @Proceedings { , title = {Towards traceability in scatterometric-optical dimensional metrology for optical lithography}, journal = {DGaO-Proceedings}, year = {2015}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, web_url = {http://www.dgao-proceedings.de}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Eindhoven, The Netherlands}, event_name = {113th annual meeting of the DGaO}, event_date = {29 May - 1 June 2012}, language = {30}, ISSN = {1614-8436}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bodermann, Bernd and Endres, Johannes and Gro{\ss}, Hermann and Henn, Mark-Alexander and Kato, Akiko and Scholze, Frank and Wurm, Matthias} } @Proceedings { , title = {The effect of line roughness on DUV scatterometry.}, journal = {Proc SPIE}, year = {2015}, volume = {8789}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, Optical metrology, Line edge roughness}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Munich, Germany}, event_name = {SPIE Modelling Aspects in Optical Metrology IV}, event_date = {May 13, 2013}, language = {30}, DOI = {10.1117/12.2020761}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Henn, M.-A. and Heidenreich, S. and Gro{\ss}, H. and Bodermann, B. and Baer, M.} } @Proceedings { , title = {Measurement comparison of goniometric scatterometry and coherent Fourier scatterometry}, journal = {Proc SPIE}, year = {2015}, volume = {9132}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, CD, pitch, inverse diffraction problem}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brussels, Belgium}, event_name = {SPIE Optical Micro- and Nanometrology V}, event_date = {April 14, 2014}, language = {30}, DOI = {10.1117/12.2052819}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Endres, J. and Kumar, N. and Petrik, P. and Henn, M.-A. and Heidenreich, S. and Pereira, S. F. and Urbach, H. P. and Bodermann, B.} } @Proceedings { , title = {Two-Way Coherent Frequency Transfer in a Commercial DWDM Communication Network in Sweden}, journal = {Frequency Control Symposium \& the European Frequency and Time Forum (FCS), 2015 Joint Conference of the IEEE International}, year = {2015}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {276-279}, keywords = {Frequency transfer, Optical fiber network, Optical fiber, DWDM.}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?reload=true\&arnumber=7138840}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IEEE}, event_place = {Denver, CO}, event_date = {12-16 April 2015}, language = {30}, ISBN = {978-1-4799-8865-5}, DOI = {10.1109/FCS.2015.7138840}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ebenhag, S.-C. and Zelan, M. and Hedekvist, P. O. and Karlsson, M. and Josefsson, B.} } @Proceedings { , title = {Nanometrology on Gratings with GISAXS: FEM Reconstruction and Fourier Analysis}, journal = {Proc SPIE}, year = {2015}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {optical metrology, computational lithography, nite element method, grazing incidence scatterometry, electron beam lithography, Fourier transformation}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Jose, California, United States}, event_name = {SPIE Metrology, Inspection, and Process Control for Microlithography XXVII}, event_date = {February 23, 2014}, language = {30}, DOI = {10.1117/12.2046212}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Soltwisch, V. and Wernecke, J. and Haase, A. and Probst, J. and Schoengen, M. and Krumrey, M. and Scholze, F.} } @Proceedings { , title = {Determination of line profiles on photomasks using DUV, EUV and X-ray scattering}, journal = {Proc SPIE}, year = {2015}, volume = {9231}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {scatterometry, GISAXS, EUV-scatterometry, line structure}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Dresden, Germany}, event_name = {30th European Mask and Lithography Conference}, event_date = {June 24, 2014}, language = {30}, DOI = {10.1117/12.2065941}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Scholze, F. and Bodermann, B. and Burger, S. and Endres, J. and Haase, A. and Krumrey, M. and Laubis, C. and Soltwisch, V. and Ullrich, A. and Wernecke, J.} } @Proceedings { , title = {Development of a scatterometry reference standard}, journal = {Proc SPIE}, year = {2015}, volume = {9132}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, CD metrology, traceability, reference standard, tool matching, AFM, SEM, rigorous modelling}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brussels, Belgium}, event_name = {SPIE Optical Micro- and Nanometrology V}, event_date = {April 14, 2014}, language = {30}, DOI = {10.1117/12.2052278}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bodermann, B. and Loechel, B. and Scholze, F. and Dai, G. and Wernecke, J. and Endres, J. and Probst, J. and Schoengen, M. and Krumrey, M. and Hansen, P.-E. and Soltwisch, V.} } @Proceedings { , title = {hp-finite element method for simulating light scattering from complex 3D structures}, journal = {Proc SPIE}, year = {2015}, volume = {9424}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, optical metrology, computational metrology, computational lithography, 3D rigorous electromagnetic field simulations, finite-element methods, hp-FEM}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Jose, California, United States}, event_name = {Metrology, Inspection, and Process Control for Microlithography XXIX}, event_date = {February 22, 2015}, language = {30}, DOI = {10.1117/12.2085795}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Burger, S. and Zschiedrich, L. and Pomplun, J. and Herrmann, S. and Schmidt, F.} } @Article { , title = {Low contact resistance in epitaxial graphene devices for quantum metrology}, journal = {Low contact resistance in epitaxial graphene devices}, year = {2015}, volume = {5}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {087134}, keywords = {epitaxial graphene, monolayer, measurement, Quantum Hall, bilayer, graphene, chemical sciences, Kemi}, web_url = {http://urn.kb.se/resolve?urn=urn:nbn:se:liu:diva-122071}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AMER INST PHYSICS}, language = {30}, DOI = {10.1063/1.4928653}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yager, T. and Lartsev, A. and Cedergren, K. and Yakimova, R. and Panchal, V. and Kazakova, O. and Tzalenchuk, A. and Ho Kim, K. and Woo Park, Y. and Lara-Avila, S. and Kubatkin, S.} } @Proceedings { , title = {Design and Analysis of a Verification Device for the Nonlinear Vector Network Analyzer}, journal = {Proceedings 85th ARFTG Conference}, year = {2015}, volume = {85}, number = {1}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Verification device, Network analyzer, NVNA, LSNA, Verification of calibration, Traceability}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7162895\&isnumber=7162886}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Phoenix, Arizona, USA}, event_name = {85th ARFTG Microwave Measurement Conference}, event_date = {22-05-2015}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, DOI = {10.1109/ARFTG.2015.7162895}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7162895\&isnumber=7162886}, author = {Rajabi, M. and Humphreys, D. A. and Nielsen, T. and Barmuta, P. and Schreurs, D.} } @Article { , title = {A coherent population trapping Cs vapor cell atomic clock based on push-pull optical pumping}, journal = {Journal of Applied Physics}, year = {2015}, volume = {118}, number = {--}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {124903}, keywords = {time and frequency, vapor cell clock, frequency stability, push-pull optical pumping, CPT}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP}, address = {-}, language = {30}, ISSN = {0021-8979}, DOI = {10.1063/1.4931768}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hafiz, M A and Boudot, R} } @Article { , title = {Methoden der Zellz{\"a}hlung - Referenzverfahren zur Messung von Stammzellkonzentrationen}, journal = {BIOspektrum Wissenschaft Special Durchflusszytometrie}, year = {2015}, volume = {21. Jahrgang}, number = {03.15}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {294-297}, keywords = {quantitative measurement, cell counting, stem cells, reference procedure}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Science+Business Media (ed.)}, address = {Berlin, Heidelberg, Luxembourg}, language = {43}, ISSN = {-}, DOI = {10.1007/s12268-015-0577-8}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Neukammer, J. and Kammel, M. and H{\"o}ckner, J. and Kummrow, A. and Ruf, A.} } @Inbook { , title = {Noncontact Atomic Force Microscopy Volume 3 Chapter 3: Simultaneous nc-AFM/STM Measurements with Atomic Resolution}, year = {2015}, volume = {3}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {29-24}, keywords = {AFM/STM measurements}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer International Publishing Switzerland}, booktitle = {Noncontact Atomic Force Microscopy}, language = {30}, ISBN = {978-3-319-15587-6}, DOI = {10.1007/978-3-319-15588-3_3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hapala, P. and Ondr{\'a}cek, M. and Stetsovych, O. and Švec, M. and Jel{\'i}nek, P.} } @Proceedings { , title = {20 kV AC Divider with Ratio Correction}, journal = {ISH COLLECTION at eCIGRE, ref. ISH2015_520,}, year = {2015}, volume = {The 19th International Symposium on High Voltage Engineering}, number = {ISH COLLECTION at eCIGRE}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {ISH2015_520}, keywords = {high voltage, divider}, tags = {SEG}, web_url = {http://www.e-cigre.org/Order/select.asp?ID=1706529}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Council on Large Electric Systems, CIGRE}, address = {Paris, France}, event_place = {Pilsen, Czech Republic}, event_name = {The 19th International Symposium on High Voltage Engineering}, event_date = {23-08-2015 to 28-08-2015}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.e-cigre.org/Order/select.asp?ID=1706529}, author = {Hlavacek, J. and Draxler, K. and Styblikova, R.} } @Article { , title = {Application of Satellite-Based Spectrally-Resolved Solar Radiation Data to PV Performance Studies}, journal = {Energies}, year = {2015}, volume = {8}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {3455-3488}, keywords = {photovoltaic performance; spectral response; solar spectrum}, web_url = {http://www.mdpi.com/1996-1073/8/5/3455/pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {MDPI}, address = {Basel, Switzerland}, language = {30}, ISSN = {ISSN 1996-1073}, DOI = {10.3390/en8053455}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Gracia Amillo, A. and Huld, T. and Vourlioti, P. and Mueller, R. and Norton, M.} } @Article { , title = {Estimating PV Module Performance over Large Geographical Regions: The Role of Irradiance, Air Temperature, Wind Speed and Solar Spectrum}, journal = {Energies}, year = {2015}, volume = {8}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {5159-5181}, keywords = {photovoltaic performance; energy rating; solar spectrum}, web_url = {http://www.mdpi.com/1996-1073/8/6/5159}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {MDPI}, address = {Basel, Switzerland}, language = {30}, ISSN = {1996-1073}, DOI = {10.3390/en8065159}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huld, T. and Gracia Amillo, A.} } @Article { ChenHG2015, title = {Microwaves and low dimension carbon: Characterisation and applications}, journal = {2015 IEEE MTT-S International Microwave Workshop...}, year = {2015}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Graphene, Substrates, Resonant frequency, Microwave amplifiers, Dielectrics, Microwave oscillator, NEMS, Dielectric microwave resonators, graphene, carbon nanotubes}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {US \& Canada}, language = {30}, DOI = {10.1109/IMWS-AMP.2015.7324929}, stag_bib_extends_levelofaccess = {NA}, author = {Chen, Jie and Hao, Ling and Gallop, John} } @Article { LALEREHFCP2015, title = {D{\'e}veloppement et validation d’une m{\'e}thode de r{\'e}f{\'e}rence pour l’analyse des HAP dans l’eau totale dans le contexte de la DCE}, journal = {Revue fran\c{c}aise de m{\'e}trologie}, year = {2015}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {3-12}, keywords = {HAP, m{\'e}thode de r{\'e}f{\'e}rence, limite de quantification, incertitude, spe disque}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {EDP Sciences}, language = {37}, ISSN = {1772-1792, 1776-3215}, DOI = {10.1051/rfm/2015014}, stag_bib_extends_levelofaccess = {NA}, author = {Lal{\`e}re, B. and Hein, S. and FALLOT, C. and Cabillic, J. and Philipp, R.} } @Article { PeltolaVHFHM2014, title = {Frequency-comb-referenced mid-infrared source for high-precision spectroscopy}, journal = {Optics Express}, year = {2014}, month = {12}, day = {23}, volume = {22}, number = {26}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {32429-32439}, keywords = {optical parametric oscillator, cavity-ring-down spectroscopy, nitrous oxide, water vapor, methane}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW Washington DC 20036-1023, USA}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.22.032429}, stag_bib_extends_levelofaccess = {NA}, author = {Peltola, Jari and Vainio, Markku and Hieta, Tuomas and Fordell, Thomas and Halonen, Lauri and Merimaa, Mikko} } @Proceedings { , title = {Overview of EMRP Joint Research Project NEW06 ''Traceability for computationally-intensive metrology''}, journal = {Advanced Mathematical and Computational Tools in Metrology and Testing X}, year = {2014}, month = {12}, day = {22}, volume = {AMCTM 2014}, number = {86}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {164-170}, keywords = {Traceability, software validation}, tags = {MAT}, web_url = {http://www.npl.co.uk/content/ConPublication/6699}, web_url2 = {http://www.worldscientific.com/doi/pdf/10.1142/9789814678629_0019}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {World Scientific Publishing}, address = {Singapore}, event_place = {St Petersburg, Russia}, event_name = {Advanced Mathematical and Computational Tools in Metrology and Testing X}, event_date = {10-09-2014 to 12-09-2014}, language = {30}, ISBN = {9789814678612}, DOI = {10.1142/9789814678629_0019}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Forbes, ABF and Smith, IMS and H{\"a}rtig, FH and Wendt, KW} } @Article { YunDHdG2014, title = {Constructive polarization modulation for coherent population trapping clock}, journal = {Applied Physics Letters}, year = {2014}, month = {12}, day = {9}, volume = {105}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, DOI = {10.1063/1.4903862}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Yun, Peter and Danet, Jean-Marie and Holleville, David and de Clercq, Emeric and Guerandel, Stephane} } @Article { , title = {Micro-flow facility for traceability in steady and pulsating flow}, journal = {Flow measurement and instrumentation}, year = {2014}, month = {12}, day = {8}, volume = {44}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {34-42}, keywords = {Micro-flow, Liquid, Dynamic, gravimetric, calibration, Pulsating flow}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1016/j.flowmeasinst.2014.11.008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bissig, H. and Tschannen, M. and Huu, M. de} } @Article { , title = {Partitioning of on-demand electron pairs}, journal = {Nature Nanotechnology}, year = {2014}, month = {12}, day = {1}, volume = {10}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {46-49}, web_url = {http://www.nature.com/nnano/journal/v10/n1/full/nnano.2014.275.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1038/nnano.2014.275}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ubbelohde, N. and Hohls, F. and Kashcheyevs, V. and Wagner, T. and Fricke, L. and K{\"a}stner, B. and Pierz, K. and Schumacher, H. W. and Haug, R. J.} } @Article { , title = {Moisture measurement setup for wood based materials}, journal = {NCSLI Measure J. Meas. Sci.}, year = {2014}, month = {12}, volume = {9}, number = {4}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {56-60}, web_url = {http://www.ncsli.org/I/mj/dfiles/NCSLI_Measure_2014_December.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ojanen, M. and Sairanen, H. and Riski, K. and Kajastie, H. and Heinonen, M.} } @Article { GraciaAmilloHM2014, title = {Mapping the Performance of PV Modules: the Influence of Irradiance, Temperature, Wind and Spectral Variations}, journal = {Proceedings EUPVSEC 2014, Amsterdam, Netherlands}, year = {2014}, month = {12}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {2290 - 2295}, keywords = {Energy Rating, Modelling / Modeling, PV Performance}, web_url = {https://www.eupvsec-proceedings.com/proceedings?fulltext=Huld\&paper=27807}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {WIP}, address = {Munich}, language = {30}, DOI = {10.4229/EUPVSEC20142014-5CO.5.2}, stag_bib_extends_levelofaccess = {NA}, author = {Gracia Amillo, A. and Huld, T. and M{\"u}ller, R.} } @Article { HapalaTSJ2014, title = {Origin of High-Resolution IETS-STM Images of Organic Molecules with Functionalized Tips}, journal = {Physical Review Letters}, year = {2014}, month = {11}, day = {28}, volume = {PRL 113}, number = {226101}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {226101-1 - 226101-5}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, DOI = {10.1103/PhysRevLett.113.226101}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hapala, Prokop and Temirov, Ruslan and Stefan Tautz, F. and Jel{\'i}nek, Pavel} } @Article { , title = {Optical characterisation of patterned thin films}, journal = {Thin Solid Films}, year = {2014}, month = {11}, day = {28}, volume = {571}, number = {3}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {601-604}, keywords = {Spectroscopic imaging and mapping ellipsometry, Inhomogeneous and patterned thin films, SiO2, Photoresist}, web_url = {http://www.sciencedirect.com/science/article/pii/S0040609013019056}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, language = {30}, ISSN = {0040-6090}, DOI = {10.1016/j.tsf.2013.11.052}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rosu, DR and Petrik, PP and Rattmann, GR and Schellenberger, MS and Beck, UB and Hertwig, AH} } @Article { RastelloDSKCPSMIKSHKTBMPTACMKV2014, title = {Metrology for industrial quantum communications: the MIQC project}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {10}, keywords = {Metrology, quantum cryptography, quantum communication}, web_url = {http://iopscience.iop.org/0026-1394/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S267}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rastello, M L and Degiovanni, I P and Sinclair, A G and K{\"u}ck, S and Chunnilall, C J and Porrovecchio, G and Smid, M and Manoocheri, F and Ikonen, E and Kubarsepp, T and Stucki, D and Hong, K S and Kim, S K and Tosi, A and Brida, G and Meda, A and Piacentini, F and Traina, P and Al Natsheh, A and Cheung, J Y and M{\"u}ller, I and Klein, R and Vaigu, A} } @Article { ChunnilallLAHS2014, title = {Traceable metrology for characterizing quantum optical communication devices}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {10}, keywords = {Metrology, quantum key distribution, single-photon}, web_url = {http://iopscience.iop.org/0026-1394/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S258}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Chunnilall, C J and Lepert, G and Allerton, J J and Hart, C J and Sinclair, A G} } @Article { , title = {Design and Fabrication of Coupled NanoSQUIDs and NEMS}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2014}, month = {11}, day = {20}, volume = {25}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1602604}, keywords = {SQUIDs, nanoscale Dayem bridges, nanoSUQID, metrology}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6960081\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fxpls\%2Fabs_all.jsp\%3Farnumber\%3D6960081}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2371696}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bechstein, S and Ruede, F and Drung, D and Storm, J.-H. and K{\"o}hn, C and Kieler, O. F. and Kohlmann, J. and Weimann, T. and Patel, T and Li, B and Cox, D and Gallop, J. C. and Hao, L. and Schurig, T} } @Article { , title = {Characterization of thin film thickness}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {S302-S308}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/51/6/S302/meta}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S302}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pourjamal, SP and M{\"a}ntynen, HM and Jaanson, PJ and Rosu, DMR and Hertwig, AH and Manoocheri, FM and Ikonen, EI} } @Article { , title = {New source and detector technology for the realization of photometric units}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry}, pages = {197-202}, keywords = {candela photometry radiometry}, web_url = {http://iopscience.iop.org/journal/0026-1394}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0195-928X}, DOI = {10.1088/0026-1394/51/6/S276}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Timo D{\"o}nsberg, T. and Tomi Pulli, T. and Tuomas Poikonen, T. and Hans Baumgartner, H. and Anna Vaskuri, A. and Meelis Sildoja, M. and Farshid Manoocheri, F. and Petri K{\"a}rh{\"a}, P. and Erkki Ikonen, E.} } @Article { , title = {A compact, robust, and transportable ultra-stable laser with a fractional frequency instability of 10\verb=^=-15}, journal = {Review of Scientific Instruments}, year = {2014}, month = {11}, day = {12}, volume = {85}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0034-6748}, DOI = {10.1063/1.4898334}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Chen, Q.-F. and Nevsky, A. and Cardace, M. and Schiller, S. and Legero, T. and H{\"a}fner, S. and Uhde, A. and Sterr, U.} } @Article { BeqiriWHM2014, title = {Comparison between simulated decoupling regimes for specific absorption rate prediction in parallel transmit MRI}, journal = {Magnetic Resonance in Medicine}, year = {2014}, month = {11}, day = {4}, volume = {Early View}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {SAR; modeling; parallel transmission}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {1522-2594}, DOI = {10.1002/mrm.25504}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Beqiri, Arian and W. Hand, Jeffrey and Hajnal, Joseph V. and Malik, Shaihan J.} } @Proceedings { , title = {Connection repeatability of cross-connected waveguide verification standards for millimeter-wave vector network analysis}, journal = {Asia-Pacific Microwave Conference 2014 (APMC 2014)}, year = {2014}, month = {11}, day = {4}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {TH3G-09}, keywords = {Measurement repeatability, cross-connected waveguide, verification standards, attenuation standards, VNAs, millimeter-wave measurements.}, web_url = {http://ieeexplore.ieee.org/document/7067875/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {The Institute of Electronics, Information and Communication Engineers (IEICE)}, address = {Tokyo, Japan}, event_place = {Sendai, Japan}, event_name = {Asia-Pacific Microwave Conference 2014 (APMC 2014)}, event_date = {04-11-2014 to 07-11-2014}, language = {30}, ISBN = {978-4-9023-3931-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7067875}, author = {Huang, H. and Ridler, N. M. and Salter, M. J.} } @Article { MaringerSKCPGCDVHRMSJDTAHM2014, title = {Radioactive waste management: Review on clearance levelsand acceptance criteria legislation, requirements and standards}, journal = {Applied Radiation and Isotopes}, year = {2014}, month = {11}, volume = {81}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, keywords = {Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal}, web_url = {http://www.sciencedirect.com/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2013.03.046}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Maringer, F.J. and Šur{\'a}ň, J. and Kov{\'a}ř, P. and Chauvenet, B. and Peyres, V. and Garc{\'i}a-Tora{\~n}o, E. and Cozzella, M.L. and De Felice, P. and Vodenik, B. and Hult, M. and Roseng{\aa}rd, U. and Merimaa, M. and Sz{\"u}cs, L. and Jeffery, C. and Dean, J.C.J. and Tymińsk, Z. and Arnold, D. and Hincam, R. and Mirescu, G.} } @Article { ZilbertiBCHLC2014, title = {Collateral Thermal Effect of MRI-LINAC Gradient Coils on Metallic Hip Prostheses}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2014}, month = {11}, volume = {50}, number = {11}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, keywords = {Dosimetry, finite element–boundary element method, magnetic resonance imaging (MRI), medical implants, Pennes’ bioheat equation.}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2323119}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zilberti, Luca and Bottauscio, Oriano and Chiampi, Mario and Hand, Jeff and Lopez, Hector Sanchez and Crozier, Stuart} } @Article { , title = {Investigating the Intrinsic Noise Limit of Dayem Bridge NanoSQUIDs}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2014}, month = {10}, day = {24}, volume = {25}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1602105}, keywords = {SQUIDs, Noise, Junctions, Critical current density (superconductivity), Nanoscale devices, Preamplifiers, Niobium}, web_url = {http://ieeexplore.ieee.org/document/6936295/?reload=true\&arnumber=6936295}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {Melville}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2014.2364920}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Patel, T and Li, B and Gallop, J and Cox, D and Kirby, K and Romans, E and Chen, J and Nisbet, A and Hao, L} } @Article { , title = {Automated Extraction and Assessment of Functional Features of Areal Measured Microstructures Using a Segmentation-Based Evaluation Method}, journal = {Surface Topography: Metrology and Properties STMP}, year = {2014}, month = {10}, day = {20}, volume = {2}, number = {4}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {044001}, keywords = {Keywords, surface metrology, microstructure, segmentation techniques, function-oriented}, web_url = {http://iopscience.iop.org/article/10.1088/2051-672X/2/4/044001?fromSearchPage=true}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {2051-672X}, DOI = {10.1088/2051-672X/2/4/044001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hartmann, WH and Loderer, AL} } @Article { KramerMMKHB2014, title = {Experimental Verification of the Individual Energy Dependencies of the PartialL-Shell Photoionization Cross Sections of Pd and Mo}, journal = {Physical Review Letters}, year = {2014}, month = {10}, day = {13}, volume = {113}, number = {16}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, keywords = {Individual Energy Dependencies of the PartialL-Shell Photoionization Cross Sections Pd Mo}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.113.163001}, stag_bib_extends_levelofaccess = {NA}, author = {Kr{\"a}mer, M. and Mantler, M. and Muller, M. and Kolbe, M. and Honicke, P. and Beckhoff, B.} } @Article { , title = {Multimodal optical characterisation of collagen photodegradation by femtosecond infrared laser ablation†}, journal = {Analyst}, year = {2014}, month = {10}, day = {9}, volume = {Analyst 2014}, number = {139}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {6135-6143}, keywords = {N/A}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/25318007}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Royal Society of Chemistry}, address = {Picadilly UK}, language = {30}, ISSN = {0003-2654}, DOI = {10.1039/c4an01523a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Manickavasagam, M. and Hirvonen, L.M. and Melita, L.N. and Chong, E.Z. and Cook, R.J. and Bozec, L. and Festy, F.} } @Proceedings { , title = {Free-space Quasi-optical Spectrometer for Material Characterization in the 50-500 GHz Frequency Range}, year = {2014}, month = {10}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {636-639}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Rome, Italy}, event_name = {41st European Microwave Conference}, event_date = {06-09 October, 2014}, language = {30}, DOI = {10.1109/EuMC.2014.6986514}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kazemipour, A. and Hudlicka, M. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Proceedings { IvanovBDHATMS2014, title = {Experimental and numerical study of the microwave field distribution in a compact magnetron-type microwave cavity}, year = {2014}, month = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {208-211}, keywords = {atomic clock, microwave cavity, field imaging, optical pumping.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Neuchatel, Switzerland}, event_name = {28th European Frequency and Time Forum (EFTF)}, event_date = {22-26 June 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ivanov, A. and Bandi, T. and Du, G.-X. and Horsley, A. and Affolderbach, C. and Treutlein, P. and Mileti, G. and Skrivervik, A. K.} } @Article { , title = {Towards standardisation of cell-free DNA measurement in plasma: controls for extraction efficiency, fragment size bias and quantification}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, month = {10}, volume = {406}, number = {26}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {6499-6512}, keywords = {Cell-free DNA, Circulating nucleic acids, Clinical/biomedical analysis, Diagnostics, Liquid biopsy,Reference materials}, web_url = {http://link.springer.com/article/10.1007\%2Fs00216-014-7835-3}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer}, address = {Berlin}, language = {30}, ISSN = {1618-2650}, DOI = {10.1007/s00216-014-7835-3}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Devonshire, AS and Whale, AS and Gutteridge, A and Jones, G and Cowen, S and Foy, CA and Huggett, JF} } @Article { , title = {Technical Notes: A detailed study for the provision of measurement uncertainty and traceability for goniospectrometers}, journal = {Journal of Quantitative Spectroscopy and Radiative Transfer.}, year = {2014}, month = {10}, volume = {146}, number = {Electromagnetic and Light Scattering by Nonspherical Particles XIV}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {376-390}, keywords = {Bidirectional reflectance, BRF, Spectrum, Polarisation, Calibration}, web_url = {http://www.sciencedirect.com/science/article/pii/S0022407314001666}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier}, language = {30}, ISSN = {0022-4073}, DOI = {10.1016/j.jqsrt.2014.04.011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Peltoniemi, JIP and Hakala, TH and Suomalainen, JS and Honkavaara, EH and Markelin, LM and Gritsevich, MG and Eskelinen, JE and Jaanson, PJ and Ikonen, EI} } @Article { , title = {Future development of biologically relevant dosimetry}, journal = {British Journal of Radiology}, year = {2014}, month = {9}, day = {26}, volume = {88}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Radiation quantities, biologically relevant dosimetry, microbeam, nanodosimetry, microdosimetry, reactive species, BioQuaRT}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0007-1285}, DOI = {10.1259/bjr.20140392}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Palmans, H. and Rabus, H. and Belchior, A. L. and Bug, M. U. and Galer, S. and Giesen, U. and Gonon, G. and Gruel, G. and Hilgers, G. and Moro, D. and Nettelbeck, H. and Pinto, M. and Pola, A. and Pszona, S. and Schettino, G. and Sharpe, P. H. G. and Teles, P. and Villagrasa, C. and Wilkens, J. J.} } @Article { ChuBCGHSG2014, title = {Experimental realization of an optical antenna designed for collecting 99\% of photons}, journal = {Optica}, year = {2014}, month = {9}, day = {25}, volume = {1}, number = {4}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {203-208}, web_url = {http://www.opticsinfobase.org/optica/home.cfm}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.1.000203}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Chu, X.-L. and Brenner, T. J. K. and Chen, X.-W. and Ghosh, Y. and Hollingsworth, J. A. and Sandoghdar, V. and G{\"o}tzinger, S.} } @Article { , title = {Electron Flood Gun Damage Effects in 3D Secondary Ion Mass Spectrometry Imaging of Organics}, journal = {Journal of the American Society of Mass Spectrometry}, year = {2014}, month = {9}, day = {25}, volume = {25}, number = {9}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {1565-1571}, keywords = {Secondary ion mass spectrometry; depth profiling; argon cluster; damage; chemical metrology}, web_url = {http://link.springer.com/article/10.1007\%2Fs13361-014-0929-5\#page-2}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ASMS}, address = {Santa Fe USA}, language = {30}, DOI = {10.1007/s13361-014-0929-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-9-25}, author = {Havelund, R. and Seah, M.P. and Shard, A.G. and Gilmore, I.S.} } @Article { LafontRHCDCRBDSP2014, title = {Anomalous dissipation mechanism and Hall quantization limit in polycrystalline graphene grown by chemical vapor deposition}, journal = {Physical Review B}, year = {2014}, month = {9}, day = {18}, volume = {Phys. Rev. B 90, 115422}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1103/PhysRevB.90.115422}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lafont, F. and Ribeiro-Palau, R. and Han, Z. and Cresti, A. and Delvall{\'e}e, A. and Cummings, A. W. and Roche, S. and Bouchiat, V. and Ducourtieux, S. and Schopfer, F. and Poirier, W.} } @Proceedings { KazemipourHYSKS2014, title = {Wideband Frequency-Domain Material Characterization Up To 500 GHz}, year = {2014}, month = {9}, day = {14}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, web_url = {http://www.irmmw-thz2014.org/sites/default/files/M5-P7.12_Kazemipour.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {The University of Arizona, Tucson, AZ, USA}, event_name = {39th International Conference on Infrared, Millimeter, and THz Waves}, event_date = {September 14, 2014}, language = {English}, DOI = {10.1109/IRMMW-THz.2014.6956130}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hudlicka, M. and Yee, S.-K. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Proceedings { KazemipourSHKS2014, title = {Probe Correction For Near-Field Scanning With A Dielectric Fiber}, year = {2014}, month = {9}, day = {14}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, web_url = {http://www.irmmw-thz2014.org/sites/default/files/T2_B-17.5_Kazemipour.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {The University of Arizona, Tucson, AZ, USA}, event_name = {39th International Conference on Infrared, Millimeter, and THz Waves}, event_date = {September 14, 2014}, language = {English}, DOI = {10.1109/IRMMW-THz.2014.6956288}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Salhi, M. and Hudlicka, M. and Kleine-Ostmann, T. and Schraderr, T.} } @Article { , title = {G-SIMS analysis of organic solar cell materials}, journal = {Surface and Interface Analysis}, year = {2014}, month = {9}, day = {12}, volume = {1}, number = {46}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {96-99}, keywords = {TOF-SIMS, Gentle-SIMS (G-SIMS), organic solar cell, PC70BM, PCDTBT}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5650/full}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Wiley Online Library}, address = {New Jersey NYC}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.5650}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-9-12}, author = {Franquet, A. and Fleischmann, C. and Conard, T. and Voroshazi, E. and Poleunis, C. and Havelund, R. and Delcorte, A. and Vandervorst, W.} } @Article { , title = {Fabrication and Analogue Applications of NanoSQUIDs Using Dayem Bridge Junctions}, journal = {IEEE Journal of Selected Topics in Quantum Electronics}, year = {2014}, month = {9}, day = {5}, volume = {21}, number = {2}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {9100108}, keywords = {SQUIDs, Junctions, Niobium, Temperature measurement, Noise, Critical current density (superconductivity), Temperature}, web_url = {http://ieeexplore.ieee.org/document/6892955/}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1077-260X}, DOI = {10.1109/JSTQE.2014.2354634}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hao, L and Gallop, J. C. and Cox, D. C. and Chen, J} } @Article { WeberSHBDEHLMMS2014, title = {Performance of a Wideband 200-kV HVDC Reference Divider Module}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2014}, month = {9}, volume = {63}, number = {9}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {2264-2270}, keywords = {Resistors, Voltage measurement, Capacitors, HVDC transmission, Uncertainty, Temperature measurement, Wideband}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2014.2304857}, stag_bib_extends_levelofaccess = {NA}, author = {Weber, C. and Suomalainen, E.P. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Dedeoğlu, S. and Elg, A.P. and Houtzager, E. and Lucas, W. and Merev, A. and Meisner, J. and Schmidt, M.} } @Article { KazemipourHDSKS2014_2, title = {The Horn Antenna as Gaussian-Source in the mm-Wave Domain}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2014}, month = {9}, volume = {35}, number = {9}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {720-731}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {English}, ISSN = {1866-6892}, DOI = {10.1007/s10762-014-0077-9}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hudlicka, M. and Dickhoff, R. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Article { SairanenHHLK, title = {A Calibration System for Reference Radiosondes that Meets GRUAN Uncertainty Requirements}, journal = {NCSL Measure J. Meas. Sci.}, year = {2014}, month = {9}, volume = {9}, number = {3}, number2 = {ENV07: MeteoMet: Metrology for pressure,temperature,humidity and airspeed in the atmosphere}, web_url = {http://www.ncsli.org/I/mj/dfiles/NCSLI_Measure_2014_Sept.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {30}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Sairanen, Hannu and Heinonen, Martti and H{\"o}gstr{\"o}m, Richard and Lakka, Antti and Kajastie, Heikki} } @Article { , title = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene}, journal = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene}, year = {2014}, month = {9}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {hot carriers, bilayer graphene, energy loss rate, magnetotransport}, web_url = {http://arxiv.org/abs/1409.6267v1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1088/0953-8984/27/16/164202}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, J. and Alexander-Webber, J.A. and Janssen, T.J.B.M. and Tzalenchuk, A. and Yager, T. and Lara Avila, S. and Kubatkin, S. and Myers-Ward, R. L. and Gaskill, D. K. and Nicholas, R.J.} } @Proceedings { , title = {Validation of CMM evaluation software using TraCIM}, journal = {Advanced Mathematical and Computational Tools in Metrology and Testing X}, year = {2014}, month = {9}, volume = {2014}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {392-399}, keywords = {Software test, validation of least squares fit, substitute element, TraCIM}, tags = {MAT}, web_url = {https://www.researchgate.net/publication/277715647_Validation_of_CMM_evaluation_software_using_TraCIM}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {World Scientific Publishing}, address = {Singapore}, event_place = {St. Petersburg, Russia}, event_name = {AMCTM 2014 Advanced Mathematical and Computational Tools in Metrology and Testing}, event_date = {10-09-2014 to 12-09-2014}, language = {30}, ISBN = {978-981-4678-63-6}, DOI = {10.1142/9789814678629_0047}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Wendt, KW and Franke, MF and H{\"a}rtig, FH} } @Proceedings { , title = {Estimation of test uncertainty for TraCIM reference pairs}, journal = {Advanced Mathematical and Computational Tools in Metrology and Testing X}, year = {2014}, month = {9}, volume = {2014}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {1-8}, tags = {MAT}, web_url = {https://www.researchgate.net/publication/277715555_Estimation_of_Test_Uncertainty_for_TraCIM_Reference_Pairs}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {World Scientific Publishing}, address = {Singapore}, event_place = {St Petersburg, Russia}, event_name = {AMCTM 2014 Advanced Mathematical and Computational Tools in Metrology and Testing}, event_date = {10-09-2014 to 12-09-2014}, language = {30}, ISBN = {978-981-4678-63-6}, DOI = {10.1142/9789814678629_0022}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Keller, FK and Wendt, KW and H{\"a}rtig, FH} } @Proceedings { MolloyNH2014, title = {Effect of time-delay errors on THz spectroscopy dynamic range}, journal = {2014 39th International Conference on Infrared, Millimeter, and Terahertz waves (IRMMW-THz)}, year = {2014}, month = {9}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {Uncertainty, Laser excitation, Delays, Measurement by laser beam, Spectroscopy, Dynamic range}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, event_place = {Tucson, AZ, USA}, event_name = {39th International Conference on Infrared, Millimeter, and Terahertz waves (IRMMW-THz)}, event_date = {14-09-2014 to 19-09-2014}, language = {30}, DOI = {10.1109/IRMMW-THz.2014.6956138}, stag_bib_extends_levelofaccess = {NA}, author = {Molloy, J.F. and Naftaly, M. and Humphreys, D.A.} } @Article { WeiHLPSKHMN2014, title = {Temperature-Dependent Mollow Triplet Spectra from Single Quantum Dot: Rabi Frequency Renormalization and Sideband Linewidth Insensitivity}, journal = {Physical Review Letters}, year = {2014}, month = {8}, day = {28}, volume = {113}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {097401 [1-5]}, web_url = {http://journals.aps.org/prl/}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.113.097401}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Wei, Y-J and He, Y and Lu, C-Y and Pan, J-W and Schneider, C and Kamp, M and H{\"o}fling, S and McCutcheon, D P S and Nazir, A} } @Article { , title = {Ultrastable laser with average fractional frequency drift rate below 5 \(\times\) 10−19/s}, journal = {Optics Letters}, year = {2014}, month = {8}, day = {22}, volume = {39}, number = {17}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {5102 - 5105}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0146-9592}, DOI = {10.1364/OL.39.005102}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hagemann, C. and Grebing, C. and Lisdat, C. and Falke, St. and Legero, T. and Sterr, U. and Riehle, F. and Martin, M. J. and Ye, J.} } @Article { , title = {Biologically Weighted Quantities in Radiotherapy: an EMRP Joint Research Project}, journal = {EPJ Web of Conferences}, year = {2014}, month = {8}, day = {19}, volume = {77}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Radiation units, dose, microbeam, nanodosimetry, microdosimetry}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {2100-014X}, DOI = {10.1051/epjconf/20147700021}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rabus, H. and Palmans, H. and Hilgers, G. and Sharpe, P. and Pinto, M. and Villagrasa, C. and Nettelbeck, H. and Moro, D. and Pola, A. and Pszona, S. and Teles, P.} } @Article { , title = {Verifying the Functional Ability of Microstructured Surfaces by Model-Based Testing}, journal = {Measurement Science and Technology MST}, year = {2014}, month = {8}, day = {12}, volume = {25}, number = {9}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {094012}, web_url = {http://iopscience.iop.org/article/10.1088/0957-0233/25/9/094012/pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0957-0233/25/9/094012}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Weckenmann, AW and Hartmann, WH} } @Article { , title = {Nanodosimetric characterization of ion beams}, journal = {European Physics Journal D}, year = {2014}, month = {8}, day = {11}, volume = {68}, number = {217}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Nanodosimetry, track structure, biological effectiveness, radiation quantities}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1434-6060}, DOI = {10.1140/epjd/e2014-50015-9}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bug, Marion U. and Hilgers, Gerhard and Yong Bae, Woon and Rabus, Hans} } @Article { , title = {Surface Analytical Study of Poly(acrylic acid)-Grafted Microparticles (Beads): Characterization, Chemical Derivatization, and Quantification of Surface Carboxyl Groups}, journal = {The Journal of Physical Chemistry C}, year = {2014}, month = {8}, day = {8}, volume = {118}, number = {35}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, web_url = {http://pubs.acs.org/doi/abs/10.1021/jp505519g}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, ISSN = {1932-7447}, DOI = {10.1021/jp505519g}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Dietrich, P.M. and Hennig, A. and Holzweber, M. and Thiele, T. and Borcherding, H. and Lippitz, A. and Schedler, U. and Resch-Genger, U. and Unger, W. E. S.} } @Proceedings { SuomalainenMHBDEHLKLMNSW2014, title = {Performance of a modular wideband 1000 kV HVDC reference divider}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {HVDC transmission, Voltage measurement, Calibration, Uncertainty, Capacitance, Resistors, Accuracy}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {IEEE}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, event_date = {24-08-2014 to 29-08-2014}, language = {30}, DOI = {10.1109/CPEM.2014.6898619}, stag_bib_extends_levelofaccess = {NA}, author = {Suomalainen, E.P. and Meisner, J. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Dedeoğlu, S. and Elg, A.P. and Houtzager, E. and Lehtonen, T. and Kl{\"u}ss, J. and Lucas, W. and Merev, A. and Nieminen, T. and Schmidt, M. and Weber, C.} } @Proceedings { BergmanNKHE2014, title = {Traceability and characterization of a 1000 kV HVDC reference divider}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {Resistors, HVDC transmission, Calibration, Voltage measurement, Measurement uncertainty, Uncertainty, Resistance}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {IEEE}, event_place = {Rio de Janeiro, Brazil}, event_name = {9th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, event_date = {24-08-2014 to 29-08-2014}, language = {30}, DOI = {10.1109/CPEM.2014.6898618}, stag_bib_extends_levelofaccess = {NA}, author = {Bergman, A. and Nieminen, T. and Kharezy, M. and H{\"a}llstr{\"o}m, J. and Elg, A.P.} } @Proceedings { KazemipourHKS2014, title = {A Reliable Simple Method to Extract the Intrinsic Material Properties in Millimeter/Sub-millimeter Wave Domain}, year = {2014}, month = {8}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Rio de Janeiro, Brazil}, event_name = {Conference on Precision Electromagnetic Measurements 2014}, event_date = {24-29 August 2014}, language = {English}, DOI = {10.1109/CPEM.2014.6898516}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hudlicka, M. and Kleine-Ostmann, T. and Schrader, T.} } @Proceedings { RodriguezPLKKKHGCBABSUWW2014, title = {The EMRP project Metrology for III–V materials based high efficiency multi-junction solar cells}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, keywords = {Nanoscale electrical measurement Multijunction solar cells standards high conversion efficiency III-V materials characterization}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {25-08-2014 to 29-08-2014}, language = {30}, ISBN = {978-1-4799-2478-3}, ISSN = {no ISSN}, DOI = {10.1109/CPEM.2014.6898387}, stag_bib_extends_levelofaccess = {NA}, author = {Rodriguez, T. G. and Pollakowski, B. and Lackner, D. and Krupka, J. and Kienberger, F. and Kern, R. and Hoffmann, J. and Gambacorti, N. and Cuenat, A. and Baumgartner, H. and Almuneau, G. and Bounouh, A. and Sametoglu, F. and Usydus, L. and Winter, S. and Witt, F.} } @Proceedings { HumphreysHF2014, title = {Calibration of Wideband Digital Real-time Oscilloscopes}, year = {2014}, month = {8}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {698 to 699}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Rio de Janeiro, Brazil}, event_name = {Conference on Precision Electromagnetic Measurements 2014}, event_date = {24 to 29 August, 2014}, DOI = {10.1109/CPEM.2014.6898577}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Humphreys, David A and Hudlicka, Martin and Fatadin, Irshaad} } @Proceedings { , title = {Graphene metrology}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {662-663}, keywords = {C,Conductivity,Graphene,Metrology,Microwave measurement,Resistance,Silicon carbide,Substrates,electrical conductivity measurement,functional property,graphene,graphene metrology,graphene morphology,graphene topography,industrial production,joining processes,linking morphology,measurement standards,microwave materials,microwave measurement,noncontact microwave conductivity measurement,quality control,quantum Hall effect,rapid noninvasive quality control}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898559}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898559}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Giusca, C. and Gallop, J. and Hao, L. and Kazakova, O. and Panchal, V. and Pierce, R. and Tzalenchuk, A.} } @Proceedings { NaftalyH2014_2, title = {Dynamic range improvement of THz spectroscopy}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {Covariance matrix, Fourier transforms, frequency-domain measurements, Measurement uncertainty, Principal component analysis, time-domain measurements, Timing jitter, THz spectroscopy, uncertainty analysis}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, event_date = {24-08-2014 to 29-08-2014}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/CPEM.2014.6898580}, stag_bib_extends_levelofaccess = {NA}, author = {Naftaly, M. and Humphreys, D.A.} } @Article { , title = {Improved limit on a temporal variation of mp=me from comparisons of Yb+ and Cs atomic clocks}, journal = {Phys. Rev. Lett. 113}, year = {2014}, month = {7}, day = {17}, volume = {210802 (2014)}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {https://arxiv.org/abs/1407.4408}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Huntemann, N. and Lipphardt, B. and Tamm, C. and Gerginov, V. and Weyers, S. and Peik, E.} } @Article { , title = {Focused Ion Beam Processing of Superconducting Junctions and SQUID Based Devices}, journal = {Nanofabrication}, year = {2014}, month = {7}, day = {7}, volume = {1}, number = {1}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {53-64}, keywords = {Focused Ion beam, SQUID, Nanofabrication}, web_url = {http://www.degruyter.com/view/j/nanofab.2014.1.issue-1/nanofab-2014-0005/nanofab-2014-0005.xml}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {De Gruyter}, address = {Berlin}, language = {30}, ISSN = {2299-680X}, DOI = {10.2478/nanofab-2014-0005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Cox, D and Gallop, J and Hao, L} } @Proceedings { LeachWCH2014, title = {Interpreting the probe-surface interaction of surface measuring instruments, or what is a surface?}, journal = {Surface Topography: Metrology and Properties}, year = {2014}, month = {7}, day = {4}, volume = {2}, number = {035001}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, keywords = {surface topography, function, electromagnetic surface, mechanical surface, electrical surface}, web_url = {http://iopscience.iop.org/2051-672X/2/3/035001/pdf/STMP_2_3_035001.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Chamonix France}, event_name = {International Precision Engineering Seminar}, event_date = {13-19 Feb 2014}, language = {English}, DOI = {10.1088/2051-672X/2/3/035001}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Leach, R K and Weckenmann, A and Coupland, J M and Hartmann, W} } @Article { , title = {Stable isotope imaging of biological samples with high resolution secondary ion mass spectrometry and complementary techniques}, journal = {Methods}, year = {2014}, month = {7}, day = {1}, volume = {68}, number = {2}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {317-324}, keywords = {Stable isotope; NanoSIMS; Atomic force microscopy; Backscattered electron imaging; Correlative analysis}, web_url = {http://www.sciencedirect.com/science/article/pii/S1046202314000425}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier Inc.}, address = {Amsterdam}, language = {30}, DOI = {10.1016/j.ymeth.2014.02.012}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Jiang, H. and Favaro, E. and Goulbourne, C.N. and Rakowska, P.D. and Hughes, G.M. and Ryadnov, M.G. and Fong, L.G. and Young, S.G. and Ferguson, D.J.P. and Harris, A.L. and Grovenor, C.R.M.} } @Article { , title = {State of the Art Raman Techniques for Biological Applications}, journal = {Methods}, year = {2014}, month = {7}, day = {1}, volume = {68}, number = {2}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {338-347}, note = {Level of access: Yes It was confirmed by a later email (12/09/2016)}, keywords = {Raman spectroscopy, quantification, nonlinear optics, biomedical}, web_url = {http://www.sciencedirect.com/science/article/pii/S1046202314000905}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {1046-2023}, DOI = {10.1016/j.ymeth.2014.02.035}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Rae, A and Stosch, R and Klapetek, P and Hight Walker, A.R and Roy, D} } @Article { GraesslRHDWORKSLFPN2014, title = {Modular 32-Channel Transceiver Coil Array for Cardiac MRI at 7.0T}, journal = {Magnetic Resonance in Medicine}, year = {2014}, month = {7}, volume = {72}, number = {1}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {276 to 290}, keywords = {ultrahigh-field MRI; cardiovascular MRI; transceiver array; parallel imaging}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, ISSN = {1522-2594}, DOI = {10.1002/mrm.24903}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Graessl, Andreas and Renz, Wolfgang and Hezel, Fabian and Dieringer, Matthias A and Winter, Lukas and Oezerdem, Celal and Rieger, Jan and Kellman, Peter and Santoro, Davide and Lindel, Tomasz D and Frauenrath, Tobias and Pfeiffer, Harald and Niendorf, Thoralf} } @Article { HachisuFNGNIFHGLLP2014, title = {Direct comparison of optical lattice clocks with an intercontinental baseline of 9000 km}, journal = {Optics Letters}, year = {2014}, month = {7}, volume = {39}, number = {14}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {4072 to 4075}, web_url = {http://www.opticsinfobase.org/ol/abstract.cfm?URI=ol-39-14-4072}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, DOI = {10.1364/OL.39.004072}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hachisu, H and Fujieda, M and Nagano, S and Gotoh, T and Nogami, A and Ido, T and Falke, S and Huntemann, N and Grebing, C and Lipphardt, B and Lisdat, C and Piester, D} } @Article { FalkeLGLWGHHAHVSL2014, title = {A strontium lattice clock with 3 x 10\verb=^=-17 inaccuracy and its frequency}, journal = {New Journal of Physics}, year = {2014}, month = {7}, volume = {16}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {073023}, web_url = {http://iopscience.iop.org/1367-2630/16/7/073023}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, DOI = {10.1088/1367-2630/16/7/073023}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Falke, S and Lemke, N and Grebing, C and Lipphardt, B and Weyers, S and Gerginov, V and Huntemann, N and Hagemann, C and Al-Masoudi, A and Haefner, S and Vogt, S and Sterr, U and Lisdat, C} } @Article { , title = {Self-Referenced Single-Electron Quantized Current Source}, journal = {Physical Review Letters}, year = {2014}, month = {6}, day = {6}, volume = {112}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0031-9007/14/112(22)/226803(5)}, DOI = {10.1103/PhysRevLett.112.226803}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Fricke, L. and Wulf, M. and Kaestner, B. and Hohls, F. and Mirovsky, Ph. and Mackrodt, B. and Dolata, R. and Weimann, Th. and Pierz, K. and Siegner, U. and Schumacher, H. W.} } @Proceedings { , title = {Study of calibration standards for extreme impedances measurement}, journal = {Proc. of the 83rd Microwave Measurement Conference (ARFTG)}, year = {2014}, month = {6}, day = {6}, volume = {n/a}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-6}, keywords = {calibration, APC-7 coaxial microwave connector, CST Microwave Studio, attofarad varactors, calibration standards, carbon nanotubes, extreme impedance measurement}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6899512\&isnumber=6899500}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Tampa, Florida, USA}, event_name = {83rd Microwave Measurement Conference (ARFTG)}, event_date = {6 June 2014}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/ARFTG.2014.6899512}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Haase, Martin and Hoffmann, Karel} } @Proceedings { , title = {Using Electromagnetic Modeling to Evaluate Uncertainty in a Millimeter-wave Cross-guide Verification Standard}, journal = {83rd ARFTG Microwave Measurement Conference (ARFTG), 2014}, year = {2014}, month = {6}, day = {6}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {N/A}, keywords = {Uncertainty, Traceability, Cross-guide, Transmission loss measurements, Verification standard, Electromagnetic modeling, Millimeter-wave measurements.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6899523}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, USA}, event_place = {Tampa, Florida, USA}, event_name = {83rd ARFTG Microwave Measurement Conference (ARFTG)}, event_date = {06-06-2014 to 06-06-2014}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, DOI = {10.1109/ARFTG.2014.6899523}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, H. and Ridler, N. M. and Salter, M. J.} } @Proceedings { , title = {Progress in the soft metrology of appearance: the contribution of digital image representations}, journal = {SID Display Week 2014}, year = {2014}, month = {6}, day = {5}, volume = {NA}, number = {NA}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {4 pages / Article 42.3}, keywords = {Appearance, Gloss, Soft metrology}, web_url = {http://displayweek.org/Portals/5/20140520\%20Display\%20Week\%20Symposium\%20Program.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Society for Information Display (SID)}, address = {Campbell, USA}, event_place = {San Diego, USA}, event_name = {Display Week 2014}, event_date = {3-6 June 2014}, language = {30}, ISBN = {NA}, ISSN = {2154-6746}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Leloup, F. B. and Hanselaer, P.} } @Article { , title = {The Ion Counter and the StarTrack Counter: consistent nanodosimetry of track structure for carbon ions}, journal = {INFN-LNL Report}, year = {2014}, month = {6}, day = {1}, volume = {241}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {134-165}, keywords = {Ion beam dosimetry, nanodosimetry, track structure}, web_url = {www.lnl.infn.it/\verb=~=annrep/read_ar/2014/contributions/pdfs/164_E_57_D052.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1828-8561}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Conte, V. and Moro, D. and Colautti, P. and Grosswendt, B. and Hilgers, G. and Rabus, H.} } @Article { , title = {The Metrology of Directional, Spectral Reflectance Factor Measurements Based on Area Format Imaging by UAVs}, journal = {PFG Photogrammetrie, Fernerkundung, Geoinformation}, year = {2014}, month = {6}, day = {1}, volume = {Jahrgang 2014}, number = {3}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {175 - 188}, keywords = {hyperspectral, metrology, radiometry, reflectance, unmanned airborne vehicle}, web_url = {http://www.schweizerbart.de/papers/pfg/detail/2014/82817/The_Metrology_of_Directional_Spectral_Reflectance_Factor_Measurements_Based_on_Area_Format_Imaging_by_UAVs?af=search}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {E Schweizerbart Science Publishers}, address = {Stuttgart}, language = {30}, ISSN = {1432-8364}, DOI = {10.1127/1432-8364/2014/0218}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Honkavaara, EH and Markelin, LM and Hakala, TH and Peltoniemi, JP} } @Article { , title = {Universal Equation for Argon Cluster Size-Dependence of Secondary Ion Spectra in SIMS of Organic Materials}, journal = {The Journal of Physical Chemistry C}, year = {2014}, month = {5}, day = {26}, volume = {118}, number = {24}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {12862–12872}, keywords = {ALQ3, FMOC, GCIB, Irganox, organic electronics, organics, SIMS}, web_url = {http://pubs.acs.org/doi/abs/10.1021/jp502646s}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ACS}, address = {Washington DC}, language = {30}, ISSN = {1932-7447}, DOI = {10.1021/jp502646s}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Seah, M.P. and Havelund, R. and Gilmore, I.S.} } @Article { ByunKBHSOCYCBSSCSP2014, title = {Electrical control of nanoscale functionalization in graphene by the scanning probe technique}, journal = {NPG Asia Materials (2014) 6}, year = {2014}, month = {5}, day = {23}, volume = {102}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {atomic force microscopy lithography; graphene; graphene functionalization; graphene hydrogenation; graphene oxidation; scanning photoelectron microscope; X-ray photoemission spectroscopy}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1038/am.2014.24}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Byun, Ik-Su and Kim, Wondong and Boukhvalov, Danil W and Hwang, Inrok and Son, Jong Wan and Oh, Gwangtaek and Choi, Jin Sik and Yoon, Duhee and Cheong, Hyeonsik and Baik, Jaeyoon and Shin, Hyun-Joon and Shiu, Hung Wei and Chen, Chia-Hao and Son, Young-Woo and Park, Bae Ho} } @Proceedings { , title = {Direct frequency comparison of intercontinentally separated Sr lattice clocks using carrier-phase two-way satellite frequency}, year = {2014}, month = {5}, day = {20}, number2 = {SIB55: ITOC: International timescales with optical clocks}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Taipei}, event_name = {Proceedings of the 2014 IEEE International Frequency Control Symposium}, event_date = {20-21 May 2014}, language = {30}, DOI = {10.1109/FCS.2014.6859906}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ido, T. and Fujieda, M. and Hachisu, H. and Nagano, S. and Gotoh, T. and Falke, St. and Huntemann, N. and Grebing, C. and Lipphardt, B. and Lisdat, Ch. and Piester, D.} } @Proceedings { , title = {ILITS Experiment: First Results1}, journal = {HIL Annual Report 2013}, year = {2014}, month = {5}, day = {1}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Ion beam dosimetry, nanodosimetry, track structure}, web_url = {www.slcj.uw.edu.pl/en/39.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1895-6726}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hilgers, G. and Helms, W. and Lambertsen, B. and Pausewang, A. and Rabus, H. and Bantsar, A. and Pszona, S. and Szeflinski, Z.} } @Article { , title = {ILITS Experiment: First Results}, journal = {INFN-LNL Report}, year = {2014}, month = {5}, day = {1}, volume = {240}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Ion beam dosimetry, nanodosimetry, track structure}, web_url = {www.lnl.infn.it/\verb=~=annrep/read_ar/2013/contributions/pdfs/129_D_92_D087.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1828-8561}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hilgers, G. and Moro, D. and Pausewang, A. and Helms, W. and Lambertsen, B. and Rabus, H. and Colautti, P. and Conte, V.} } @Article { , title = {ILITS Experiment: Track Structure of Carbon Ions}, journal = {INFN-LNL Report}, year = {2014}, month = {5}, day = {1}, volume = {241}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Ion beam dosimetry, nanodosimetry, track structure}, web_url = {www.lnl.infn.it/\verb=~=annrep/read_ar/2014/contributions/pdfs/132_D_56_D051.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1828-8561}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hilgers, G. and Moro, D. and Pausewang, A. and Helms, W. and Lambertsen, B. and Rabus, H. and Colautti, P. and Conte, V.} } @Article { , title = {Sub-kHz traceable characterization of stroboscopic scanning white light interferometer}, journal = {SPIE proceedings}, year = {2014}, month = {5}, day = {1}, volume = {9132}, number = {1}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {913218}, keywords = {Scanning white light interferometry (SWLI), metrology, MEMs, NEMs,}, web_url = {http://spie.org/Publications/Proceedings/Paper/10.1117/12.2051622}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, address = {Bellingham}, language = {30}, DOI = {10.1117/12.2051622}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heikkinen, V and Kassamakov, I and Paulin, T and Nolvi, A and Sepp{\"a}, J and Lassila, A and H{\ae}ggstr{\"o}m, E} } @Proceedings { Hudlicka2014, title = {Calibration of a VNA operating in the differential mode}, year = {2014}, month = {5}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Prague, Czech Republic}, event_name = {40th meeting of the Czech elektrotechnical society, subgroup Microwave technique}, event_date = {21 May, 2014}, language = {Czech}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hudlicka, Martin} } @Article { , title = {Agreement between two 88Sr+ optical clocks to 4 parts in 10\verb=^=17}, journal = {Physical Review A (Rapid Communications)}, year = {2014}, month = {5}, volume = {A89}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {http://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.050501}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1050-2947}, DOI = {10.1103/PhysRevA.89.050501}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barwood, GP and Huang, G and Klein, HA and Johnson, LAM and King, SA and Margolis, HS and Szymaniec, K and Gill, P} } @Article { PiacentiniMTHDBGRGR2014, title = {Measurement facility for the evaluation of the backscattering in fiber: Realization of an OTDR operating at single photon level}, journal = {International Journal of Quantum Information}, year = {2014}, month = {4}, day = {30}, volume = {12}, number = {02}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {1461014 [1 to 8]}, keywords = {OTDR; single photon detector; quantum information}, web_url = {http://www.worldscientific.com/worldscinet/ijqi}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0219-7499}, DOI = {10.1142/S0219749914610140}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, Fabrizio and Meda, Alice and Traina, Paolo and Hong, Kee Suk and Degiovanni, Ivo Pietro and Brida, Giorgio and Gramegna, Marco and Ruo Berchera, Ivano and Genovese, Marco and Rastello, Maria Luisa} } @Article { YuJPKHCKHK2014, title = {Structural analysis of graphene synthesized by chemical vapor deposition on copper foil using nematic liquid crystal texture}, journal = {Science Direct, Elsevier Carbon}, year = {2014}, month = {4}, day = {24}, volume = {76}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {133-122}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1016/j.carbon.2014.04.057}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Yu, Jeong-Seon and Jin, Xiaozhan and Park, Jaesung and Kim, Dong Hyun and Ha, Dong-Han and Chae, Dong-Hun and Kim, Wan-Seop and Hwang, Chanyong and Kim, Jong-Hyun} } @Article { , title = {Characterization of High-k Nanolayers by Grazing Incidence X-ray Spectrometry}, journal = {Materials}, year = {2014}, month = {4}, day = {17}, volume = {7}, number = {4}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {3147-3159}, keywords = {GIXRF; layer thickness; gate stack; reference-free analysis, ALD}, web_url = {http://www.mdpi.com/1996-1944/7/4/3147}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {MDPI}, address = {Basel Switzeland}, language = {30}, ISSN = {1996-1944}, DOI = {10.3390/ma7043147}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 201-4-17}, author = {Muller, M. and Honicke, P. and Detlefs, B. and Fleischmann, C.} } @Article { , title = {Thermal desorption mass spectrometer for mass metrology}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS 85, 045111 (2014)}, year = {2014}, month = {4}, day = {14}, volume = {85}, number = {85}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {045111}, keywords = {Thermal, desorption, mass spectrometer, mass metrology}, web_url = {http://scitation.aip.org/docserver/fulltext/aip/journal/rsi/85/4/1.4870921.pdf?expires=1460456419\&id=id\&accname=2118383\&checksum=AC3FCE73DE77059689EE889598D57A63}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, DOI = {10.1063/1.4870921}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Silvestri, Z and Azouigui, S and Bouhtiyya, S and Mac{\'e}, S and Plimmer, M D and Pinot, P and Tayeb-Chandoul, F and Hannachi, R} } @Article { , title = {Monochromator Based Absolute Calibration of a Standard Radiation Thermometer}, journal = {Int. J. Thermophys}, year = {2014}, month = {4}, day = {6}, volume = {35}, number = {3}, number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry}, pages = {493-503}, keywords = {Absolute radiometry · Radiance method · Standard radiation thermometer}, web_url = {http://link.springer.com/journal/10765}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer}, address = {Cham}, language = {30}, ISSN = {0195-928X}, DOI = {10.1007/s10765-014-1589-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mantilla, J. M. and Hernanz, M. L. and Campos, J. and Mart{\'i}n, M. J. and Pons, A. and del Campo, D.} } @Article { , title = {Validation of a Blackbody Comparator Based System for Thermocouple Calibration}, journal = {International Journal of Thermophysics}, year = {2014}, month = {4}, volume = {35}, number = {3}, number2 = {NEW09: METCO: Metrology of electro-thermal coupling for new functional materials technology}, pages = {526-534}, keywords = {Comparison, Filter radiometer, Gradient, Modeling, Thermocouple calibration}, web_url = {http://link.springer.com/article/10.1007\%2Fs10765-014-1565-9\#page-1}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer US}, language = {30}, ISSN = {1572-9567}, DOI = {10.1007/s10765-014-1565-9}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ojanen, MO and Hahtela, OH and Heinonen, MH} } @Proceedings { , title = {TRACEABILITY FOR ROUNDNESS MEASUREMENTS OF ROLLS - European Metrology Research Programme, project No. IND62}, journal = {Proceedings 9th International DAAAM Baltic Conference - Industrial Engineering}, year = {2014}, month = {4}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {232-237}, keywords = {metrology, roll, roundness, calibration}, web_url = {http://innomet.ttu.ee/daaam14/proceedings/Mechatronics\%20and\%20System\%20Engineering/Hemming.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Tallinn, Estronia}, event_name = {9th International DAAAM Baltic Conference - Industrial Engineering}, event_date = {24-04-2014 to 26-04-2014}, language = {30}, ISBN = {978-9949-23-620-6}, ISSN = {2346-612X (print), 2346-6138 (online)}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hemming, B. and Widmaier, T. and Palosuo, I. and Esala, V.-P. and Laukkanen, P. and Lillepea, L. and Simson, K. and Brabandt, D. and Haikio, J.} } @Article { , title = {Comparative Study of Sensitivity, Linearity, and Resistance to Inhibition of Digital and Nondigital Polymerase Chain Reaction and Loop Mediated Isothermal Amplification Assays for Quantification of Human Cytomegalovirus}, journal = {Analytical Chemistry}, year = {2014}, month = {3}, day = {31}, volume = {86}, number = {9}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {4387–4394}, keywords = {nucleic acid amplification techniques, human cytomegalovirus, loop mediated isothermal amplification, LAMP, digital PCR, digital LAMP, inhibitors}, web_url = {http://pubs.acs.org/doi/abs/10.1021/ac500208w}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {ACS Publications}, address = {Washington}, language = {30}, ISSN = {1520-6882}, DOI = {10.1021/ac500208w}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Nixon, G. and Garson, J.A. and Grant, P. and Nastouli, E. and Foy, C.A. and Huggett, J.F.} } @Article { , title = {Recent advances in vacuum sciences and applications}, journal = {Journal of Physics D: Applied Physics}, year = {2014}, month = {3}, day = {27}, volume = {47}, number = {15}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, pages = {24}, keywords = {vacuum, surface, plasma, interface, nanoscience}, web_url = {http://iopscience.iop.org/article/10.1088/0022-3727/47/15/153001}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0022-3727}, DOI = {10.1088/0022-3727/47/15/153001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-3-27}, author = {Mozetič, M and Ostrikov, K and Ruzic, D.N and Curreli, D and Cvelbar, U and Tagliaferro, A and Conde, O. and Silvestre, A.J and Giapintzakis, J. and Buljan, M. and Radić, N. and Dražić, G. and Bernstorff, S. and Biederman, H. and Kyli{\'a}n, O. and Hanuš, J. and Miloševič, S. and Galtayries, A. and Dietrich, P. and Unger, W. and Sedlarik, V. and Stana-Kleinschek, K. and Drmota-Petrič, A. and Pireaux, J.J and Rogers, J.,.W and Anderle, M.} } @Proceedings { , title = {Dual beam organic depth profiling using large argon cluster ion beams}, journal = {Surface and Interface Analysis}, year = {2014}, month = {3}, day = {18}, volume = {46}, number = {10-11}, number2 = {IND15: SurfChem: Traceable quantitative surface chemical analysis for industrial applications}, keywords = {SIMS; organic depth profiling; argon cluster; ToF-SIMS; Ar-GCIB}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5429/abstract}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Sardinia}, event_name = {European Applications of Surface and Interface Analysis - ECASIA'13}, event_date = {October 13-18, 2013}, language = {30}, DOI = {10.1002/sia.5429}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Holzweber, M. and Shard, A. G. and Jungnickel, H. and Luch, A. and Unger, W. E.S.} } @Article { , title = {A surrogate model enables a Bayesian approach to the inverse problem of scatterometry}, journal = {Journal of Physics: Conference Series}, year = {2014}, month = {3}, day = {11}, volume = {490}, number = {-}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {012007}, keywords = {scatterometry, photomask geometry, surrogate model, polynomial chaos}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/490/1/012007/pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOPScience}, address = {Bristol \& Philadelphia}, language = {30}, ISSN = {-}, DOI = {10.1088/1742-6596/490/1/012007}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heidenreich, S and Gross, H and Henn, M-A and Elster, C and B{\"a}r, M} } @Article { HusuSLSTL2014, title = {Scatterometer for characterization of diffractive optical elements}, journal = {Measurement Science and Technology}, year = {2014}, month = {3}, day = {5}, volume = {25}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Diffraction gratings, metrology, nanoscale materials and structures}, web_url = {http://iopscience.iop.org/0957-0233/25/4/044019/article?fromSearchPage=true}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1088/0957-0233/25/4/044019}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Husu, H. and Saastamoinen, T. and Laukkanen, J. and Siitonen, S. and Turunen, J. and Lassila, A.} } @Article { HuKLSRRKBNS2014, title = {Magnetothermoelectric figure of merit of Co/Cu multilayers}, journal = {APPLIED PHYSICS LETTERS}, year = {2014}, month = {3}, day = {5}, volume = {104}, number = {092411}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, web_url = {http://scitation.aip.org/content/aip/journal/apl/104/9/10.1063/1.4867700}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, DOI = {10.1063/1.4867700}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hu, X. K. and Krzysteczko, P. and Liebing, N. and Serrano-Guisan, S. and Rott, K. and Reiss, G. and Kimling, J. and B{\"o}hnert, T. and Nielsch, K. and Schumacher, H. W.} } @Article { , title = {Measurements of CD and sidewall profile of EUV photomask structures using CD-AFM and Tilting-AFM}, journal = {Meas. Sci. Technol.}, year = {2014}, month = {3}, day = {5}, volume = {25}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {EUV-lithography, photomask, CD, sidewall angle, feature height, CD-AFM, Tilting-AFM, scatterometry, traceability}, web_url = {http://iopscience.iop.org/0957-0233/25/4/044002}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1088/0957-0233/25/4/044002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gaoliang, D. and Hahm, K. and Scholze, F. and Henn, M.-A. and Gross, H. and Fluegge, J. and Bosse, H.} } @Article { , title = {Improved reconstruction of critical dimensions in exteme ultraviolet scatterometry by modellig systematic errors}, journal = {Measurement Science and Technology}, year = {2014}, month = {3}, day = {5}, volume = {25}, number = {4}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {044003 (9pp)}, keywords = {Scatterometry, metrology, EUV-lithography}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/0957-0233/25/4/044003/meta}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOPScience}, address = {Bristol \& Philadelphia}, language = {30}, ISSN = {-}, DOI = {10.1088/0957-0233/25/4/044003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Henn, M-A and Gross, H and Heidenreich, S and Scholze, F and Elster, C and B{\"a}r, M} } @Proceedings { , title = {''Multidimensional reflectometry for industry'' (xD-Reflect) an European research project}, journal = {Proceedings of SPIE}, year = {2014}, month = {2}, day = {24}, volume = {9018}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {901804}, keywords = {Reflectometry ; Metrology ; Modeling ; Optical design ; Optical testing ; Bidirectional reflectance transmission function ; CCD cameras ; Calibration ; Data analysis ; Light sources}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835520}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE - The International Society for Optical Engineering}, address = {Bellingham}, event_place = {San Francisco (USA)}, event_name = {Measuring, Modeling, and Reproducing Material Appearance}, event_date = {4-5 February, 2014}, language = {30}, ISBN = {978-0-8194-9935-6}, ISSN = {0277-786X}, DOI = {10.1117/12.2035981}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {H{\"o}pe, A. and Koo, A. and Verdu, F.-M. and Leloup, F.-B. and Obein, G. and W{\"u}bbeler, G. and Campos, J. and Iacomussi, P. and Jaanson, P. and K{\"a}llberg, S. and Smids, M.} } @Proceedings { , title = {Rapid determination of the photometric bidirectional scatter distribution function by use of a near field goniophotometer}, journal = {PROCEEDINGS OF SPIE VOLUME 9018: Measuring, Modeling, and Reproducing Material Appearance}, year = {2014}, month = {2}, day = {24}, volume = {9018}, number = {NA}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {8 pages / Article no. 901803}, keywords = {bidirectional reflectance distribution function, near-field goniophotometry, optical metrology, material appearance characterization}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835519}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, address = {Bellingham}, event_place = {San Francisco}, event_name = {Measuring, Modeling, and Reproducing Material Appearance}, event_date = {2 February 2014}, language = {30}, ISBN = {NA}, ISSN = {NA}, DOI = {10.1117/12.2035958}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Leloup, F.B. and De Ketelaere, W. and Audenaert, J. and Hanselaer, P.} } @Article { , title = {Derivation of continuous wave mode output power from burst mode measurements in high-intensity ultrasound applications}, journal = {The Journal of the Acoustical Society of America}, year = {2014}, month = {2}, day = {19}, volume = {135}, number = {3}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {EL123}, keywords = {Ultrasound Power Measurements, Burst Mode, CW Mode}, web_url = {http://scitation.aip.org/content/asa/journal/jasa/135/3/10.1121/1.4865268}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Acoustical Society of America}, address = {Melville}, language = {30}, ISSN = {0001-4966}, DOI = {10.1121/1.4865268}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Haller, J and Wilkens, V} } @Article { TammHLGNKWP2014, title = {Cs-based optical frequency measurement using cross-linked optical and microwave oscillators}, journal = {Physical Review A}, year = {2014}, month = {2}, day = {14}, volume = {89}, number = {2014}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.023820\#abstract}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, DOI = {10.1103/PhysRevA.89.023820}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Tamm, Chr. and Huntemann, N. and Lipphardt, B. and Gerginov, V. and Nemitz, N. and Kazda, M. and Weyers, S. and Peik, E.} } @Article { , title = {Observing and measuring strain in nanostructures and devices with transmission electron microscopy}, journal = {MRS Bulletin}, year = {2014}, month = {2}, day = {12}, volume = {39}, number = {2}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {138-146}, keywords = {Nanostructure, silicon, stress/strain relationship, transmission electron microscopy}, web_url = {https://www.cambridge.org/core/journals/mrs-bulletin/article/observing-and-measuring-strain-in-nanostructures-and-devices-with-transmission-electron-microscopy/296C465E63EC9AEB189EFFE7AA4C1116}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Cambridge University Press}, address = {Cambridge}, language = {30}, ISSN = {0883-7694}, DOI = {10.1557/mrs.2014.4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hytch, MH and Minor, AMM} } @Proceedings { , title = {ATOMIC FORCE MICROSCOPY STUDY ON THE EFFECT OF LOW-PRESSURE HYDROGEN PLASMA CLEANING ON STAINLESS STEEL WEIGHTS}, journal = {Proceedings of the Joint IMEKO International TC3, TC5 and TC22 Conference 2014.}, year = {2014}, month = {2}, day = {3}, volume = {TC3}, number = {2014}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {4}, keywords = {AFM, hydrogen plasma cleaning, stainless steel weight, surface contamination}, web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-004.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IMEKO}, address = {Budapest}, event_place = {Cape Town, SOUTH AFRICA}, event_name = {Joint IMEKO International TC3, TC5 and TC22 Conferences}, event_date = {February 3 - 5, 2014}, language = {30}, ISBN = {NA}, ISSN = {NA}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {H{\"o}gstr{\"o}m, Richard and Riski, Kari and Ojanen, Maija and Heinonen, Martti} } @Article { , title = {Addressing the requirements for the implementation and ongoing maintenance of the redefined kilogram}, journal = {IMEKO 22nd TC3, 12th TC5 and 3rd TC22 International Conferences}, year = {2014}, month = {2}, day = {3}, volume = {22}, number = {22}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {1-6}, keywords = {kilogram, redefinition, vacuum, transfer, storage, cleaning.}, web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-032.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IMEKO}, address = {Budapest}, language = {30}, ISSN = {NA}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Davidson, S and Berry, J and Silvestri, Z and Hogstorm, R and Green, R} } @Article { , title = {Spatially resolved electrical characterisation of graphene layers by an evanescent field microwave microscope}, journal = {Physica E: Low dimensional systems and nanostructures}, year = {2014}, month = {2}, day = {1}, volume = {56}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {431 - 434}, keywords = {evanescent field microwave microscope, traceable measurements, graphene}, web_url = {http://www.sciencedirect.com/science/article/pii/S1386947712004018}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {n/a}, DOI = {10.1016/j.physe.2012.10.006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-2-1}, author = {Gregory, A and Hao, L and Klein, N and Gallop, J and Mattevi, C and Shaforost, O and Lees, K and Clarke, B} } @Article { , title = {An Environmental Wind Tunnel Facility for Testing Meteorological Sensor Systems}, journal = {JOURNAL OF ATMOSPHERIC AND OCEANIC TECHNOLOGY}, year = {2014}, month = {2}, volume = {31}, number = {2}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {447-457}, keywords = {Atmosphere-land interaction, Atmospheric circulation, Boundary layer, Wind, Planetary atmospheres, Instrumentation/sensors}, misc2 = {EMRP A169: Call 2010 Environment}, language = {30}, ISSN = {0739-0572}, DOI = {10.1175/JTECH-D-13-00141.1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {HOLSTEIN-RATHLOU, GC. and Merrison, J. and IVERSEN, J. J. and JAKOBSEN, A. B. and NICOLAJSEN, R. and N{\O}RNBERG, P. and RASMUSSEN, K. and Merlone, A. and Lopardo, G. and HUDSON, T. and BANFIELD, D. and PORTYANKINA, G.} } @Proceedings { , title = {Qualitative failure analysis on laminate structures using comprehensive analytical linear elastic contact modelling}, journal = {SEECCM 2013 Proceedings}, year = {2014}, month = {2}, volume = {SEECCM III}, number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials}, pages = {224-244}, keywords = {Impact, contact mechanics, Young’s modulus, Yield strength, transverse isotropy, laminates, windsurfing, light weight construction, fracture toughness, fibers, foams, layered structures, anisotropy, fracture, mechanical properties, analytical modeling}, web_url = {http://www.eccomasproceedings.org/PDF_Papers/SEECCM2013/2134.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {ECCOMAS Conference Proceedings}, event_place = {Kos Island, Greece}, event_name = {SEECCM III 3rd South-East European Conference on Computational Mechanicsan ECCOMAS and IACM Special Interest Conference}, event_date = {12-06-2013 to 14-06-2013}, language = {30}, ISBN = {978-960-99994-4-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schwarzer, NS and Heuer-Schwarzer, PHS} } @Article { HertzbergCFEBW2014, title = {Onsite Measurements for Power-Quality Estimation at the Sweden–Poland HVDC Link}, journal = {IEEE Transactions on Power Delivery}, year = {2014}, month = {2}, volume = {29}, number = {1}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {472-479}, keywords = {Harmonic analysis, Power system harmonics, HVDC transmission, Current measurement, Voltage measurement, Switches, Impedance}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-8977, 1937-4208}, DOI = {10.1109/TPWRD.2013.2276408}, stag_bib_extends_levelofaccess = {NA}, author = {Hertzberg, K. and Clarkson, P. and Flood, M. and Elg, A.P. and Bergman, A. and Wright, P.S.} } @Article { WanGWSALHLHS2014, title = {Precision spectroscopy by photon-recoil signal amplification}, journal = {Nature Communications}, year = {2014}, month = {1}, day = {30}, volume = {5}, number = {3096}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, keywords = {Physical sciences, atomic and molecular physics, optical physics}, web_url = {http://www.nature.com/ncomms/2014/140130/ncomms4096/full/ncomms4096.html}, web_url2 = {http://arxiv.org/abs/1309.7033}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, DOI = {10.1038/ncomms4096}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Wan, Y and Gebert, F and W{\"u}bbena, J.B and Scharnhorst, N and Amairi, S and Leroux, I.D and Hemmerling, B and L{\"o}rch, N and Hammerer, K and Schmidt, P.O} } @Book { , title = {Circuit Cavity electromagnetics in the strong coupling regime}, year = {2014}, month = {1}, day = {1}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {64-67}, keywords = {resonators, Circuit Cavity electromagnetics, metrology}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {McGraw-Hill}, address = {New York City}, booktitle = {McGraw-Hill Yearbook of Science and Technology,}, language = {30}, DOI = {10.1036/1097-8542.YB140265}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hao, L and Gallop, J} } @Proceedings { , title = {Traceable Quasi-dynamic Stroboscopic Scanning White Light Interferometry}, journal = {Fringe 2013}, year = {2014}, month = {1}, day = {1}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {491 - 496}, keywords = {SSWL (Stroboscopic Scanning White Light Interferometry), Metrology Transfer standards}, web_url = {http://link.springer.com/book/10.1007/978-3-642-36359-7}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer Berlin Heidelberg}, address = {Berlin}, event_place = {Nurtingen, Germany}, event_name = {7th International Workshop on Advanced Optical Imaging and Metrology}, event_date = {01-01-2014}, language = {30}, ISBN = {9783642363597}, DOI = {10.1007/978-3-642-36359-7_86}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Heikkinen, V and Nolvi, A and Paulin, T and Sepp{\"a}, J and Kassamakov, I and Lassila, A and H{\ae}ggstr{\"o}m, E} } @Proceedings { KohlmannBKDSSTGMJONLIWLVBECHvO2014, title = {A quantum standard for sampled electrical measurements - main goals and first results of the EMRP project Q-WAVE}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {522 - 523}, keywords = {AC Josephson voltage standards European Metrology Research Programme (EMRP) binary-divided Josephson series arrays pulse-driven Josephson series arrays}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898489}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kohlmann, J. and Behr, R. and Kieler, O. and Diaz de Aguilar Rois, J. and Sira, M. and Sosso, A. and Trinchera, B. and Gran, J. and Malmbekk, H. and Jeanneret, B. and Overney, F. and Nissil{\"a}, J. and Lehtonen, T. and Ireland, J. and Williams, J. and Lapuh, R. and Voljc, B. and Bergsten, T. and Eklund, G. and Coskun Ozturk, T. and Houtzager, E. and van den Brom, H.E. and Ohlckers, P.} } @Proceedings { SanchezLopezZBHPTCC, title = {Heating of bilateral hip prostheses in a human body model induced by a multi-axis gradient coil set}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2014}, volume = {22}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/14/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Milan, Italy}, event_name = {Joint Annual Meeting ISMRM-ESMRMB}, event_date = {10-16 May 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Sanchez-Lopez, H. and Zilberti, L. and Bottauscio, O. and Hand, J. and Papadaki, A. and Tang, F. and Chiampi, M. and Crozier, S.} } @Article { ahinOHCI2014, title = {Coherent population trapping resonances at lower atomic levels of Doppler broadened optical lines}, journal = {Quantum Electronics}, year = {2014}, volume = {44}, number = {11}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {1071-1076}, keywords = {coherent population trapping, optical pumping, probe beam, sub-Doppler spectroscopy.}, web_url = {http://iopscience.iop.org/1063-7818/}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, ISSN = {1468-4799}, DOI = {10.1070/QE2014v044n11ABEH015240}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Şahin, E. and {\"O}zen, G. and Hamid, R. and \c{C}elik, M. and Izmailov, A.Ch.} } @Proceedings { , title = {A self-referenced single-electron current source}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {665-665}, keywords = {Charge pumps, Current measurement, Error accounting, Single electron devices, Single electron transistors}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hohls, F. and Fricke, L. and Wulf, M. and Kaestner, B. and Mirovsky, Ph. and Mackrodt, B. and Dolata, R. and Weimann, Th. and Pierz, K. and Siegner, U. and Schumacher, H. W.} } @Article { MonteGAKEOH2014, title = {Radiometric calibration of the in-flight blackbody calibrationsystem of the GLORIA interferometer}, journal = {Atmos. Meas. Tech}, year = {2014}, volume = {7}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {Radiation Thermometry, Radiance, Remote Sensing, Vacuum, Emissivity}, web_url = {http://www.atmos-meas-tech.net/7/13/2014/amt-7-13-2014.html}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, DOI = {10.5194/amt-7-13-2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Gutschwager, B. and Adibekyan, A. and Kehrt, M. and Ebersoldt, A. and Olschewski, F. and Hollandt, J.} } @Proceedings { EndresBDWHGSD2014, title = {Preliminary comparison of DUV scatterometry for CD and edge profile metrology on EUV masks}, journal = {Fringe 2013 - 7th International Workshop on Advanced Optical Imaging and Metrology}, year = {2014}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {695-700}, web_url = {http://link.springer.com/chapter/10.1007\%2F978-3-642-36359-7_128\#page-1}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {N{\"u}rtingen, Germany}, event_name = {FRINGE 2013}, event_date = {8 - 11 September 2013}, language = {English}, ISBN = {978-3-642-36358-0}, DOI = {10.1007/978-3-642-36359-7_128}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Endres, J. and Bodermann, B. and Dai, G. and Wurm, M. and Henn, M.-A. and Gross, H. and Scholze, F. and Diener, A.} } @Article { HayHFLGSD2014, title = {New facilities for the measurements of high temperature thermophysical properties at LNE}, journal = {International Journal of Thermophysics}, year = {2014}, volume = {35}, number2 = {ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants}, pages = {1712 to 1724}, keywords = {Emissivity, High temperature, Metrology, Thermal diffusivity}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, DOI = {10.1007/s10765-013-1400-8}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hay, Bruno and Hameury, Jacques and Fleurence, Nolwenn and Lacipiere, Pascal and Grelard, Marc and Scoarnec, Vincent and Dav{\'e}e, Guillaume} } @Article { CaroTHLMC2014, title = {Characterization of 226Ra activity in low-level slag reference standards}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2014}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, keywords = {EURAMET; EMRP; MetroMetal; low-level 226Ra slag source; underground laboratory; HADES; HPGe-detector; gamma-ray spectrometry}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0236-5731}, DOI = {10.1007/s10967-014-3851-1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Caro, B. and Tzika, F. and Hult, M. and Lutter, G. and Mejuto, M. and Crespo, T.} } @Article { PlotnikovPRKH2014, title = {Determination of Major Non-Metallic Impurities in Magnesium by Glow Discharge Mass Spectrometry with a Fast Flow Source Using Sintered and Pressed Powder Samples}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, number = {406}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, pages = {7463-7471}, keywords = {Glow discharge mass spectrometry, Magnesium matrix, nonmetallic impurities, fast flow source, electrical parameters, calibration samples.}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1007/s00216-014-8185-x}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Plotnikov, A. and Pfeifer, J. and Richter, S. and Kipphardt, H. and Hoffmann, V.} } @Article { GonzalezGagoSVHH2014, title = {The use of matrix-specific calibrations for oxygen in analytical glow discharge spectrometry}, journal = {Analytical and Bioanalytical Chemistry}, year = {2014}, number2 = {SIB09: ELEMENTS: Primary standards for challenging elements}, keywords = {GD-OES. GD-MS. Glow discharge analysis. Oxygen determination}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1007/s00216-014-8186-9}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gonzalez-Gago, C. and Smid, P. and Venzago, C. and Hofmann, T. and Hoffmann, V.} } @Article { NouiraBKPHS2014, title = {Ultra-high precision CMMs as well as tactile and optical single scanning probes evaluation in dimensional metrology}, journal = {International Journal of Metrology and Quality Engineering}, year = {2014}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {measuring machine, chromatic confocal probe; tactile probe, error sources; dimensional and mechanical metrology, evaluation}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {2107-6839}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nouira, H and Bergmans, R H and K{\"u}ng, A. and Piree, H and Henselmans, R. and Spaan, H.A.M.} } @Proceedings { IrelandHWKKBGMLT2014, title = {An opto-electronic coupling for pulsedriven Josephson junction arrays}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {124 - 125}, keywords = {Measurement, metrology, voltage measurement, Josephson arrays, opto-electronics, Josephson arbitrary waveform synthesizer.}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898290}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ireland, J. and Henderson, D. and Williams, J. and Kieler, O. and Kohlmann, J. and Behr, R. and Gran, J. and Malmbekk, H. and Lind, K. and Tang, Chi Kwong} } @Proceedings { GulmezGKEHG2014, title = {Sıcaklık Kontroll{\"u} Pasif Faz Standardı Yapımı}, journal = {URSI-T{\"U}RKİYE’2014 VII. Bilimsel Kongresi, 28-30 Ağustos 2014, ELAZIĞ}, year = {2014}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {436-438}, web_url = {http://www.ursi.org.tr/2014-Kongre/bildiriler/TAM_155.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Elazığ TURKEY}, event_name = {URSI-T{\"U}RKİYE’2014 VII. Bilimsel Kongresi, 28-30 Ağustos}, event_date = {28 - 30 August 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://web.firat.edu.tr/ursi/download/URSI_TUM_KITAP_PAGE.pdf}, author = {G{\"u}lmez, G. and G{\"u}lmez, Y and Karacadağ, H. and Erkan, {\"O}. and Hayırlı, C. and Gali\c{c}, N.} } @Proceedings { MalikBPHH, title = {RF Safety Evaluation for Neonatal MRI at 3T}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2014}, volume = {22}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/14/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Milan, Italy}, event_name = {Joint Annual Meeting ISMRM-ESMRMB}, event_date = {10-16 May 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Malik, Shaihan J. and Beqiri, Arian and Price, Anthony N. and Hand, Jeff W. and Hajnal, Joseph V.} } @Proceedings { WeidemannFSCHI, title = {A system for calibrated measurements of RF electromagnetic fields inside a clinical MR scanner}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2014}, volume = {22}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/14/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Milan, Italy}, event_name = {Joint Annual Meeting ISMRM-ESMRMB 2014}, event_date = {10-16 May 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Weidemann, Gerd and Frese, Isabela and Seifert, Frank and Cassara, Antonino and Hoffmann, Werner and Ittermann, Bernd} } @Article { VorbringerDorozhovetsGMFHM2014, title = {Multifunctional nanoanalytics and long-range scanning probe microscope using a nanopositioning and nanomeasuring machine}, journal = {Meas. Sci. Technol.}, year = {2014}, volume = {25}, number = {044006}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, keywords = {nanopositioning and nanomeasuring machine, metrological scanning probe microscope, AFM, electromagnetic changer for SPM probes, fiducial marks}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, DOI = {10.1088/0957-0233/25/4/044006}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Vorbringer-Dorozhovets, N and Goj, B and Machleidt, T and Franke, K-H and Hoffmann, M and Manske, E} } @Proceedings { OberackerWSMWHN, title = {En Route to Ultrahigh Field Cardiac MR in Patients: RF Safety Assessment of Intracoronary Stents at 7.0 T Using Numerical Simulations and E-Field Measurements}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2014}, volume = {22}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/14/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Milan, Italy}, event_name = {Joint Annual Meeting ISMRM-ESMRMB}, event_date = {10-16 May 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Oberacker, Eva and Winter, Lukas and Seifert, Frank and Marek, Jaroslav and Weidemann, Gerd and Hofmann, Eugen and Niendorf, Thoralf} } @Proceedings { BeqiriPHHM, title = {SAR optimised local B1+ shimming for cardiac imaging at 3T - a multi-model study}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2014}, volume = {22}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/14/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Milan, Italy}, event_name = {Joint Annual Meeting ISMRM-ESMRMB}, event_date = {10-16 May 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Beqiri, Arian and Padorno, Francesco and Hand, Jeff W. and Hajna, Joseph V. and Malik, Shaihan J.} } @Proceedings { BeqiriHPHM, title = {SAR characterisation for parallel transmission MRI - comparison between modelling different decoupling regimes}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2014}, volume = {22}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/14/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Milan, Italy}, event_name = {Joint Annual Meeting ISMRM-ESMRMB}, event_date = {10-16 May 2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Beqiri, Arian and Hand, Jeff W. and Padorno, Francesco and Hajnal, Joeseph V. and Malik, Shaihan J.} } @Article { , title = {Spectral properties of molecular iodine in absorption cells filled to specified saturation pressure}, journal = {Applied Optics}, year = {2014}, volume = {53}, number = {31}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {7435-7441}, keywords = {spectroscopy, absorbtion, laser stabilisation, metrological instrumentation}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {30}, DOI = {10.1364/AO.53.007435}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hrabina, Jan and Šarbort, Martin and Acef, Ouali and Du Burck, Fr{\'e}d{\'e}ric and Chiodo, Nicola and Hol{\'a}, Miroslava and Č{\'i}p, Ondřej and Lazar, Josef} } @Proceedings { , title = {Determination of metrological structural resolution of a CT system using the frequency response on surface structures}, journal = {Macroscale 2014}, year = {2014}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, keywords = {dimensional metrology, computed tomography, structural resolution, frequency response, spatial frequency}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Vienna}, event_name = {Macroscale 2014}, event_date = {28-30 October, 2014}, language = {30}, DOI = {10.7795/810.20150223B}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Fle{\ss}ner, Matthias and Vujaklija, Nemanja and Helmecke, Eric and Hausotte, Tino} } @Proceedings { , title = {xD-Reflect - ''Multidimensional Reflectometry for Industry'' a research project of the European Metrology Research Program (EMRP)}, journal = {Proceedings of NEWRAD 2014}, year = {2014}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {295-297}, web_url = {http://newrad2014.aalto.fi/Newrad2014_Proceedings.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Seongchong Park}, address = {Yuseong-gu}, event_place = {Helsinki}, event_name = {NEWRAD 2014}, event_date = {2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}pe, A. and Koo, A. and Forthmann, C. and Verd{\'u}, F. M. and Manoocheri, F. and Leloup, F. B. and Obein, G. and W{\"u}bbeler, G. and Ged, G. and Campos, J. and Hauer, K. O. and Yang, L. and Šm{\'i}d, M. and Langovoy, M. and Iacomussi, P. and Jaanson, P. and K{\"a}llberg, S.} } @Proceedings { , title = {Virtual experiment uncertainty analysis of robot-based gonioreflectometers}, journal = {Proceedings of NEWRAD 2014}, year = {2014}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {355-356}, web_url = {http://newrad2014.aalto.fi/Newrad2014_Proceedings.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Seongchong Park}, address = {Yuseong-gu}, event_place = {Helsinki}, event_name = {NEWRAD 2014}, event_date = {2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}pe, A. and Forthmann, C. and Langovoy, M. and Schm{\"a}hling, F. and W{\"u}bbeler, G.} } @Proceedings { , title = {ADDRESSING THE REQUIREMENTS FOR THE PRACTICAL IMPLEMENTATION AND ONGOING MAINTENANCE OF THE REDEFINED KILOGRAM}, journal = {Proceedings of IMEKO TC3}, year = {2014}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, keywords = {kilogram, redefinition, vacuum, transfer, storage, cleaning.}, web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-032.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Queen's Printer and Controller of HMSO}, event_place = {Cape Town, Republic of South Africa}, event_name = {IMEKO 22nd TC3, 15th TC5 and 3rd TC22 International Conferences}, event_date = {3 to 5 February, 2014}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31}, author = {Davidson, S and Berry, J and Silvestri, Z and Hogstrom, R and Green, R} } @Proceedings { , title = {In-beam tracking refractometry for coordinate interferometric measurement}, journal = {Proceddings SPIE 9132, Optical Micro- and Nanometrology V}, year = {2014}, volume = {9132}, number = {9132K}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, keywords = {refractometry, refractive index of air, interferometer, measuring system}, web_url = {http://proceedings.spiedigitallibrary.org/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, event_place = {Brussels, Belgium}, event_name = {SPIE Photonics Europe}, event_date = {April 14-17, 2014}, language = {30}, DOI = {10.1117/12.2052920}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {CCC code: 0277-786X/14/$18}, author = {Hol{\'a}, M. and Lazar, J. and Cip, O. and Buchta, Z.} } @Proceedings { , title = {Dissipative quantum Hall effect in polycrystalline CVD graphene}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {42-43}, keywords = {Backscatter,C,CVD graphene,Conductivity,Grain boundaries,Graphene,Hall bar,Hall effect,Landau level filling factor,Quantization (signal),Quantum Hall effect,Resistance,SiO2-Si,backscatter,carriers backscattering,chemical vapor deposition,chemical vapour deposition,counter propagating edge state,dissipative quantum Hall effect,electric resistance measurement,electrical conductivity measurement,grain boundaries,graphene,line defect,longitudinal conductivity measurement,numerical simulation,polycrystalline CVD graphene,quantum Hall effect,resistance metrology,resistance standards,short-circuit current,short-circuit currents,structural characterizations,wrinkles}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898249}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898249}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lafont, F. and Ribeiro-Palau, R. and Cresti, A. and Han, Z. and Cummings, A.W. and Roche, S. and Bouchiat, V. and Ducourtieux, S. and Schopfer, F. and Poirier, W.} } @Proceedings { , title = {Towards Quantum Resistance Metrology Based on Graphene}, journal = {The EMRP Project GraphOhm - Towards Quantum Resistance Metrology Based on Graphene}, year = {2014}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {548-549}, keywords = {Measurement standards, resistance, quantum hall effect, graphene, C, Calibration, EMRP project GraphOhm, Electrical resistance measurement, Hall effect devices, JRP, Materials, Metrology, Resistance, Standards, electric resistance measurement, electrical measurement, intrinsically referenced resistance standard disse, joint research project, quantum resistance metrology standard, semiconductor quantum Hall device}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898502}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_date = {24-29 Aug. 2014}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898502}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ahlers, F. and Kučera, J. and Poirier, W. and Jeanneret, B. and Satrapinski, A. and Tzalenchuk, A. and Vrabček, P. and Bergsten, T. and Hwang, C. and Yakimova, R. and Kubatkin, S.} } @Proceedings { , title = {Stability tests of electronic calibration units}, journal = {CPEM 2014 Digest}, year = {2014}, volume = {2014}, number = {2014}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {16-17}, keywords = {Measurement technique, calibration, stability analysis, temperature dependence, scattering parameters, network analysis, electronic calibration}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {n/a}, event_place = {Rio de Janeiro, Brazil}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {25-08-2014 to 29-08-2014}, language = {30}, ISBN = {978-1-4799-5205-2}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898236}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Zeier, M and Hoffmann, J and Huerlimann, P and Ruefenacht, J and Wollensack, M and Judaschke, R and Kuhlmann, K} } @Article { , title = {Impacts of Dichroic Prism Coatings on Radiometry of the Airborne Imaging Spectrometer APEX}, journal = {Applied Optics}, year = {2014}, volume = {53}, number = {24}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {5344-5352}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-53-24-5344\&origin=search}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Optical Society of America}, address = {Massachusetts}, language = {30}, ISSN = {1559-128X}, DOI = {10.1364/AO.53.005344}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hueni, AH and Schlaepfer, DS and Jehle, MJ and Schaepman, MES} } @Article { , title = {Modellbasiertes Pr{\"u}fen zur Verifikation der Funktionsf{\"a}higkeit von mikrostrukturierten Oberfl{\"a}chen}, journal = {Technisches Messen}, year = {2014}, volume = {81}, number = {5}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {228-236}, keywords = {Function-oriented testing, surface metrology, virtual functional gauge, model of function}, web_url = {http://www.degruyter.com/dg/viewarticle.fullcontentlink:pdfeventlink/$002fj$002fteme.2014.81.issue-5$002fteme-2014-1016$002fteme-2014-1016.pdf?t:ac=j$002fteme.2014.81.issue-5$002fteme-2014-1016$002fteme-2014-1016.xml}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {De Gruyter Oldenbourg}, address = {Munich}, language = {43}, ISSN = {0171-8096}, DOI = {10.1515/teme-2014-1016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hartmann, WH and Weckenmann, AW} } @Article { , title = {Characterization of Semiconductor Materials using Synchrotron Radiation-based Near-Field Infrared Microscopy and nano-FTIR Spectroscopy}, journal = {Optics Express}, year = {2014}, volume = {22}, number = {15}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {17948-17958}, keywords = {Instrumentation, measurement, and metrology, Near-field microscopy, Optics at surfaces, Spectroscopy, Thin films, optical properties}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-22-15-17948}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Optical Society of America (OSA)}, address = {Washington}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.22.017948}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hermann, PH and Hoehl, AH and Ulrich, GU and Fleischmann, CF and Hermelink, AH and K{\"a}stner, BK and Patoka, PP and Hornemann, AH and Beckhoff, BB and R{\"u}hl, ER and Ulm, GU} } @Proceedings { , title = {New Material Standards For Traceability Of Roundness Measurements Of Large Scale Rotors}, journal = {Proceedings of the 58th Ilmenau Scientific Colloquium}, year = {2014}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, keywords = {Material standard, roundness, paper machine roll, steel mill roll, measurement uncertainty}, web_url = {https://www.db-thueringen.de/receive/dbt_mods_00025013}, web_url2 = {http://nbn-resolving.de/urn:nbn:de:gbv:ilm1-2014iwk-136:5}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {TU Ilmenau}, address = {Ilmenau}, event_place = {Ilmenau, Germany}, event_name = {58th Ilmenau Scientific Colloquium}, event_date = {08-09-2014 to 12-09-2014}, language = {30}, ISSN = {Online PPN: 802503594}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://nbn-resolving.de/urn:nbn:de:gbv:ilm1-2014iwk-136:5}, author = {Widmaier, T. and Kuosmanen, P. and Esala, V.-P. and Brabandt, D. and Haiko, J.} } @Proceedings { , title = {TRACEABLE IN-PROCESS DIMENSIONAL MEASUREMENT – European Metrology Research Programme, project No. IND62}, journal = {Proceedings 9th International DAAAM Baltic Conference - Industrial Engineering}, year = {2014}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {295-299}, keywords = {traceability, machine tools, calibration, thermal influences}, web_url = {http://innomet.ttu.ee/daaam14/proceedings/Mechatronics\%20and\%20System\%20Engineering/Simson.pdf}, web_url2 = {https://www.researchgate.net/publication/289606165_Traceable_in-process_dimensional_measurement_-_European_metrology_research_programme_project_No_IND62}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Tallinn, Estronia}, event_name = {9th International DAAAM Baltic Conference - Industrial Engineering}, event_date = {24-04-2014 to 26-04-2014}, language = {30}, ISBN = {978-9949-23-620-6}, ISSN = {2346-612X (print), 2346-6138 (online)}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Simson, K. and Lillepea, L. and Hemming, B. and Widmaier, T.} } @Article { , title = {Quasidynamic calibration of stroboscopic scanning white light interferometer with a transfer standard}, journal = {Optical Engineering}, year = {2013}, month = {12}, day = {20}, volume = {51}, number = {12}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {124104}, keywords = {Micro(nano)electromechanical systems, Scanning white light interferometry, stroboscopic scanning white light interferometry, traceability}, web_url = {http://opticalengineering.spiedigitallibrary.org/article.aspx?articleid=1790550}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, address = {not known}, language = {30}, ISSN = {N/A}, DOI = {10.1117/1.OE.52.12.124104}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Seppa, J and Kassamakov, I and Heikkenen, V and Nolvi, A and Paulin, T and Lassila, A and Haeggstrom, E} } @Article { , title = {Proximity effect bilayer nano superconducting quantum interference devices for millikelvin magnetometry}, journal = {Journal of Applied physics}, year = {2013}, month = {12}, day = {18}, volume = {114}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {233907}, keywords = {SQUIDS, nanotechnology, electrical, measurements}, web_url = {http://scitation.aip.org/content/aip/journal/jap/114/23/10.1063/1.4843856}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP}, address = {Melville}, language = {30}, ISSN = {n/a}, DOI = {10.1063/1.4843856}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-12-18}, author = {Blois, A and Rozhko, S and Hao, L and Gallop, J and Romans, E} } @Article { BaigJWHZW2013, title = {A scalable, fast and multichannel arbitrary waveform generator}, journal = {Review of Scientific Instruments}, year = {2013}, month = {12}, day = {9}, volume = {84}, number = {124701}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {11}, keywords = {Segmented ion trap, arbitrary waveform generator, quantum information}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, DOI = {10.1063/1.4832042}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Baig, M. T and Johanning, M and Wiese, A and Heidbrink, S and Ziolkowski, M and Wunderlich, Ch} } @Article { , title = {Proton-impact ionisation cross sections for nanodosimetric track structure simulations}, journal = {Radiation Protection Dosimetry}, year = {2013}, month = {12}, day = {8}, volume = {161}, number = {1-4}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Interaction cross sections, nanodosimetry, Monte Carlo simulation, track structure}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Aix-en-Provence}, event_name = {12th Neutron and Ion Dosimetry Symposium}, event_date = {3.6.-7.6.2013}, language = {30}, ISSN = {0144-8420}, DOI = {10.1093/rpd/nct317}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bug, M. U. and Gargioni, E. and Baek, W. Y. and Hilgers, G. and Nettelbeck, H. and Rabus, H.} } @Article { , title = {Model Peptides Uncover the Role of the \(\beta\)‑Secretase Transmembrane Sequence in Metal Ion Mediated Oligomerization}, journal = {Journal of the Americal Chemical Society}, year = {2013}, month = {12}, day = {4}, volume = {135}, number = {51}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {19354–19361}, keywords = {Alzheimer disease; Amyloid formation; Copper; Enzymes}, web_url = {http://pubs.acs.org/doi/abs/10.1021/ja410812r}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {ACS Publications}, address = {Washington}, language = {30}, ISSN = {0002-7863, 1520-5126}, DOI = {10.1021/ja410812r}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Munter, Lisa M. and Sieg, Holger and Bethge, Tobias and Liebsch, Filip and Bierkandt, Frank S. and Schleeger, Michael and Bittner, Heiko J. and Heberle, Joachim and Jakubowski, Norbert and Hildebrand, Peter W. and Multhaup, Gerd} } @Article { , title = {Integrating chemical cross-linking with mass spectrometric analysis of peptides and proteins}, journal = {Amino Acids, Peptides and Proteins}, year = {2013}, month = {11}, day = {21}, volume = {38}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {151-171}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {RSC Publ.}, address = {Cambridge}, language = {30}, ISSN = {978-1-84973-585-8}, DOI = {10.1039/9781849737081-00151}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Henrion, Andr{\'e}} } @Proceedings { , title = {Characterizing Cable Flexure Effects in S-parameter Measurements}, journal = {Microwave Measurement Conference, 2013 82nd ARFTG}, year = {2013}, month = {11}, day = {18}, volume = {n/a}, number = {82nd ARFTG proceedings}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-7}, keywords = {VNA, PNA, S-parameters, cable effects, cable flexure, impedance, de-embedding, measurement, measurement techniques.}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {n/a}, language = {30}, ISSN = {n/a}, DOI = {10.1109/ARFTG-2.2013.6737336}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mubarak, F.A. and Rietveld, G. and Hoogenboom, D. and Spirito, M.} } @Article { , title = {Comparison of measured and Monte-Carlo simulated track structure parameters in nanometric volumes}, journal = {Radiation Protection Dosimetry}, year = {2013}, month = {11}, day = {13}, volume = {161}, number = {1-4}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Nanodosimetry, Monte Carlo simulation, track structure}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Aix-en-Provence}, event_name = {12th Neutron and Ion Dosimetry Symposium}, event_date = {3.6.-7.6.2013}, language = {30}, ISSN = {0144-8420}, DOI = {10.1093/rpd/nct265}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hilgers, G. and Bug, M. U. and Gargioni, E. and Rabus, H.} } @Proceedings { , title = {Optical metrology at the Light \& Lighting Laboratory: where lighting meets appearance}, journal = {BEMEKO Workshop on measurement}, year = {2013}, month = {11}, day = {7}, volume = {NA}, number = {NA}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {C01}, keywords = {Optical metrology}, web_url = {http://www.bemeko.be/images/BEMEKO/BEMEKO/2013\%20BEMEKO\%20workshop\%20abstract\%20book.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {BEMEKO}, address = {Li{\`e}ge, Belgium}, event_place = {Li{\`e}ge, Belgium}, event_name = {2013 BEMEKO workshop on measurement: Chalenges and Opportunities}, event_date = {07/11/2013}, language = {30}, ISBN = {-}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Leloup, F. B. and Hanselaer, P.} } @Article { OlschewskiEFGHKMPPRSK2013, title = {The in-flight blackbody calibration system for the GLORIA interferometer on board an airborne research platform}, journal = {Atmospheric Measurement Techniques (AMT)}, year = {2013}, month = {11}, volume = {6}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, web_url = {http://www.atmos-meas-tech.net/6/3067/2013/amt-6-3067-2013.html}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, DOI = {10.5194/amt-6-3067-2013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Olschewski, F. and Ebersoldt, A. and Friedl-Vallon, F. and Gutschwager, B. and Hollandt, J. and Kleinert, A. and Monte, C. and Piesch, C. and Preusse, P. and Rolf, C. and Steffens, P. and Koppmann, R.} } @Article { , title = {The APEX (Airborne Prism Experiment - Imaging Spectrometer) Calibration Information System}, journal = {IEEE Transactions on Geoscience and Remote Sensing}, year = {2013}, month = {11}, volume = {51}, number = {11}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {5169-5180}, keywords = {Imaging spectroscopy, relational database, sensor calibration.}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6488863\&newsearch=true\&queryText=Airborne\%20Prism\%20Experiment\%20Calibration\%20Information\%20System}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {IEEE}, language = {30}, ISSN = {0196-2892}, DOI = {10.1109/TGRS.2013.2246575}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hueni, AH and Lenhard, KL and Baumgartner, AB and Schaepman, MES and Briden, Charlotte} } @Article { , title = {Ionization cross section data of nitrogen, methane, and propane for light ions and electrons and their suitability for use in track structure simulations}, journal = {Physical Review E}, year = {2013}, month = {10}, day = {29}, volume = {88}, number = {043308}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Ionization cross sections, charge transfer cross sections, interaction cross sections, protons, alpha particles, PTRA, nanodosimetry, Monte Carlo simulation, track structure, benchmark}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1539-3755}, DOI = {10.1103/PhysRevE.88.043308}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bug, M. U. and Gargioni, E. and Nettelbeck, H. and Baek, W. Y. and Hilgers, G. and Rosenfeld, A. B. and Rabus, H.} } @Proceedings { , title = {Novel mathematical and statistical approaches to uncertainty evaluation: introducing a new EMRP research project}, journal = {16th International Congress of Metrology}, year = {2013}, month = {10}, day = {7}, volume = {04010}, number = {2013}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {-}, tags = {MAT}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_04010.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {EDP Sciences}, address = {Les Ulis \& London}, event_place = {Paris}, event_name = {16th International Congress of Metrology}, event_date = {07-10-2013 to 10-10-2013}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/201304010}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {B{\"a}r, M and Elster, C and Heidenreich, S and Matthews, C and Pendrill, L R and Wright, L} } @Proceedings { , title = {Novel mathematical and statistical approaches to uncertainty evaluation in the context of regression and inverse problems}, journal = {16th International Congress of Metrology}, year = {2013}, month = {10}, day = {7}, volume = {-}, number = {2013}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {04003}, keywords = {-}, tags = {MAT}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_04003.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {EDP Sciences}, address = {Les Ulis \& London}, event_place = {Paris}, event_name = {16th International Congress of Metrology}, event_date = {07-10-2013 to 10-10-2013}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/201304003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Elster, C and Klauenberg, K and B{\"a}r, M and Allard, A and Fischer, N and Kok, G and van der Veen, A and Harris, P and Cox, M and Smith, I and Cowen, S and Wilson, P and Ellison, S} } @Article { , title = {Establishing traceability of photometric absorbance values for accurate measurements of the haemoglobin concentration in blood}, journal = {Metrologia}, year = {2013}, month = {10}, day = {3}, volume = {50 / 2013}, number = {5}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {539 - 548}, keywords = {traceability, haemoglobin concentration, photometric absorbance}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/50/5/539/meta}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP}, address = {Bristol}, language = {30}, ISSN = {0026-1394 (print) ; 1681-7575 (online)}, DOI = {10.1088/0026-1394/50/5/539}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Witt, K. and Wolf, H. U. and Heuck, C. and Kammel, M. and Kummrow, A. and Neukammer, J.} } @Article { , title = {Evaluation of digital PCR for absolute RNA quantification}, journal = {PLoS ONE}, year = {2013}, month = {9}, day = {20}, volume = {8}, number = {9}, number2 = {SIB54: Bio-SITrace: Traceability for biologically relevant molecules}, pages = {e75296}, keywords = {RNA, digital PCR, absolute quantification, RT enzymes}, web_url = {http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0075296}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {PLOS}, address = {San Francisco}, language = {30}, ISSN = {1932-6203}, DOI = {10.1371/journal.pone.0075296}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sanders, R and Mason, DJ and Foy, CA and Huggett, JF} } @Article { , title = {A simple electrical lumped-element model simulates intra-cochlear sound pressures and cochlear impedance below 2 kHz}, journal = {J Acoust Soc Am}, year = {2013}, month = {9}, day = {19}, volume = {134 (2013-Nov)}, number = {5}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {3730-3738}, web_url = {http://scitation.aip.org/content/asa/journal/jasa/134/5/10.1121/1.4824154}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1121/1.4824154}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Marquardt, T. and Hensel, J.} } @Article { , title = {Microwave surface impedance measurements on reduced graphene oxide}, journal = {Applied Physics Letters}, year = {2013}, month = {9}, day = {17}, volume = {103}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {123103}, keywords = {grapheme, permittivity, quartz, sapphire}, web_url = {http://scitation.aip.org/content/aip/journal/apl/103/12/10.1063/1.4821268}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, address = {Melville, NY}, language = {30}, ISSN = {n/a}, DOI = {10.1063/1.4821268}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-9-17}, author = {Hao, L and Gallop, J and Goniszewski, S and Shaforost, O and Klein, N and Yakimova, R} } @Article { , title = {Optical Frequency Transfer over a single-span 1840-km Fiber Link}, journal = {PHYSICAL REVIEW LETTERS}, year = {2013}, month = {9}, day = {13}, volume = {111}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1103/PhysRevLett.111.110801}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Droste, S. and Ozimek, F. and Udem, Th. and Predehl, K. and Haensch, T. W. and Schnatz, H. and Grosche, G. and Holzwarth, R.} } @Article { , title = {Grazing-incidence x-ray fluorescence analysis for non-destructive determination of In and Ga depth profiles in Cu(In,Ga)Se2 absorber films}, journal = {Applied Physics Letters}, year = {2013}, month = {9}, day = {12}, volume = {103}, number = {11}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1-12}, keywords = {Fluorescence, copper, synchrotron radiation, x-ray fluorescence spectroscopy, solar cells}, web_url = {http://scitation.aip.org/content/aip/journal/apl/103/11/10.1063/1.4821267}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {AIP Publishing}, address = {New York}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4821267}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Streeck, CS and Brunken, SB and Gerlach, MG and Herzog, CHB and H{\"o}nicke, PH and Kaufmann, CAK and Lubeck, JL and Malzer, WM and Pollakowski, BP and Unterumsberger, RU and Weber, AW and Beckhoff, BB and Kanngie{\ss}er, BK and Schock, HWS and Mainz, RM} } @Proceedings { , title = {Thermodynamic temperature measurements of silver freezing point and HTFPs}, journal = {AIP Conference Proceedings}, year = {2013}, month = {9}, day = {11}, volume = {1552}, number = {56}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {56-59}, keywords = {Thermodynamic temperature; Absolute radiation thermometer; High temperature fixed point}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821371}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Scitation}, address = {Melville}, event_place = {Los Angeles, California, USA}, event_name = {TEMPERATURE: ITS MEASUREMENT AND CONTROL IN SCIENCE AND INDUSTRY}, event_date = {19-03-2012 to 23-03-2012}, language = {30}, ISBN = {NA}, ISSN = {NA}, DOI = {10.1063/1.4821371}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yuan, Z and Lu, X and Hao, X and Dong, W and Wang, T and Lin, Y and Wang, J and Duan, Y} } @Article { , title = {Lens transmission measurement for an absolute radiation thermometer}, journal = {AIP Conference Proceedings}, year = {2013}, month = {9}, day = {11}, volume = {1552}, number = {649}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {648-653}, keywords = {Radiance Absolute Radiance Thermometer; Thermodynamic temperature; Lens Transmission; Uncertainty.}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821399}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Scitation}, address = {Melville}, language = {30}, ISSN = {NA}, DOI = {10.1063/1.4821399}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hao, X and Yuan, Z and Lu, X} } @Article { , title = {Metrological Evaluation of Secondary Adhesion Wear Effects in the Dry Turning of UNS-A92024-T3 Alloy through Focus-variation Microscopy (FVM)}, journal = {Procedia Engineering}, year = {2013}, month = {9}, day = {10}, volume = {63}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {804–811}, keywords = {UNS-A92024, tool adhesion wear, Built-Up Layer, Built-Up Edge, Focus-Variation Microscopy (FVM)}, web_url = {http://www.sciencedirect.com/science/article/pii/S1877705813014641}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, ISSN = {1877-7058}, DOI = {10.1016/j.proeng.2013.08.251}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Garc{\'i}a-Jurado, DGJ and Main{\'e}, JMM and Batista, MB and Shaw, LS and Marcos, MM and Hausotte, TH} } @Proceedings { , title = {Comparison of CD measurements of an EUV photomask by EUV scatterometry and CD-AFM}, journal = {Proc. of SPIE}, year = {2013}, month = {9}, day = {9}, volume = {8880}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {mask metrology, EUV lithography, CD metrology, line edge roughness, line width roughness}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1736337}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Monterey, California, United States}, event_name = {Photomask Technology 2013}, event_date = {September 10, 2013}, language = {30}, DOI = {10.1117/12.2025827}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Scholze, F. and Soltwisch, V. and Dai, G. and Henn, M.-A. and Gross, H.} } @Article { , title = {Magnetoencephalography of Deep Lying Auditory Sources Using Acoustical Devices for Infra- and Ultrasound Stimulation}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2013}, month = {9}, day = {7}, volume = {58\verb=^=}, number = {1E}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {2}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Biomedical Engineering / Biomedizinische Technik - DE GRUYTER}, address = {Berlin}, language = {30}, ISSN = {ISSN (Online) 1862-278X, ISSN (Print) 0013-5585}, DOI = {10.1515/bmt-2013-4135}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bauer, M and Baker, C and Barham, R and Hensel, J and Kling, C and Trahms, L and Koch, C and Sander, T} } @Proceedings { , title = {Microwave characterization of large area graphene using a TE011 dielectric resonator}, journal = {Proceedings of Microwaves, Millimeter and Submillimeter Waves}, year = {2013}, month = {8}, day = {13}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {427-429}, keywords = {graphene, dielectrics, resonators, microwave, Substrates, Microwave theory and techniques, Resistance, Apertures, Electric fields}, web_url = {http://ieeexplore.ieee.org/document/6622095/?arnumber=6622095}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {Melville}, event_place = {Kharkov, Ukraine}, event_name = {International Kharkov Symposium on Physics and Engineering of Microwaves, Millimeter and Submillimeter Waves}, event_date = {23-06-2013 to 28-06-2013}, language = {30}, ISBN = {978-1-4799-1068-7}, DOI = {10.1109/MSMW.2013.6622095}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaforost, O and Wang, K and Adabi, M and Guo, Zh and Hao, L and Gallop, J and Klein, N} } @Article { CappellaBSKLWH, title = {High Temperature Thermal Conductivity of Amorphous Al2O3 Thin Films Grown by Low Temperature ALD}, journal = {Advanced Engineering Materials}, year = {2013}, month = {8}, day = {6}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, keywords = {ALD, amorphous alumina, modulated photothermal radiometry, thermal conductivity}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1002/adem.201300132}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Cappella, Andrea and Battaglia, Jean-Luc and Schick, Vincent and Kusiak, Andrzej and Lamperti, Alessio and Wiemer, Claudia and Hay, Bruno} } @Proceedings { , title = {Development of Near-field Microwave Methods for NEMS Resonators}, journal = {13th IEEE Conference on Nanotechnology (IEEE-NANO)}, year = {2013}, month = {8}, day = {5}, volume = {n/a}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {379 - 383}, keywords = {cantilever, microwave probe, NEMs resonator}, web_url = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=6720900\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fxpls\%2Fabs_all.jsp\%3Farnumber\%3D6720900}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, event_place = {Beijing, China}, event_name = {13th IEEE Conference on Nanotechnology (IEEE-NANO)}, event_date = {05-08-2013 to 08-08-2013}, language = {30}, ISBN = {978-1-4799-0675-8}, ISSN = {1944-9399}, DOI = {10.1109/NANO.2013.6720900}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hao, L and Goniszewski, S and Gallop, J and Chen, J} } @Article { PykaHKM2013, title = {A high-precision segmented Paul trap with minimized micromotion for an optical multiple-ion clock}, journal = {Applied Physics B}, year = {2013}, month = {7}, day = {25}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, web_url = {http://link.springer.com/article/10.1007\%2Fs00340-013-5580-5/fulltext.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer-Verlag Berlin Heidelberg 2013}, DOI = {10.1007/s00340-013-5580-5}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pyka, K. and Herschbach, N. and Keller, J. and Mehlst{\"a}ubler, T. E.} } @Article { GeorgJCESPBHVA2013, title = {Dosimetry auditing procedure with alanine dosimeters for light ion beam therapy}, journal = {Radiotherapy and Oncology}, year = {2013}, month = {7}, volume = {108}, number = {1}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {99-106}, keywords = {Alanine; Audit; Carbon ions; Dosimetry; Protons}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/j.radonc.2013.04.029}, stag_bib_extends_levelofaccess = {NA}, author = {Georg, D. and J{\"a}kel, O. and Chaudhri, N. and Ecker, S. and Sharpe, P. and Palmans, H. and Bassler, N. and Herrmann, R. and Vatnitsky, S. and Ableitinger, A.} } @Article { MiallH2013, title = {Traceable Measurement of Source and Receiver EVM Using a Real-Time Oscilloscope}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2013}, month = {6}, volume = {62}, number = {6}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {1413-1416}, keywords = {Code-division multiaccess, communications equipment testing, measurement errors, oscilloscopes, test equipment, uncertainty}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2013.2238458}, stag_bib_extends_levelofaccess = {NA}, author = {Miall, J. and Humphreys, D.A.} } @Article { , title = {Nanoscale imaging reveals laterally expanding antimicrobial pores in lipid bilayers}, journal = {PNAS}, year = {2013}, month = {5}, day = {28}, volume = {110}, number = {22}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {8918-8923}, keywords = {innate host defense de novo protein design nanometrology antibiotics nanoscopy}, web_url = {http://www.pnas.org/content/110/22/8918.abstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1073/pnas.1222824110}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rakowska, Paulina and Jiang, Haibo and Ray, Santanu and Pyne, Alice and Lamarre, Baptiste and Carr, Matthew and Judge, Peter and Ravi, Jascindra and Gerling, Ulla I. M. and Koksch, Beate and Martyna, Glenn J. and Hoogenboom, Bart W. and Watts, Anthony and Crain, Jason and Grovenor, Chris R. M. and Ryadnov, Maxim G.} } @Proceedings { , title = {Static and (quasi)dynamic calibration of stroboscopic scanning white light interferometer}, journal = {Proceedings of Society of Photo Optical Instrumentation Engineers}, year = {2013}, month = {5}, day = {13}, volume = {8788}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {87883J}, keywords = {stroboscopic scanning light interferometer, M(N)EMS devices, Interferometers ; Calibration ; Scanning ; Transducers ; Mirrors ; Equipment and services ; Heterodyning ; Lasers ; Light sources ; Metrology}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1687502}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {SPIE}, address = {n/a}, event_place = {Munich, Germany}, event_name = {Optical Measurement Systems for Industrial Inspection VIII}, event_date = {13-05-2013}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1117/12.2020525}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sepp{\"a}, J and Kassamakov, I and Nolvi,, A and Heikkinen, V and Paulin, T and Hao, L and Lassila, A and H{\ae}ggsr{\"o}m, E} } @Proceedings { , title = {Alternative methods for uncertainty evaluation in EUV scatterometry}, journal = {Proc. SPIE 8789, Modeling Aspects in Optical Metrology IV, 87890T (May 13, 2013); doi:10.1117/12.2020677}, year = {2013}, month = {5}, day = {13}, volume = {8789}, number = {2013}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {Uncertainty quantifcation, Difraction gratings, Metrology}, tags = {MAT}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1687372}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {International Society for Optics and Photonics}, address = {Bellingham}, event_place = {Munich}, event_name = {Modeling Aspects in Optical Metrology IV}, event_date = {13-05-2013}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1117/12.2020677}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Heidenreich, S and Henn, M-A and Gross, H and Bodermann, B and B{\"a}r, M} } @Article { , title = {Subhertz-linewidth infrared frequency source with a long-term instability below 5\(\times\)10\verb=^=-15}, journal = {Applied Physics B}, year = {2013}, month = {3}, day = {1}, volume = {110}, number = {4}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {465-470}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {Print: 0946-2171, Online: 1432-0649}, DOI = {10.1007/s00340-012-5280-6}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Raupach, S. M. F. and Legero, T. and Grebing, C. and Hagemann, Ch. and Kessler, T. and Koczwara, A. and Lipphardt, B. and Misera, M. and Schnatz, H. and Grosche, G. and Sterr, U.} } @Article { , title = {Providing 10\verb=^=-16 short-term stability of a 1.5 \(\mu\)m laser to optical clocks}, journal = {IEEE TIM (Transactions on Instrumentation and Measurement)}, year = {2013}, month = {2}, day = {21}, volume = {62}, number = {6}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {1556 - 1562}, keywords = {Atomic clocks, femtosecond frequency combs, frequency control, laser stability, optical phase-locked loops, stability transfer, transfer oscillator}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2013.2242597}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hagemann, C and Grebing, C and Kessler, T and Falke, St. and Lisdat, C and Schnatz, H and Riehle, F and Sterr, U} } @Article { , title = {Coupled NanoSQUIDs and Nano-Electromechanical Systems (NEMS) Resonators}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2013}, month = {1}, day = {3}, volume = {23}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1800304}, keywords = {NanoSQUIDs, nanomagnetism, NEMS mechanical resonators, single particle detection.}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6401168}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2012.2233536}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Cox, D. C. and Hao, L and Gallop, J. C. and Chen, J and Rozhko, S and Blois, A and Romans, E. J.} } @Article { , title = {Zero wear (Null Verschlei{\ss})}, journal = {Tribologie und Schmierungstechnik}, year = {2013}, month = {1}, volume = {60}, number = {2/13}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {5-12}, web_url = {https://www.researchgate.net/publication/258055524_Zero_Wear_Null_Verschleiss}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Curt R Vincentz Verlag}, language = {30}, ISSN = {0724-3472}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kovalev, AK and Hartelt, MH and Spaltmann, DS and W{\"a}sche, RW and Woydt, MW} } @Proceedings { HoffmannWZNHK2013, title = {Calibration Algorithm for Nearfield Scanning Microwave Microscopes}, journal = {Proceedings of the IEEE Nano 2012}, year = {2013}, number2 = {IND02: EMINDA: Electromagnetic Characterization of Materials for Industrial Applications up to Microwave Frequencies}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Birmingham, UK}, event_name = {IEEE Nano 2012: 12th International Conference on Nanotechnology}, event_date = {20 - 23 August 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hoffmann, J. and Wollensack, M. and Zeier, M. and Niegemann, J. and Huber, H.-P. and Kienberger, F.} } @Article { FrickeWKKTNHMMDWPS2013, title = {Counting statistics for electron capture in a dynamic quantum dot}, journal = {Physical Review Letters}, year = {2013}, volume = {110}, number = {126803}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {126803-1 - 126803-5}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.110.126803}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Fricke, L. and Wulf, M. and Kaestner, B. and Kashcheyevs, V. and Timoshenko, J. and Nazarov, P. and Hohls, F. and Mirovsky, P. and Mackrodt, B. and Dolata, R. and Weimann, T. and Pierz, K. and Schumacher, H.} } @Article { MirovskyFHKLPMS2013, title = {Towards quantized current arbitrary waveform synthesis}, journal = {Applied Physics Letters}, year = {2013}, volume = {113}, number = {213704}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {213704-1 - 213704-4}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, DOI = {10.1063/1.4807929}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Mirovsky, P. and Fricke, L. and Hohls, F. and Kaestner, B. and Leicht, C. and Pierz, K. and Melcher, J. and Schumacher, H.} } @Article { GutschwagerTMARFH2013, title = {Comparison of the radiation temperature scales of the PTB and the NPL in the temperature range from −57 \(^{\circ}\)C to 50 \(^{\circ}\)C}, journal = {Measurement Science and Technology}, year = {2013}, volume = {24}, number = {6}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {065002 (9pp)}, keywords = {radiation thermometry, infrared, radiometer, blackbody, low temperature,}, web_url = {http://m.iopscience.iop.org/0957-0233/24/6/065002/pdf/0957-0233_24_6_065002.pdf}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {0957-0233/13/065002+09$33.00}, DOI = {10.1088/0957-0233/24/6/065002}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gutschwager, B. and Theocharous, E. and Monte, C. and Adibekyan, A. and Reiniger, M. and Fox, N. and Hollandt, J.} } @Proceedings { KoppmannOSRPEFKPHGM2012, title = {An In-flight Blackbody Calibration Source for the GLORIA Interferometer Onboard an Airborne Research Platform}, journal = {AIP Conference Proceedings}, year = {2013}, volume = {1531}, number = {322}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {GLORIA, Remote sensing, Blackbody, Calibration, Infrared, Limb sounder, Thermoelectric cooler, ITS-90}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {AIP}, event_place = {Berlin, Germany}, event_name = {Radiation Processes in the Atmosphere and Ocean (IRS2012)}, event_date = {6 - 10 August 2012}, language = {English}, DOI = {10.1063/1.4804774}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Koppmann, R. and Olschewski, F. and Steffens, P. and Rolf, C. and Preusse, P. and Ebersoldt, A. and Friedl-Vallon, F. and Kleinert, A. and Piesch, C. and Hollandt, J. and Gutschwager, B. and Monte, C.} } @Proceedings { MerloneLABBBdDDEGGHHJKKMMMdSSSSSV2013, title = {A new challenge for meteorological measurements: The ''MeteoMet'' project - Metrology for meteorology}, journal = {AIP Conference Proceedings}, year = {2013}, volume = {8}, number = {1552}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {1030-1035}, keywords = {air humidity, air pressure, air temperature, air speed and direction, historical temperature data series, meteorological instruments calibration, traceable climate measurements}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821419}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Los Angeles (USA)}, event_name = {9th International Temperature Symposium}, event_date = {19-23 March 2012}, DOI = {10.1063/1.4821419}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Merlone, A. and Lopardo, G. and Antonsen, I. and Bell, S. and Benyon, R and Boese, N. and del Campo, D. and Dobre, M. and Drnovsek, J. and Elkatmis, A. and Georgin, E. and Grudniewicz, E. and Heinonen, M. and Holstein-Rathlou, C. and Johansson, J. and Klason, P. and Knorova, R. and Melvad, C. and Merrison, J. and Migaa, K. and de Podesta, M. and Saathoff, H. and Smorgon, D. and Sparasci, F. and Strnad, R. and Szmyrka-Grzebyk, A. and Vuillermoz, E.} } @Article { HughesW2013, title = {A novel co-ordinate measurement system based on frequency scanning interferometry}, journal = {Journal of the CMSC}, year = {2013}, volume = {2013}, number = {Autumn}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {19-24}, keywords = {FSI, coordinate metrology, SI, traceable}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hughes, Ben and Warden, Matt} } @Article { HuSMS2013, title = {The influence of individual lattice defects on the domain structure in magnetic antidot lattices}, journal = {Journal of Applied Physics}, year = {2013}, volume = {113}, number = {10}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, pages = {103907 - 103907-6}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1063/1.4795147}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hu, X.K. and Sievers, S. and M{\"u}ller, A. and Schumacher, H.} } @Article { HenningGFSLCM2013, title = {Correction for lateral distortion in coherence scanning interferometry}, journal = {CIRP Annals Manufacturing Technology}, year = {2013}, volume = {62}, number = {1}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, pages = {547 to 550}, keywords = {Surface analysis, Measurement, Distortion correction}, web_url = {http://www.sciencedirect.com/science/article/pii/S0007850613000279}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, DOI = {10.1016/j.cirp.2013.03.026}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Henning, Andrew and Giusca, Claudiu and Forbes, Alistair B and Smith, Ian and Leach, Richard and Coupland, Jeremy and Mandal, Rahul} } @Proceedings { GraesslWOHFPHN, title = {A two-dimensional 16 Channel Dipole Transceiver Array for Cardiac MR at 7.0 T: Design, Evaluation of RF Shimming Behavior and Application in CINE Imaging}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2013}, volume = {21}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/13/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Salt Lake City, USA}, event_name = {ISMRM 21st Annual Meeting \& Exhibition 2013}, event_date = {20-26 April 2013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Graessl, Andreas and Winter, Lukas and {\"O}zerdem, Celal and Hezel, Fabian and Fuchs, Katharina and Pfeiffer, Harald and Hoffmann, Werner and Niendorf, Thorald} } @Proceedings { WintervOHSMGSMN, title = {Hybrid MRI/RF-Heating at 7.0 Tesla and 11.7 Tesla: Electro-Magnetic Field Simulations, Temperature Simulations/Measurements, Dipole Antenna Design and Heating Experiments}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2013}, volume = {21}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/13/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Salt Lake City, USA}, event_name = {ISMRM 21st Annual Meeting \& Exhibition 2013}, event_date = {20-26 April 2013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, Lukas and van de Lindt, Tessa and {\"O}zerdem, Celal and Hoffmann, Werner and Santoro, Davide and Mueller, Alexander and Graessl, Andreas and Seemann, Reiner and Marek, Jaroslav and Niendorf, Thoralf} } @Proceedings { KuehneWHPSSI, title = {Parallel transmission experiments using an extensible RF pulse generator}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2013}, volume = {21}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/13/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Salt Lake City, USA}, event_name = {ISMRM 21st Annual Meeting \& Exhibition 2013}, event_date = {20-26 April 2013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kuehne, Andre and Waxmann, Patrick and Hoffmann, Werner and Pfeiffer, Harald and Seemann, Reiner and Seifert, Frank and Ittermann, Bernd} } @Proceedings { , title = {Investigation of microstructured fiber geometries by scatterometry}, journal = {Proc. SPIE}, year = {2013}, volume = {8789}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {887890R}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Munich, Germany}, event_name = {Modeling Aspects in Optical Metrology IV}, event_date = {2013}, language = {30}, DOI = {10.1117/12.2020526}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hansen, P-E and Burger, S} } @Techreport { , title = {''xD-Reflect'' Multidimensionale Reflektometrie f{\"u}r die Industrie}, journal = {DfwG-Report 2013}, year = {2013}, volume = {3}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {24-40}, keywords = {Goniochromasie, Sparkling, Graininess, Coarseness, Glanz}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Vorstand der DfwG}, address = {Aachen}, institution = {Deutsche farbwissenschaftliche Gesellschaft e.V.}, language = {43}, ISSN = {1860-2835}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"o}pe, A.} } @Proceedings { PhilippLBCCGBBPCLHC2013, title = {Joint Research Project env08 “Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD) 2000/60/EC”}, journal = {16th International Congress of Metrology}, year = {2013}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, keywords = {Water Framework Directive, reference method, reference materials, PAH, priority hazardous substances}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {EDP Sciences}, event_place = {Paris, France}, event_name = {16th International Congress of Metrology}, event_date = {07-10-2013 to 10-10-2013}, language = {30}, DOI = {10.1051/metrology/201310001}, stag_bib_extends_levelofaccess = {NA}, author = {Philipp, R. and Lal{\`e}re, B. and Buzuianu, M. and Crina, I. and Ceyhan Goren, A. and Gokcen, T. and B{\'i}lsel, M. and Belli, M. and Potalivo, M. and Calabretta, E. and Lehnik-Habrink, P. and Hein, S. and Cabillic, J.} } @Article { , title = {Investigation of Material Effects With Micro-Sized SQUID Sensors}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2012}, month = {12}, day = {20}, volume = {23}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1602004}, keywords = {SQUID sensors, gradiometer, microSQUIDs, susceptometers}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6389719\&url=http\%3A\%2F\%2Fieeexplore.ieee.org\%2Fiel5\%2F77\%2F6366258\%2F06389719.pdf\%3Farnumber\%3D6389719}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2012.2235505}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bechstein, S and Kirste, A and Drung, D and Regin, M and Kazakova, O and Gallop, J and Hao, L and Cox, D and Schurig, T} } @Article { , title = {Study of Low-Frequency Noise Performance of Nanobridge-Based SQUIDs in External Magnetic Fields}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2012}, month = {12}, day = {11}, volume = {23}, number = {3}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1601004}, keywords = {Magnetic field sensitivity, nanoscale superconducting quantum interference device (SQUID).}, web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6378430}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {1051-8223}, DOI = {10.1109/TASC.2012.2233537}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rozhko, S and Hino, T and Cox, D. C. and Hao, L and Gallop, J. C. and Romans, E. J. and Blois, A} } @Article { , title = {Apparatus to measure adsorption of condensable solvents on technical surfaces by photothermal deflection.}, journal = {Review of Scientific Instruments}, year = {2012}, month = {11}, day = {28}, volume = {83}, number = {11}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {7}, keywords = {adsorption, ethanol, solvents, mirage, condensation.}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/83/11/10.1063/1.4767245}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {AIP Publishing}, address = {Melville, US}, language = {30}, ISSN = {1.4767245}, DOI = {10.1063/1.4767245}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Plimmer, M.D. and du Colombier, D. and Iraqi Houssaini, N. and Silvestri, Z. and Pinot, P. and Hannachi, R.} } @Proceedings { BodermannHBHGBSEW2012, title = {First steps towards a scatterometry reference standard}, journal = {Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VI}, year = {2012}, month = {10}, day = {25}, volume = {8466}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, CD metrology, traceability, reference standard, tool matching, AFM, SEM, rigorous modelling}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1379467}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {San Diego, USA}, event_name = {SPIE Optics \& Photonics 2012 international meeting, conference: Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VI}, event_date = {12-16 August 2012}, ISBN = {978-0-8194-9183-1}, DOI = {10.1117/12.929903}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bodermann, B. and Hansen, P.-E. and Burger, S. and Henn, M.-A. and Gross, H. and B{\"a}r, M. and Scholze, F. and Endres, J. and Wurm, M.} } @Article { , title = {Modeling of line roughness and its impact on the diffraction intensities and the reconstructed critical dimensions in scatterometry}, journal = {APPLIED OPTICS}, year = {2012}, month = {10}, day = {18}, volume = {51}, number = {30}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {7384 - 7394}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1364/AO.51.007384}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gross, H. and Henn, M.-A. and Heidenreich, S. and Rathsfeld, A. and B{\"a}r, M.} } @Article { , title = {Ultra-stable long distance optical frequency distribution using the Internet fiber network}, journal = {Optics Express}, year = {2012}, month = {10}, day = {8}, volume = {20}, number = {21}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {23518 - 23526}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-20-21-23518}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/OE.20.023518}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopez, O. and Haboucha, A. and Chanteau, B. and Chardonnet, C. and Amy-Klein, A. and Santarelli, G.} } @Proceedings { HarrisHM2012, title = {Instrument related structure in covariance matrices used for uncertainty propagation}, journal = {2012 42nd European Microwave Conference}, year = {2012}, month = {10}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {Covariance matrix, Oscilloscopes, Real-time systems, Frequency domain analysis, Uncertainty, Standards}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, event_place = {Amsterdam, Netherlands}, event_name = {42nd European Microwave Conference}, event_date = {29-10-2012 to 01-11-2012}, language = {30}, DOI = {10.23919/EuMC.2012.6459112}, stag_bib_extends_levelofaccess = {NA}, author = {Harris, P.M. and Humphreys, D.A. and Miall, J.M.} } @Article { , title = {Profile estimation for Pt submicron wire on rough Si substrate from experimental data}, journal = {OPTICS EXPRESS}, year = {2012}, month = {9}, day = {6}, volume = {20}, number = {19}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {21678 - 21686}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1364/OE.20.021678}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Karamehmedović, M. and Hansen, P.-E. and Dirscherl, K. and Karamehmedović, E. and Wriedt, T.} } @Proceedings { , title = {Near-field microwave excitation and detection of NEMS resonators}, journal = {12th IEEE Conference on Nanotechnology (IEEE-NANO)}, year = {2012}, month = {8}, day = {23}, volume = {n/a}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {1-5}, keywords = {electromechanical resonator, near-field microwave probe system}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6321922}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York}, event_place = {Birmingham}, event_name = {12th IEEE Conference on Nanotechnology}, event_date = {20-08-2013 - 23-08-2012}, language = {30}, ISBN = {978-1-4673-2198-3}, ISSN = {1944-9399}, DOI = {10.1109/NANO.2012.6321922}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hao, L and Gallop, J and Chen, J} } @Article { MokdadGHSH2012, title = {Development of a quasi-adiabatic calorimeter for the determination of the water vapor pressure curve}, journal = {Review of Scientific Instruments}, year = {2012}, month = {7}, day = {25}, volume = {83}, number = {7}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {075114}, keywords = {Quasi-adiabatic calorimeter, water vapor pressure curve, Thermalization system, temperature sensors}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4737627}, stag_bib_extends_levelofaccess = {NA}, author = {Mokdad, S. and Georgin, E. and Hermier, Y. and Sparasci, F. and Himbert, M.} } @Article { , title = {The Planck constant, watt and vacuum balances, and an evolving Mise en pratique for the kilogram in North America}, journal = {Precision Electromagnetic Measurements (CPEM), 2012 Conference on 1-6 July 2012}, year = {2012}, month = {7}, day = {1}, volume = {6250983}, number = {6250983}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {422 - 423}, keywords = {Planck constant, watt, vacuum balances, evolving Mise en pratique, kilogram}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6250983}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {CPEM}, address = {Ottawa}, language = {30}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2012.6250983}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pratt, J R and Schlamminger, S and Newell, D B and Haddad, D and Liu, R and Williams, W and Kubarych, Z and Inglis, D and Wood, B and Sanchez, C and Green, R} } @Proceedings { AkmalH2012, title = {Channel timebase errors for Digital Sampling Oscilloscopes}, journal = {2012 Conference on Precision electromagnetic Measurements}, year = {2012}, month = {7}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {Sampling oscilloscope, timebase correction, large-signal measurements}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, event_place = {Washington, DC, USA}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {01-07-2013 to 06-07-2012}, language = {30}, DOI = {10.1109/CPEM.2012.6251032}, stag_bib_extends_levelofaccess = {NA}, author = {Akmal, M. and Humphreys, D.} } @Proceedings { MiallH2012, title = {Traceable measurement of source and receiver EVM using a Real-Time Oscilloscope}, journal = {2012 Conference on Precision Electromagnetic Measurements}, year = {2012}, month = {7}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {Error vector Magnitude, real-time digital oscilloscope, measurement uncertainty, mobile communications}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, event_place = {Washington, DC, USA}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {01-07-2013 to 06-07-2012}, language = {30}, DOI = {10.1109/CPEM.2012.6250685}, stag_bib_extends_levelofaccess = {NA}, author = {Miall, J. and Humphreys, D.} } @Proceedings { HaleWDWJHHFB2012, title = {Traceability of high-speed electrical waveforms at NIST, NPL,and PTB.}, journal = {Conference on Precision Electromagnetic Measurements 2012}, year = {2012}, month = {7}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {522 to 523}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Washington, USA}, event_name = {Conference on Precision Electtromagnetic Measurements 2012}, event_date = {1 to 6 July 2012}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2012.6251033}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hale, P.D and Williams, D.F and Dienstfrey, A and Wang, J and Jargon, J and Humphreys, D.A and Harper, M and F{\"u}ser, H and Bieler, M} } @Article { , title = {A maximum likelihood approach to the inverse problem of scatterometry}, journal = {OPTICS EXPRESS}, year = {2012}, month = {5}, day = {23}, volume = {20}, number = {12}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {12771 - 12786}, keywords = {Diffraction gratings, Metrology}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-20-12-12771}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1364/OE.20.012771}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Henn, M.-A. and Gross, H. and Scholze, F. and Wurm, M. and Elster, C. and Baer, M.} } @Proceedings { HoutzagerRHEv2012, title = {Selection and characterization of resistors for a HVDC reference divider}, journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2012}, year = {2012}, day = {1}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {HVDC, resistors, metrology, voltage coefficient, temperature coefficient, high-voltage techniques, resistance measurement}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {IEEE}, event_place = {Washington DC, USA}, event_name = {CPEM 2012}, event_date = {01 - 06 July 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Houtzager, E. and Rietveldt, G. and H{\"a}llstr{\"o}m, J. and Elg, A.-P. and van der Beek, J. H. N.} } @Article { HallerJSKMSDGG2012, title = {A comparison of three different types of temperature measurement in HITU fields}, journal = {Metrologia}, year = {2012}, volume = {49}, number = {5}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {297-281}, keywords = {temperature, HITU}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {0026-1394 (Print), 1681-7575 (Online)}, DOI = {10.1088/0026-1394/49/5/S279}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Haller, J. and Jenderka, K. and Seifert, F. and Klepsch, T. and Martin, E. and Shaw, A. and Durando, G. and Guglielmone, C. and Girard, F.} } @Proceedings { HallerW2012, title = {On the Reliability of Voltage and Power as Input Parameters for the Characterization of High Power Ultrasound Applications}, journal = {AIP Conference Proceedings}, year = {2012}, volume = {1503}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {276-281}, keywords = {Calibration, voltage, power, impedance, transducers}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Heidelberg, Germany}, event_name = {12th International Symposium on Therapeutic Ultrasound}, event_date = {10 - 13 June 2012}, language = {English}, ISSN = {0094-243X (print), 1551-7616 (online)}, DOI = {10.1063/1.4769957}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Haller, J. and Wilkens, V.} } @Article { HauswaldtRJFSLM2012, title = {Uncertainty of standard addition experiments: a novel approach to include the uncertainty associated with the standard in the model equation}, journal = {Accreditation and Quality Assurance}, year = {2012}, volume = {17}, number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry}, pages = {129-138}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, DOI = {10.1007/s00769-011-0827-5}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hauswaldt, A.-L. and Rienitz, O. and J{\"a}hrling, R. and Fischer, N. and Schiel, D. and Labarraque, G, and Magnusson, B.} } @Article { PollingerHVDAMM2012, title = {Effective humidity in length measurements: comparison of three approaches}, journal = {Measurement Science and Technology}, year = {2012}, volume = {23}, number = {2}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {025502-025503}, web_url = {http://stacks.iop.org/MST/23/025503}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pollinger, F. and Hieta, T. and Vainio, M. and Doloca, N. R. and Abou-Zeid, A. and Meiners-Hagen, K. and Merimaa, M.} } @Proceedings { HallstromBDEHLMMSSW2012, title = {Design of a wideband HVDC reference divider}, journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2012}, year = {2012}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {Measurement techniques, measurement uncertainty, voltage measurement, HVDC transmission, highvoltage techniques}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {IEEE}, event_place = {Washington DC, USA Language}, event_name = {CPEM 2012}, event_date = {01 - 06 July 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"a}llstr{\"o}m, J. and Bergman, A. and Dedeoğlu, S. and Elg, A. and Houtzager, E. and Lucas, W. and Merev, A. and Meisner, J. and Sardi, A. and Suomalainen, E.-P. and Weber, C.} } @Proceedings { ElgKBH2012, title = {Characterization of dielectric properties of insulating materials for use in an HVDC reference divider}, journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2012}, year = {2012}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, keywords = {HVDC, dielectric, metrology, current measurement, high-voltage techniques}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {IEEE}, event_place = {Washington DC, USA}, event_name = {CPEM 2012}, event_date = {01 - 06 July 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Elg, A. and Kharezy, M. and Bergman, A. and H{\"a}llstr{\"o}m, J.} } @Proceedings { KlepschLHBIS2012, title = {Calibration of fibre-optic RF E/H-field probes using a magnetic resonance (MR) compatible TEM cell and dedicated MR measurement techniques}, journal = {Biomedizinische Technik : Proceedings BMT 2012}, year = {2012}, volume = {57 (Suppl. 1)}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, pages = {119-122}, web_url = {http://www.degruyter.com/view/j/bmte.2012.57.issue-s1-B/bmt-2012-4428/bmt-2012-4428.xml}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Jena, Germany}, event_name = {46th DGBMT Annual Conference}, event_date = {16 - 19 September, 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Klepsch, T. and Lindel, T. and Hoffmann, W. and Botterweck, H. and Ittermann, B. and Seifert, F.} } @Article { ArseneSKH2012, title = {High Sensitivity Mass Spectrometric Quantification of Serum Growth Hormone by Amphiphilic Peptide Conjugation}, journal = {Journal of Mass Spectrometry}, year = {2012}, volume = {47}, number = {12}, number2 = {T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine}, pages = {1554–1560}, keywords = {quantitative proteomics; derivatization; tandem mass spectrometry; acromegaly; glucose tolerance tests}, web_url = {http://arxiv.org/pdf/1205.4981.pdf}, misc2 = {iMERA-Plus: Call 2007 Health}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Arsene, C. and Schulze, D. and Kratzsch, J. and Henrion, A.} } @Article { PollingerMBDSNJHAM2012, title = {The upgraded PTB 600 m baseline: a high-accuracy reference for the calibration and the development of long distance measurement devices}, journal = {Measurement Science and Technology}, year = {2012}, volume = {23}, number = {9}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {094018}, keywords = {geodetic baseline, long distance measurement, refractivity compensation, calibration, measurement uncertainty, length measurement, femtosecond laser-based time-of-flight distance meter}, web_url = {http://stacks.iop.org/MST/23/094018}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, ISSN = {0957-0233}, DOI = {10.1088/0957-0233/23/9/094018}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pollinger, F. and Meyer, T. and Beyer, J. and Doloca, N. and Schellin, W. and Niemeier, W. and Jokela, J. and H{\"a}kli, P. and Abou-Zeid, A. and Meiners-Hagen, K.} } @Proceedings { HudlickaJSK2013, title = {Waveform metrology for error vector magnitude measurements in a 300 GHz transmission system}, journal = {Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2012}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {error vector magnitude, waveform metrology}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Washington DC, USA}, event_name = {Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {1 - 6 July 2012}, language = {English}, DOI = {10.1109/CPEM.2012.6251035}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hudlicka, M. and Jastrow, C. and Schrader, T. and Kleine-Ostmann, T.} } @Proceedings { HudlickaSH2012, title = {Towards Metrological Characterization of Vector Signal Analyzers}, journal = {Proceedings of the European Microwave Conference}, year = {2012}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, web_url = {http://www.ieeeexplore.us/stamp/stamp.jsp?tp=\&arnumber=6459150\&isnumber=6459071}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Amsterdam, The Netherlands}, event_name = {European Microwave Conference}, event_date = {28 October - 2 November 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hudlicka, M. and Salhi, M. and Humphreys, D.} } @Article { Huclicka2012, title = {Metrologie digit{\'a}lne modulovanych sign{\'a}lu}, journal = {Metrologie}, year = {2012}, volume = {21}, number = {3}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {1210-3543}, misc2 = {EMRP A169: Call 2010 Industry}, language = {Czech}, ISSN = {1210-3543}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hudlicka, M.} } @Proceedings { Hudlicka2012, title = {Metrologie v modern{\'i}ch komunikacn{\'i}ch syst{\'e}mech}, journal = {Proceedings of the 36th meeting of the Czech electrotechnical society, subgroup Microwave technique}, year = {2012}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Prague, Czech Republic}, event_name = {36th meeting of the Czech electrotechnical society, subgroup Microwave technique}, event_date = {23 May 2012}, language = {Czech}, ISSN = {36th meeting of the Czech electrotechnical society, subgroup Microwave technique}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hudlicka, M.} } @Article { LenzEHZP2012, title = {Traceable measurements of electrical conductivity and Seebeck coefficient of \(\beta\)-Fe0.95Co0.05Si2 and Ge in the temperature range from 300 K to 850 K}, journal = {Physica Status Solidi (c)}, year = {2012}, volume = {9}, number = {12}, number2 = {ENG02: Harvesting: Metrology for Energy Harvesting}, pages = {2432-2435}, misc2 = {EMRP A169: Call 2009 Energy}, language = {English}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lenz, E. and Edler, F. and Haupt, S. and Ziolkowski, P. and Pernau, H.} } @Article { AckoMHB2012, title = {Standards for testing freeform measurement capability of optical and tactile co-ordinate measuring machines}, journal = {Measurement Science and Technology}, year = {2012}, volume = {23}, number = {9}, number2 = {T3.J2.2: NIMTech: Metrology for New Industrial Measurement Technologies}, keywords = {traceability, coordinate measuring machine, freeform, 3D artefact, performance test, gear standard}, web_url = {http://iopscience.iop.org/0957-0233}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, ISSN = {957-0233}, DOI = {10.1088/0957-0233/23/9/094013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Acko, B. and McCarthy, M. and Haertig, F. and Buchmeister, B.} } @Proceedings { OlschewskiRSKPEMGHPFK2012, title = {In-flight blackbody calibration sources for the GLORIA interferometer}, journal = {Proceedings of SPIE 8511 - Infrared Remote Sensing and Instrumentation XX, 85110I}, year = {2012}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {GLORIA, remote sensing, blackbody, calibration, infrared, limb sounder, thermoelectric cooler, ITS-90}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1387106}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {San Diego, CA, United States}, event_name = {SPIE 8511 Infrared Remote Sensing and Instrumentation XX}, event_date = {12 - 16 August 2012}, language = {English}, DOI = {10.1117/12.928194}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Olschewski, F. and Rolf, C. and Steffens, P. and Kleinert, A. and Piesch, C. and Ebersoldt, A. and Monte, C. and Gutschwager, B. and Hollandt, J. and Preusse, P. and Friedl-Vallon, F. and Koppmann, R.} } @Proceedings { MonteGAKOH2012, title = {Radiation thermometry for remote sensing at PTB}, journal = {AIP Conference Proceedings}, year = {2012}, volume = {8}, number = {1552}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {Radiation Thermometry, Radiance, Remote Sensing, Vacuum, Emissivity}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Anaheim, USA}, event_name = {Temperature: Its Measurement and Control in Science and Industry}, event_date = {19 - 23 March 2012}, language = {English}, DOI = {10.1063/1.4819631}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Gutschwager, B. and Adibekyan, A. and Kehrt, M. and Olschewski, F. and Hollandt, J.} } @Article { VillamarinFPCRHVC2012, title = {Distribuci{\'o}n angular de la intensidad radiante espectral de LEDs blancos de alta luminosidad - Angular and spectral radiant intensity distribution of high brightness white LEDS}, journal = {Optica Pura y Aplicada}, year = {2012}, volume = {45}, number = {2}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, pages = {131-136}, keywords = {LEDs, Gonio‐Spectro‐Photometer, Luminous Intensity, LED Angular Distribution, LED Emission, Spectral Distribution, High Brightness, White LEDs}, web_url = {http://www.scopus.com/inward/record.url?eid=2-s2.0-84871420576\&partnerID=65\&md5=a928625cebaaaba8080da7225160b9ff}, misc2 = {EMRP A169: Call 2009 Energy}, language = {Spanish}, ISSN = {2171-8814}, DOI = {10.7149/OPA.45.2.131}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Villamarin, A. and Ferrero, A. and Pons, A. and Campos, J. and Rabal, A. and Hernanz, M. and Vel{\'a}squez, J. and Corrons, A.} } @Inbook { VelasquezCPFH2013, title = {Dise{\~n}o de un medidor mes{\'o}pico}, year = {2012}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, keywords = {Visi{\'o}n mes{\'o}pica, medidor mes{\'o}pico, fotometr{\'i}a mes{\'o}pica}, misc2 = {EMRP A169: Call 2009 Energy}, editor = {Joaquin Campos, Esther Perales and Rafael Huertas}, publisher = {Copicentro Granada S.L.}, booktitle = {Ciencia y Tecnolog{\'i}a del Color}, language = {Spanish}, ISSN = {978-84-15536-60-4}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Vel{\'a}squez, J. and Campos, J. and Pons, A. and Ferrero, A. and Hernanz, M.} } @Proceedings { VillamarinVPFCH2013, title = {Estudio de la iluminancia en funci{\'o}n de la distancia de LEDs de alta luminosidad}, journal = {Proceedings of X Reuni{\'o}n Nacional de {\'O}ptica}, year = {2012}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Zaragoza, Spain}, event_name = {X Reuni{\'o}n Nacional de {\'O}ptica}, event_date = {04 September 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Villamarin, A. and Vel{\'a}squez, J. and Pons, A. and Ferrero, A. and Campos, J. and Hermanz, M.} } @Proceedings { HeinsGBB2012, title = {State-space formulation for the Nodal Load Observer for smart electrical grids with imperfect measurement infrastructure}, journal = {Proceedings of XX IMEKO World Congress - Metrology for Green Growth}, year = {2012}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, keywords = {Distribution grid, dynamic state estimation, state observation, nodal load estimation, nodal load observer, disturbance observer, Kalman filter}, web_url = {http://www.imeko.org/publications/wc-2012/IMEKO-WC-2012-TC20-P4.pdf}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Busan, Republic of Korea}, event_name = {XX IMEKO World Congress - Metrology for Green Growth}, event_date = {9 - 14 September 2012}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Heins, W. and Gewiss, G. and Bohn, C. and Beck, H.-P.} } @Article { NwabohHL2012, title = {Measurement of CO2 in a multipass cell and in a hollow-core photonic bandgap fiber at 2µm}, journal = {Applied Physics B}, year = {2012}, number2 = {T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection}, pages = {8pp}, tags = {Author's version can be published 2013-05-29. Copyright note: This is an author-created, un-copyedited version of an article accepted for publication in Applied Physics B. The definitive publisher-authenticated version is available online at doi: 10.1007/s00340-012-5047-0 The final publication is available at www.springerlink.com}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, DOI = {10.1007/s00340-012-5047-0}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nwaboh, J. A. and Hald, J. and Lyngs, J. K.} } @Proceedings { GraesslRHFPHKMN, title = {Design, Evaluation and Application of a Modular 32 Channel Transmit/Receive Surface Coil Array for Cardiac MRI at 7T}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2012}, volume = {20}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/12/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Melbourne, Australia}, event_name = {ISMRM 20th Annual Meeting and Exhibition}, event_date = {5-11 May 2012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Graessl, Andreas and Renz, Wolfgang and Hezel, Fabian and Frauenrath, Tobias and Pfeiffer, Harald and Hoffmann, Werner and Kellmann, Peter and Martin, Conrad and Niendorf, Thorals} } @Proceedings { HayHFSDL2012, title = {D{\'e}veloppement d’installations de r{\'e}f{\'e}rence pour la mesure des propri{\'e}t{\'e}s thermophysiques {\`a} haute temp{\'e}rature}, year = {2012}, number2 = {ENG06: Powerplants: Metrology for Improved Power Plant Efficiency}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Bordeaux (France)}, event_name = {SFT 2012}, event_date = {29 May - 01 June 2012}, language = {French}, ISSN = {1259-164X}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hay, Bruno and Hameury, Jacques and Fleurence, Nolwenn and Scoarnec, Vincent and Dav{\'e}e, Guillaume and Lacipiere, Pascal} } @Proceedings { WinterOHWSMLRMSIN, title = {Design and Evaluation of an Eight Channel TX/RX Hybrid Applicator for Imaging and Targeted RF-Heating at 7.0 T}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2012}, volume = {20}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/12/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Melbourne, Australia}, event_name = {ISMRM 20th Annual Meeting and Exhibition}, event_date = {5-11 May 2012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, Lukas and {\"O}zerdem, Celal and Hoffmann, Werner and Waiczies, Helmar and Santoro, Davide and M{\"u}ller, Alexander and Lindel, Tomasz and Renz, Wolfgang and Martin, Conrad and Seifert, Frank and Ittermann, Bernd and Niendorf, Thoralf} } @Proceedings { AlexanderDieringerdHHNS, title = {Design, Implementation, Application and Evaluation of a MR Compatible Left Ventricle Model}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2012}, volume = {20}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/12/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Melbourne, Australia}, event_name = {ISMRM 20th Annual Meeting and Exhibition}, event_date = {5-11 May 2012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Alexander Dieringer, Matthias and de Quadros, Thiago and Hentschel, Jan and Hoffmann, Werner and Niendorf, Thoralf and Schulz-Menger, Jeanette} } @Proceedings { OzerdemWHWSSMOLIN, title = {Design and Evaluation of a Dipole Antenna TX/RX element as a Building Block for Combined MR imaging and RF Hyperthermia at 7.0 T}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2012}, volume = {20}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/12/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Melbourne, Australia}, event_name = {ISMRM 20th Annual Meeting and Exhibition}, event_date = {5-11 May 2012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {{\"O}zerdem, Celal and Winter, Lukas and Hoffmann, Werner and Waiczies, Helmar and Seemann, Reiner and Santoro, Davide and Mueller, Alexander and Ok, Abdullah and Lindel, Tomasz and Ittermann, Bernd and Niendorf, Thoralf} } @Proceedings { PapadakiHPMH, title = {SAR around uni- and bi-lateral metal-on-metal hip implants at 1.5 and 3T}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2012}, volume = {20}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/12/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Melbourne, Australia}, event_name = {ISMRM 20th Annual Meeting and Exhibition}, event_date = {5-11 May 2012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Papadaki, Annie and Hand, Jeff and Powell, John and McRobbie, Donald and Hart, Alister} } @Proceedings { HoliastouFT2012, title = {Presentation of the European program EMRP ENG04 ''Metrology for smart electrical grids''}, year = {2012}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, keywords = {energy, power quality, smart meter, phasor measurement unit (PMU), on site network measurements.}, web_url = {http://hdl.handle.net/11637/98}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Athens, Greece}, event_name = {Metrologia 2012}, event_date = {3-4 February 2012}, language = {Greek}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Holiastou, M. and Flouda, E. and Todi, T.} } @Proceedings { HeinsHBB2012, title = {Einsatz von St{\"o}rgr{\"o}{\ss}enbeobachtern f{\"u}r elektrische Verteilnetze}, journal = {Proceedings of the Workshop des GMA FA 1.40 ''Theoretische Verfahren der Regelungstechnik''}, year = {2012}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, web_url = {http://www.gma.tu-darmstadt.de/gma/archiv_1/archiv_2011_2/index.de.jsp}, misc = {A169}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Salzburg}, event_name = {Workshop des GMA FA 1.40 ''Theoretische Verfahren der Regelungstechnik''}, event_date = {September 16-19, 2012}, language = {German}, ISBN = {978-3-9815012-3-0}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Heins, W. and Hingst, J. z. and Beck, H.-P. and Bohn, C.} } @Article { , title = {ILITS Experiment at TANDEM-ALPI accelerator}, journal = {LNL Annual Report 2012, INFN-LNL-Report}, year = {2012}, volume = {239}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Ion beam dosimetry, nanodosimetry, track structure}, web_url = {www.lnl.infn.it/\verb=~=annrep/read_ar/2012/contributions/pdfs/178_D_51_D025.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1828-8561}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Moro, D. and Colautti, P. and Conte, V. and Hilgers, G. and Pausewang, A. and Helms, W. and Lambertsen, B. and Rabus, H.} } @Article { , title = {Efficient implementation of a Monte Carlo method for uncertainty evaluation in dynamic measurements}, journal = {IOP Metrologia}, year = {2012}, volume = {499}, number = {3}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {401-410}, keywords = {dynamic measurement, digital filter, uncertainty, GUM, Monte Carlo}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, DOI = {10.1088/0026-1394/49/3/401}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2013-1-1}, author = {Eichst{\"a}dt, S and Link, A and Harris, P and Elster, C} } @Proceedings { MerevEHBDH2011, title = {Design of 1000 kV DC High Voltage Divider / 1000 kV Diren\c{c}sel DC Y{\"u}ksek Gerilim B{\"o}l{\"u}c{\"u}s{\"u}n{\"u}n Tasarımı}, journal = {Proceedings II. ELEKTRİK TESİSAT ULUSAL KONGRESİ}, year = {2011}, month = {11}, day = {24}, volume = {1}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {396-399}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {The Chamber of Turkish Electrical Engineers/T{\"u}rkiye Elektrik M{\"u}hendisleri Odası}, event_place = {Izmir, Turkey}, event_name = {II. ELEKTRİK TESİSAT ULUSAL KONGRESİ}, event_date = {24 - 27 November 2011}, language = {Turkish}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Merev, A. and Elg, A. and H{\"a}llstr{\"o}m, J. and Bergman, A. and Dedeoğlu, S. and Houtzager, E.} } @Proceedings { BodermannBDBSKWKHKvYSEBS2011, title = {Joint Research on Scatterometry and AFM Wafer Metrology}, journal = {AIP Conference Proceedings}, year = {2011}, month = {11}, day = {10}, volume = {1395}, number = {319 (2011)}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {Scatterometry, CD metrology, AFM, reference standard, rigorous modelling, inverse diffraction problem}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {American Institute of Physics}, event_place = {Grenoble, France}, event_name = {International Conference on Frontiers of Characterisation and Metrology for Nanoelectronics FCMN 2011}, event_date = {23-26 May 2011}, language = {30}, DOI = {10.1063/1.3657910}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bodermann, B. and Buhr, E. and Danzebrink, H.-U. and B{\"a}r, M. and Scholze, F. and Krumrey, M. and Wurm, M. and Klapetek, P. and Hansen, P.-E. and Korpelainen, V. and van Veghel, M. and Yacoot, A. and Siitonen, S. and El Gawhary, O. and Burger, S. and Saastamoinen, T.} } @Article { ArslanovSNCLPBH2011, title = {Rapid and sensitive trace gas detection with continuous wave Optical Parametric Oscillator-based Wavelength Modulation Spectroscopy}, journal = {Applied Physics B}, year = {2011}, month = {9}, day = {25}, volume = {103}, number = {1}, number2 = {T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection}, pages = {223-228}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Arslanov, D.D. and Spunei, M. and Ngai, A.K.Y. and Cristescu, S.M. and Lindsay, I.D. and Persijn, S.T. and Boller, K.J. and Harren, F.J. M.} } @Article { RietveldZKHKdL2011, title = {Characterization of a Wideband Digitizer for Power Measurements uo to 1 MHz}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2011}, month = {7}, volume = {60}, number = {7}, number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques}, pages = {2195-2201}, keywords = {Digital filters, Digital–analog conversion, digitizer, frequency response, phase measurement, power measurement, wideband power}, tags = {SEG}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, Gert and Zhao, Dongsheng and Kramer, Charlotte and Houtzager, Ernest and Kristensen, Orla and de Leffe, Cyrille and Lippert, Torsten} } @Article { RietveldvH2011, title = {DC Characterization of AC Current Shunts for Wideband Power Applications}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2011}, month = {7}, volume = {60}, number = {7}, number2 = {T4.J01: Power \& Energy: Next generation of power and energy measuring techniques}, pages = {2191-2194}, keywords = {Current shunts , current , environmental factors , measurement standards , power coefficient , power measurements , stability , temperature coefficient}, tags = {SEG}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, Gert and van der Beek, J.H.N. and Houtzager, Ernest} } @Proceedings { HallerJKSKS2011, title = {A Low-Cost, Easy-to-Handle Calibration Phantom for MR Thermometry in HIFU Fields}, journal = {AIP Conference Proceedings}, year = {2011}, month = {4}, volume = {1481}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {125-130}, keywords = {ultrasound therapy, calibration phantom, MR thermometry, HITU, HIFU}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {New York, USA}, event_name = {11th International Symposium on Therapeutic Ultrasound (ISTU)}, event_date = {11 - 13, April 2011}, language = {English}, ISSN = {0094-243X (print), 1551-7616 (online)}, DOI = {10.1063/1.4757322}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Haller, J. and Jenderka, K. and Koch, C. and Seifert, F. and Klepsch, T. and Shaw, A.} } @Article { HughesFLSVN2011, title = {Laser tracker error determination using a network measurement}, journal = {Measurement Science and Technology}, year = {2011}, month = {3}, volume = {22}, number = {045103}, number2 = {T3.J2.2: NIMTech: Metrology for New Industrial Measurement Technologies}, pages = {12pp.}, misc2 = {iMERA-Plus: Call 2007 Length}, DOI = {10.1088/0957-0233/22/4/045103}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hughes, B. and Forbes, A. and Lewis, A. and Sun, W. and Veal, D. and Nasr, K.} } @Article { HaoAGCRKJDS2011, title = {Detection of single magnetic nanobead with a nano-superconducting quantum interference device}, journal = {Applied Physics Letters}, year = {2011}, month = {2}, day = {28}, volume = {98}, number = {9}, number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics}, note = {No pdf received}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, DOI = {10.1063/1.3561743}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hao, L. and Assmann, C. and Gallop, J. C. and Cox, D. and Ruede, F. and Kazakova, O. and Josephs-Franks, P. and Drung, D. and Schurig, Th.} } @Article { , title = {Calibration of the Irradiance Responsivity of a Filter Radiometer for T Measurement at NIM}, journal = {International Journal of Thermophysics}, year = {2011}, month = {1}, day = {19}, volume = {32}, number = {1-2}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {278-284}, keywords = {Filter radiometer · Monochromator · Spectral responsivity · Thermodynamic temperature}, web_url = {http://link.springer.com/article/10.1007/s10765-011-0911-4}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Europe/Asia/Africa}, language = {30}, ISSN = {0195-928X}, DOI = {10.1007/s10765-011-0911-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lu, X and Yuan, Z and Hao, X and Lin, Y and Yang, J} } @Article { JeanneretROvH2011, title = {High precision comparison between a programmable and a pulse-driven Josephson voltage standard}, journal = {Metrologia}, year = {2011}, volume = {48}, number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications}, pages = {311-316}, note = {Only available as publisher's version.}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, DOI = {10.1088/0026-1394/48/5/011}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Jeanneret, B. and Ruefenacht, A. and Overney, F. and van den Brom, H. and Houtzager, E.} } @Article { GoenagaInfanteKSHJ2011, title = {Capabilities of HPLC with APEX-Q nebulisation ICP-MS and ESI MS/MS to compare selenium uptake and speciation of non-malignant with different B cell lymphoma lines}, journal = {Analytical and Bioanalytical Chemistry}, year = {2011}, volume = {399}, number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry}, pages = {1789-1797}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Goenaga-Infante, Heidi and Kassam, Shireen and Stokes, Emma and Hopley, Christopher and Joel, Simon P.} } @Article { RebaneHL2011, title = {Analysis of selenomethylselenocysteine and selenomethionine by LC-ESI-MS/MS with diethyl ethoxymethylenemalonate derivatization}, journal = {Analyst}, year = {2011}, number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, DOI = {10.1039/C0AN01031F}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rebane, Riin and Herodes, Koit and Leito, Ivo} } @Article { ShawBKGH2011, title = {Calibration of HIFU intensity fields measured using an infra-red camera}, journal = {Journal of Physics: Conference Series}, year = {2011}, volume = {279}, number = {012019}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Shaw, A. and Bobkova, S. M. and Khokhlova, V. A. and Gavrilov, L. R. and Hand, J. W.} } @Proceedings { HallerJK2011, title = {Characterization and quantification of HITU fields with a fiber-optic displacement sensor}, journal = {Proceedings of the 10th International Symposium on Therapeutic Ultrasound}, year = {2011}, volume = {1359}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, pages = {19-23}, misc2 = {iMERA-Plus: Call 2007 Health}, publisher = {AIP Conference Proceedings}, event_place = {Tokyo, Japan}, event_name = {10th International Symposium on Therapeutic Ultrasound}, event_date = {9 - 12 June 2011}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}