This file was created by the TYPO3 extension bib --- Timezone: CEST Creation date: 2022-05-22 Creation time: 10-03-13 --- Number of references 387 article BriantKCLBWRMPCESTHPKKDZWMSNB2022 2714 Optics 2022 4 29 3 2 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 159-176 thermometry; photonic; optomechanic; temperature sensors; photonic integrated circuit https://doi.org/10.3390/opt3020017 EMPIR 2017: Fundamental MDPI AG 30 2673-3269 10.3390/opt3020017 NA T.Briant S.Krenek A.Cupertino F.Loubar R.Braive L.Weituschat D.Ramos M.J.Martin P.A.Postigo A.Casas R.Eisermann D.Schmid S.Tabandeh O.Hahtela S.Pourjamal O.Kozlova S.Kroker W.Dickmann L.Zimmermann G.Winzer T.Martel P.G.Steeneken R.A.Norte S.Briaudeau article VolkovaHTBCMARERBPN2022 2712 Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 color centers, optical quantum technology EMPIR 2020: Fundamental MDPI 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov article VolkovaHTBCMARERBPN2022_2 2721 Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time EMPIR 2020: Fundamental MDPI AG 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov proceedings BircherMKBEKHHL2022 2585 Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022, 2022 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry traceability, Dimensional metrology, XCT machine geometry, calibrated reference standards, radiographic XCT geometry determination, stage error motion, CFD/FE simulations, image quality metric based methods https://www.ndt.net/search/docs.php3?id=26614 EMPIR 2017: Industry Wels, Austria 11th Conference on Industrial Computed Tomography (iCT) 2022 08-02-2022 to 11-02-2022 30 NA https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id209.pdf B.Bircher F.Meli A.Küng C.Bellon S.Evsevleev M.Katić V.Heikkinen B.Hemming A.Lassila article BeckhoffURHTHE2022 2463 ChemPhysChem 2022 1 14 HLT10: BiOrigin: Metrology for biomolecular origin of disease 1-11 antimicrobialpeptides, electrostatic interactions, IR spectroscopy, phospholipid membranes, protein folding EMRP A169: Call 2011 Metrology for Health Wiley 30 1439-4235, 1439-7641 NA https://doi.org/10.1002/cphc.202100815 B.Beckhoff G.Ulm M.G.Ryadnov A.Hoehl B.Tiersch A.Hornemann D.M.Eichert article FasoloBBCCCCCDEFFFFGGGGKLLLMMMMMMMNOPPPRRRSUV2022 2612 IEEE Transactions on Applied Superconductivity 2022 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology Physics, Gain, Microwave amplifiers, Noise figure, Superconducting microwave devices, Microwave photonics, Bandwidth EMPIR 2017: Fundamental Institute of Electrical and Electronics Engineers (IEEE) 30 1051-8223, 1558-2515, 2378-707 10.1109/TASC.2022.3148692 NA L.Fasolo C.Barone M.Borghesi G.Carapella A.P.Caricato I.Carusotto W.Chung A.Cian D.Di Gioacchino E.Enrico P.Falferi M.Faverzani E.Ferri G.Filatrella C.Gatti A.Giachero D.Giubertoni A.Greco C.Kutlu A.Leo C.Ligi P.Livreri G.Maccarone B.Margesin G.Maruccio A.Matlashov C.Mauro R.Mezzena A.G.Monteduro A.Nucciotti L.Oberto S.Pagano V.Pierro L.Piersanti M.Rajteri A.Rettaroli S.Rizzato Y.K.Semertzidis S.V.Uchaikin A.Vinante article FasoloGEILVL2021 2582 Measurement: Sensors 2021 12 18 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology 100349 Microwave quantum illumination, Josephson traveling wave parametric amplifiers, Entangled quantum states, Detection probability improvement EMPIR 2017: Fundamental Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100349 NA L.Fasolo A.Greco E.Enrico F.Illuminati R.Lo Franco D.Vitali P.Livreri article ForbesJDE2021 2458 Measurement: Sensors 2021 12 18 1 17IND12: Met4FoF: Metrology for the Factory of the Future 100128 Gaussian processes, design of experiment, measurement uncertainty, sensor networks EMPIR 2017: Industry Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100128 NA A.Forbes K.Jagan J.Donlevy S.Eichstädt article GrecoFMCE2021 2342 Physical Review B 2021 11 24 104 18 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology Superconductivity, Josephson junctions, Josephson metamaterials, Parametric amplifiers https://arxiv.org/abs/2009.01002 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.104.184517 NA A.Greco L.Fasolo A.Meda L.Callegaro E.Enrico article RiemannAEBMSSRIF2021 2569 Magnetic Resonance in Medicine 2021 11 16 87 3 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 1119-1135 CRLBs, measurement precision, minimal detectable change, MR spectroscopy, reproducibility/repeatability, SPECIAL https://onlinelibrary.wiley.com/doi/10.1002/mrm.29034 EMPIR 2018: Health Wiley 30 0740-3194, 1522-2594 10.1002/mrm.29034 NA L.T.Riemann C.S.Aigner S.L.R.Ellison R.Brühl R.Mekle S.Schmitter O.Speck G.Rose B.Ittermann A.Fillmer article Eichstadt2021 2464 Research Outreach 2021 11 126 17IND12: Met4FoF: Metrology for the Factory of the Future sensor network, industry 4.0, machine learning, software, multi-agent system EMPIR 2017: Industry Research Outreach 30 10.32907/RO-126-1869538673 NA S.Eichstädt article HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021 2336 NeuroImage 2021 11 241 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 118430 Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site EMPIR 2018: Health Elsevier BV 30 1053-8119 10.1016/j.neuroimage.2021.118430 NA S.C.N.Hui M.Mikkelsen H.J.Zöllner V.Ahluwalia S.Alcauter L.Baltusis D.A.Barany L.R.Barlow R.Becker J.I.Berman A.Berrington P.K.Bhattacharyya J.U.Blicher W.Bogner M.S.Brown V.D.Calhoun R.Castillo K.M.Cecil Y.B.Choi W.C.W.Chu W.T.Clarke A.R.Craven K.Cuypers M.Dacko C.de la Fuente-Sandoval P.Desmond A.Domagalik J.Dumont N.W.Duncan U.Dydak K.Dyke D.A.Edmondson G.Ende L.Ersland C.J.Evans A.S.R.Fermin A.Ferretti A.Fillmer T.Gong I.Greenhouse J.T.Grist M.Gu A.D.Harris K.Hat S.Heba E.Heckova J.P.Hegarty K-F.Heise S.Honda A.Jacobson J.F.A.Jansen C.W.Jenkins S.J.Johnston C.Juchem A.Kangarlu A.B.Kerr K.Landheer T.Lange P.Lee S.R.Levendovszky C.Limperopoulos F.Liu W.Lloyd D.J.Lythgoe M.G.Machizawa E.L.MacMillan R.J.Maddock A.V.Manzhurtsev M.L.Martinez-Gudino J.J.Miller H.Mirzakhanian M.Moreno-Ortega P.G.Mullins S.Nakajima J.Near R.Noeske W.Nordhøy G.Oeltzschner R.Osorio-Duran M.C.G.Otaduy E.H.Pasaye R.Peeters S.J.Peltier U.Pilatus N.Polomac E.C.Porges S.Pradhan J.J.Prisciandaro N.A.Puts C.D.Rae F.Reyes-Madrigal T.P.L.Roberts C.E.Robertson J.T.Rosenberg D-G.Rotaru R.L.O'Gorman Tuura M.G.Saleh K.Sandberg R.Sangill K.Schembri A.Schrantee N.A.Semenova D.Singel R.Sitnikov J.Smith Y.Song C.Stark D.Stoffers S.P.Swinnen R.Tain C.Tanase S.Tapper M.Tegenthoff T.Thiel M.Thioux P.Truong P.van Dijk N.Vella R.Vidyasagar A.Vovk G.Wang L.T.Westlye T.K.Wilbur W.R.Willoughby M.Wilson H-J.Wittsack A.J.Woods Y-C.Wu J.Xu M.Y.Lopez D.K.W.Yeung Q.Zhao X.Zhou G.Zupan R.A.E.Edden article DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021 2365 Frontiers in Remote Sensing 2021 10 19 2 19ENV04: MAPP: Metrology for aerosol optical properties GRASP, Radiative Transfer, Inversion model https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full EMPIR 2019: Environment Frontiers Media SA 30 2673-6187 10.3389/frsen.2021.706851 NA O.Dubovik D.Fuertes P.Litvinov A.Lopatin T.Lapyonok I.Doubovik F.Xu F.Ducos C.Chen B.Torres Y.Derimian L.Li M.Herreras-Giralda M.Herrera Y.Karol C.Matar G.L.Schuster R.Espinosa A.Puthukkudy Z.Li J.Fischer R.Preusker J.Cuesta A.Kreuter A.Cede M.Aspetsberger D.Marth L.Bindreiter A.Hangler V.Lanzinger C.Holter C.Federspiel proceedings WeidingerDLYKZEMZ2021 2253 Measurement: Sensors 2021 9 23 18 19ENG08: WindEFCY: Traceable mechanical and electrical power measurement for efficiency determination of wind turbines 100159 nacelle test bench, wind turbine power curves, direct efficiency determination, mechanical power measurement, electrical power measurement EMPIR 2019: Engergy Elsevier BV Yokohama, JAPAN XXIII IMEKO World Congress 30-08-2021 to 03-09-2021 30 2665-9174 10.1016/j.measen.2021.100159 NA P.Weidinger A.Dubowik C.Lehrmann N.Yogal R.Kumme M.Zweiffel N.Eich C.Mester H.Zhang proceedings SongWEZYK2021 2252 Measurement: Sensors 2021 9 22 18 19ENG08: WindEFCY: Traceable mechanical and electrical power measurement for efficiency determination of wind turbines 100249 nacelle test bench, wind turbine, inclinometer, rotational speed measurement, mechanical power measurement EMPIR 2019: Engergy Elsevier BV Yokohama, JAPAN XXIII IMEKO World Congress 30-08-2021 to 03-09-2021 30 2665-9174 10.1016/j.measen.2021.100249 NA Z.Song P.Weidinger N.Eich H.Zhang N.Yogal R.Kumme article ArduiniMSEH2021 2199 Sensors 2021 9 17 21 18 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties 6252 emissivity, reflectivity, infrared radiation, high temperature, FTIR-spectrometer, blackbody,uncertainty, X-point, inductive heating, direct radiative method EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s21186252 NA M.Arduini J.Manara T.Stark H-P.Ebert J.Hartmann article EssBKGV2021 2081 Journal of Aerosol Science 2021 9 157 18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants 105820 soot, aerosol, secondary organic matter, calibration, black carbon, absorption photometers EMPIR 2018: Health Elsevier BV 30 0021-8502 10.1016/j.jaerosci.2021.105820 NA M.N.Ess M.Bertò A.Keller M.Gysel-Beer K.Vasilatou article EisermannKWR2021 2243 tm - Technisches Messen 2021 9 88 10 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 640-654 Thermometry; photonic; temperature sensor; optical ring resonator EMPIR 2017: Fundamental Walter de Gruyter GmbH 30 2196-7113, 0171-8096 10.1515/teme-2021-0054 NA R.Eisermann S.Krenek G.Winzer S.Rudtsch article DorstRESS2021 2170 Journal of Sensors and Sensor Systems 2021 8 24 10 2 17IND12: Met4FoF: Metrology for the Factory of the Future 233-245 synchronization, machine learning, sensor network https://jsss.copernicus.org/articles/10/233/2021/ EMPIR 2017: Industry Copernicus GmbH 30 2194-878X 10.5194/jsss-10-233-2021 NA T.Dorst Y.Robin S.Eichstädt A.Schütze T.Schneider article EdlerBGJTAASZ2021 2137 International Journal of Thermophysics 2021 8 42 11 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 1-13 Noble metal thermocouples, Reference function, Thermoelectric stability and homogeneity https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf. EMPIR 2017: Industry Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-021-02895-w NA F.Edler J.Bojkovski C.Garcia Izquerdo M.Jose Martin D.Tucker N.Arifovic S.L.Andersen L.Šindelárová V.Žužek article BarrattRCSKE2021 2167 Physical Review B 2021 7 30 104 3 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 035436 single electrons, electron interferometry, quantum transport, electron quantum optics https://arxiv.org/abs/2104.01653 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.104.035436 NA C.J.Barratt S.Ryu L.A.Clark H.-S.Sim M.Kataoka C.Emary article KruskopfBPCPREPPGS2021 2113 IEEE Transactions on Electron Devices 2021 7 68 7 18SIB07: GIQS: Graphene impedance quantum standard 3672-3677 Alternating current, dissipation factor,double-shield, epitaxial graphene, magnetocapacitance,magnetotransport, precision measurements, quantized Hallresistance (QHR) standards, quantum Hall effect (QHE),superconducting contacts https://ieeexplore.ieee.org/document/9446081 EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9383, 1557-9646 10.1109/TED.2021.3082809 NA M.Kruskopf S.Bauer Y.Pimsut A.Chatterjee D.K.Patel A.F.Rigosi R.E.Elmquist K.Pierz E.Pesel M.Götz J.Schurr article MarzanoTDSEOPKC2021 2115 ACTA IMEKO 2021 6 29 10 2 18SIB07: GIQS: Graphene impedance quantum standard 24 Quantum Hall effect, Metrology, Impedance, Graphene, Cryogenic probe https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-10%20%282021%29-02-05 EMPIR 2018: SI Broader Scope IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v10i2.925 NA M.Marzano N.T.M.Tran V.D'Elia D.Serazio E.Enrico M.Ortolano K.Pierz J.Kucera L.Callegaro article PrzyklenkBOEYAFPZCMRB2021 2104 Measurement Science and Technology 2021 6 21 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing Advance Manufacturing, Metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), Stakeholder EMPIR 2019: Support for Networks IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac0d25 NA A.Przyklenk A.Balsamo D.O'Connor A.Evans T.Yandayan A.Akgöz O.Flys D.Phillips V.Zelený D.Czułek F.Meli C.Ragusa H.Bosse proceedings DickmannWEKPK2021 2279 Modeling Aspects in Optical Metrology VIII 2021 6 20 11783 1178309 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 1-12 optical ring resonators, heat equation, absorption, two-photon absorption, temperature sensing, thermalmodeling https://www.spiedigitallibrary.org/conference-proceedings-of-spie EMPIR 2017: Fundamental SPIE on line SPIE Optical Metrology, 2021 21-06-2021 to 25-06-2021 30 10.1117/12.2592552 NA W.Dickmann L.Weituschat R.Eisermann S.Krenek P.A.Postigo S.Kroker proceedings ThompsonRSEHL2021 2410 Proceedings 21st euspen International Conference and Exhibition 2021 6 10 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry Metrology, surface topography, metrological characteristics, X-ray computed tomography EMPIR 2017: Industry Online Conference 21st euspen International Conference and Exhibition 07-06-2021 to 10-06-2021 30 NA https://www.euspen.eu/knowledge-base/ICE21165.pdf A.Thompson Á.Rodríguez-Sánchez N.Senin M.Eifler J.Hering R.Leach proceedings PrzyklenkBOEYAFZCPMRB2021 2123 Proceedings 21st euspen International Conference and Exhibition 2021 6 2021 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing advanced manufacturing, metrology, European metrology networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0 EMPIR 2019: Support for Networks Online Conference 21st euspen International Conference and Exhibition 07-06-2021 to 10-06-2021 30 NA https://www.euspen.eu/knowledge-base//ICE21292.pdf A.Przyklenk A.Balsamo D.O’Connor A.Evans T.Yandayan S.Akgöz O.Flys V.Zelený D.Czułek D.Phillips F.Meli C.Ragusa H.Bosse article EdlerE2021 2272 tm - Technisches Messen 2021 5 20 88 10 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 592-597 Thermoelement, Kennlinienfunktion, Temperaturmessung EMPIR 2017: Industry Walter de Gruyter GmbH 43 2196-7113, 0171-8096 10.1515/teme-2021-0042 NA F.Edler P.Ederer article PeruzziRPEBu2021 2057 Metrologia 2021 4 14 58 3 18SIB02: Real-K: Realising the redefined kelvin 035009 platinum resistance thermometers (SPRTs), statistical test, fixed-point uncertainty propagation (PoU) https://iopscience.iop.org/article/10.1088/1681-7575/abe8c1/pdf EMPIR 2018: SI Broader Scope IOP Publishing

Bristol, United Kingdom

30 0026-1394, 1681-7575 10.1088/1681-7575/abe8c1 NA APeruzzi R LRusby J VPearce LEusebio JBojkovski VŽužek article deKromBZMBiGFKHE2021 2071 Atmospheric Measurement Techniques 2021 3 25 14 3 19NRM03: SI-Hg: Metrology for traceable protocols for elemental and oxidised mercury concentrations 2317-2326 Mercury, Metrology, Calibration, SI-traceability, Environmental https://amt.copernicus.org/articles/14/2317/2021/amt-14-2317-2021.html EMPIR 2019: Pre-Co-Normative Copernicus GmbH 30 1867-8548 10.5194/amt-14-2317-2021 NA I.de Krom W.Bavius R.Ziel E.A.McGhee R.J.C.Brown I.Živković J.Gačnik V.Fajon J.Kotnik M.Horvat H.Ent article MetznerWFGKE2021 1989 Physics in Medicine & Biology 2021 3 23 66 7 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers 075006 MRF, Bayesian inference, uncertainty EMPIR 2018: Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/abeae7 NA S.Metzner G.Wübbeler S.Flassbeck C.Gatefait C.Kolbitsch C.Elster article LoslerEKR2021 2007 Applied Sciences 2021 3 20 11 6 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 2785 close range photogrammetry, bundle adjustment, reference point determination, unscentedtransformation, stochastic model, satellite laser ranging, GeoMetre https://www.mdpi.com/2076-3417/11/6/2785 EMPIR 2018: SI Broader Scope MDPI AG 30 2076-3417 10.3390/app11062785 NA M.Lösler C.Eschelbach T.Klügel S.Riepl article EssBIMGV2021 2011 Aerosol Science and Technology 2021 3 15 16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols 1-25 soot, miniCAST, morphology, optical properties, calibration aerosol, combustion generator https://www.tandfonline.com/doi/full/10.1080/02786826.2021.1901847 EMPIR 2016: Environment Informa UK Limited

London, United Kingdom

30 0278-6826, 1521-7388 10.1080/02786826.2021.1901847 NA M.N.Ess M.Bertò M.Irwin R.L.Modini M.Gysel-Beer K.Vasilatou proceedings LoslerEH2021 2405 Proceedings of the 25th European VLBI for Geodesy and Astrometry (EVGA) Working Meeting 2021 3 14 2021 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 49-55 Paraboloid, Least-Squares Adjustment, Sequential Quadratic Programming, Surface Analysis, Cartesian Coordinates, Polar Coordinates, GeoMetre https://zenodo.org/record/5811948 EMPIR 2018: SI Broader Scope Gothenburg, Sweden 25th European VLBI for Geodesy and Astrometry (EVGA) Working Meeting 14-03-2021 to 18-03-2021 30 NA https://doi.org/10.5281/zenodo.5811948 M.Lösler C.Eschelbach CHolst article EichstadtGVSBK2021 2301 Sensors 2021 3 12 21 6 17IND12: Met4FoF: Metrology for the Factory of the Future 2019 Internet of Things, calibration, measurement uncertainty, traceability, semantics, ontology, sensor network, digital sensors, redundancy EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s21062019 NA S.Eichstädt M.Gruber A.P.Vedurmudi B.Seeger T.Bruns G.Kok article ModiniCBIBPFEHMLMG2021 2010 Atmospheric Measurement Techniques 2021 2 14 2 16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols 819-851 miniCAST 5201 black carbon (BC) generator; particle morphology; nanostructure; optical properties; photoacoustic absorption coefficient EMPIR 2016: Environment Copernicus GmbH 30 1867-8548 10.5194/amt-14-819-2021 NA R.L.Modini J.C.Corbin B.T.Brem M.Irwin M.Bertò R.E.Pileci P.Fetfatzis K.Eleftheriadis B.Henzing M.M.Moerman F.Liu T.Müller M.Gysel-Beer article SobanskiTSLKIPHE2021 1916 Applied Sciences 2021 1 29 11 3 16ENV05: MetNO2: Metrology for nitrogen dioxide 1222 air pollution; trace gas; nitrogen dioxide; laser spectroscopy; mid-infrared; quantum cascade laser; selective detection EMPIR 2016: Environment MDPI AG 30 2076-3417 10.3390/app11031222 NA N.Sobanski B.Tuzson P.Scheidegger H.Looser A.Kupferschmid M.Iturrate C.Pascale C.Hüglin L.Emmenegger article KoutsourakisEKB2021 1948 Measurement Science and Technology 2021 1 29 16ENG02: PV-Enerate: Advanced PV energy rating digital light processing projection EMPIR 2016: Energy IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/abe162 NA G. Koutsourakis T.D.Eales I.Kroeger J.Blakesley article SmithHEPNMWP2021 1900 Remote Sensing 2021 1 22 13 3 16ENV03: MetEOC-3: Further metrology for earth observation and climate 374 calibration, uncertainty, traceability, SLSTR, Sentinel-3, temperature, blackbody, radiometer, data processing, Earth observation, metrology EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs13030374 NA D.Smith S.E.Hunt M.Etxaluze D.Peters T.Nightingale J.Mittaz E.R.Woolliams E.Polehampton article KlussEW2021 2063 IEEE Transactions on Instrumentation and Measurement 2021 1 18 70 N/A 19ENG02: FutureEnergy: Metrology for future energy transmission 1-9 Current transformers, frequency-domain analysis, high-voltage techniques, partial discharge (PD) measurement, time-domain analysis. EMPIR 2019: Energy IEEE 30 N/A NA https://zenodo.org/record/4772471 J.Klüss A-P.Elg C.Wingqvist article PreetzmannEVLR2021 2667 AIChE Journal 2021 1 11 67 4 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 1-12 composition analysis, liquefaction, liquefied natural gas, optical spectroscopy, vapor–liquid-equilibrium https://aiche.onlinelibrary.wiley.com/doi/epdf/10.1002/aic.17128 EMPIR 2016: Energy Wiley 30 0001-1541, 1547-5905 10.1002/aic.17128 NA N.Preetzmann P.Eckmann A.M.H.Veen J.Li M.Richter article BagherRENWMZDHBL2021 1796 International Journal of Molecular Sciences 2021 1 22 2 18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants 506 lung fibroblasts, mast cells, epithelial cells, extracellular matrix, IL-6; tryptase, vascular endothelial growth factor, hepatocyte growth factor, idiopathic pulmonary fibrosis EMPIR 2018: Health MDPI AG 30 1422-0067 10.3390/ijms22020506 NA M.Bagher O.Rosmark L.Elowsson Rendin A.Nybom S.Wasserstrom C.Müller X-H.Zhou G.Dellgren O.Hallgren L.Bjermer A-K.Larsson-Callerfelt article KrasniqiKLETRT2021 1827 Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment 2021 1 987 16ENV09: MetroDecom II: In situ metrology for decommissioning nuclear facilities 164821 Optical remote detection, alpha radiation EMPIR 2016: Environment Elsevier BV 30 0168-9002 10.1016/j.nima.2020.164821 NA F.S.Krasniqi T.Kerst M.Leino J-T.Eisheh H.Toivonen A.Röttger J.Toivonen article DorstSSE2021 2302 SMSI 2021 - System of Units and Metreological Infrastructure 2021 D1 Future 2021 17IND12: Met4FoF: Metrology for the Factory of the Future 314 - 315 machine learning, automation, sensor network, uncertainty EMPIR 2017: Industry AMA Service GmbH, Von-Münchhausen-Str. 49, 31515 Wunstorf, Germany 30 10.5162/SMSI2021/D1.1 NA T.Dorst T.Schneider A.Schütze S.Eichstädt article BehrEBGHKKLPPS2020 1857 Measurement Science and Technology 2021 18SIB07: GIQS: Graphene impedance quantum standard impedance measurement,quantized Hall resistor,coaxial impedance bridge,graphene,Josephson arbitrary waveform synthesizer https://iopscience.iop.org/article/10.1088/1361-6501/abcff3/pdf EMPIR 2018: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/abcff3 NA S.Bauer R.Elmquist R.Behr M.Goetz J.Herick O.F.Kieler M.Kruskopf J.Lee L.Palafox Y.Pimsut J.Schurr article EberPP2020 1889 International Journal of Thermophysics 2020 12 28 42 2 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Normal spectral emissivity, Microsecond polarimetry, Molybdenum, Pulse heating, Subsecond thermophysics EMPIR 2017: Industry Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-020-02769-7 NA A.Eber P.Pichler G.Pottlacher article MarschallHWHRKE2020 1801 Optics Express 2020 12 28 26 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 38762 Fourier transform infrared; FTIR spectroscopy; low-rank matrix reconstruction https://www.osapublishing.org/oe/fulltext.cfm?uri=oe-28-26-38762&id=444648 EMPIR 2018: Health The Optical Society 30 1094-4087 10.1364/OE.404959 NA M.Marschall A.Hornemann G.Wübbeler A.Hoehl E.Ruhl B.Kästner C.Elster proceedings ElgGAMMHHLMPMSV2020 2062 VDE High Voltage Technology 2020; ETG-Symposium 2020 12 N/A N/A 19ENG02: FutureEnergy: Metrology for future energy transmission N/A UHVDC, traceability, Lightning Impulse, linearity, voltage dependence, HVAC, DC partial discharge, GIS Partial discharge https://ieeexplore.ieee.org/servlet/opac?punumber=9275417 EMPIR 2019: Energy VDE Berlin, Germany VDE High Voltage Technology 2020; ETG-Symposium 09-11-2020 to 11-11-2020 30 978-3-8007-5353-6 NA https://zenodo.org/record/4769653 A-P.Elg F.Garnacho M.Agazar J.Meisner A.Merev E.Houtzager J.Hällström K.Lahti C.Mier Escurra C.Platinero T.Micand T.Steiner A.Voss article BarreQSDBTESdA2020 2036 Frontiers in Environmental Chemistry 2020 11 23 1 16ENV01: MercOx: Metrology for oxidised mercury isotopic composition, mercury, biomonitoring EMPIR 2016: Environment Frontiers Media SA 30 2673-4486 10.3389/fenvc.2020.582001 NA J.P.G.Barre S.Queipo-Abad C.Sola-Larrañaga G.Deletraz S.Bérail E.Tessier D.Elustondo Valencia J.M.Santamaría A.de Diego D.Amouroux proceedings MeisnerGSHSEGRMLBOGS2020 1922 VDE High Voltage Technology 2020, ETG-Symposium 2020 11 11 19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes Electricity grids, high voltage testing, traceability, combined wave shapes, composite wave shapes, universal dividers, calibration https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215 EMPIR 2019: Pre-Co-Normative VDE online VDE High Voltage Technology 2020 09-11-2020 to 11-11-2020 30 NA https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215 J.Meisner E.Gockenbach H.Saadeddine J.Havunen U.Schichler A-P.Elg F.Garnacho P.E.Roccato A.Merev K.Lahti K.Backhaus A.Orrea M.Gamlin T.Steiner miscellaneous PennecchiRAE 1659 2020 11 3 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Conformity assessment; Producer’s and consumer’s risk; Total suspended particulates in air; Mass Concentration; Measurement uncertainty; Log-normal prior distribution EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.4242988 NA F.Pennecchi F.Rolle A.Allard S.L.R.Ellison article ClarkKE2020 1686 New Journal of Physics 2020 10 15 22 10 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 103031 electron quantum optics,mesoscopics,electron transport, quantum Hall effect,electron interferometry EMPIR 2017: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/abb9e5 NA L.A.Clark M.Kataoka C.Emary article JandaGOPUHRSMRNCHWEACDMORONJKZ2020 1683 Physical Review Materials 2020 9 28 4 9 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 094413-1 to 094413-9 - https://arxiv.org/abs/2004.05460 EMPIR 2016: Energy American Physical Society (APS)

1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States

30 2475-9953 10.1103/PhysRevMaterials.4.094413 NA T.Janda J.Godinho T.Ostatnicky E.Pfitzner G.Ulrich A.Hoehl S.Reimers Z.Šobáň T.Metzger H.Reichlová V.Novák R. P.Campion J.Heberle P.Wadley K. W.Edmonds O. J.Amin J. S.Chauhan S. S.Dhesi F.Maccherozzi R. M.Otxoa P. E.Roy K.Olejník P.Němec T.Jungwirth B.Kaestner FrancoisZiade article SikorskyGHKGEMRDWBRSKSF2020 1642 Physical Review Letters 2020 9 28 125 14 17FUN07: CC4C: Coulomb Crystals for Clocks Th229 Isomer Energy, Magnetic Microcalorimeter https://arxiv.org/abs/2005.13340 EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.125.142503 NA T.Sikorsky J.Geist D.Hengstler S.Kempf L.Gastaldo C.Enss C.Mokry J.Runke C.E.Düllmann P.Wobrauschek K.Beeks V.Rosecker J.H.Sterba G.Kazakov T.Schumm A.Fleischmann article EckmannvCLvKR2020 1605 International Journal of Thermophysics 2020 9 23 41 11 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 1-19/156 Cryogenic state · Density measurement · Liquefied binary mixtures ·Magnetic-suspension coupling · Single-sinker densimeter EnG EMPIR 2016: Energy Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-020-02728-2 NA P.Eckmann N.von Preetzmann G.Cavuoto J.Li A.van der Veen R.Kleinrahm M.Richter article deKromBZMBiGFKHE2020 2032 Atmospheric Measuremnt Techniques Discussion 2020 9 21 16ENV01: MercOx: Metrology for oxidised mercury Mercury, emissions, calibration, traceability EMPIR 2016: Environment Copernicus GmbH 30 10.5194/amt-2020-314 NA I.de Krom W.Bavius R.Ziel E.A.McGhee R.J.C.Brown I.Živković J.Gačnik V.Fajon J.Kotnik M.Horvat H.Ent article QuNWE2020 1875 Flow, Turbulence and Combustion 2020 9 20 106 2 16ENV08: IMPRESS 2: Metrology for air pollutant emissions 533-546 Laser diagnostics; Absorption spectroscopy; dTDLAS; Line-of-sight measurements; HCl measurement; Spatial heterogeneity; Thermal boundary layer EMPIR 2016: Environment Springer Science and Business Media LLC 30 1386-6184, 1573-1987 10.1007/s10494-020-00216-z NA Z.Qu J.Nwaboh O.Werhahn V.Ebert article deKromBZEvvvvHvDCE2020 1994 Measurement 2020 8 16 169 2021 16ENV01: MercOx: Metrology for oxidised mercury 108351 Mercury, Metrology, Primary gas standard, Calibration, SI-traceability, Environmental EMPIR 2016: Environment Elsevier 30 0263-2241 10.1016/j.measurement.2020.108351 NA I.de Krom W.Bavius R.Ziel E.Efremov D.van Meer P.van Otterloo I.van Andel D.van Osselen M.Heemskerk A.M.H.van der Veen M.A.Dexter W.T.Corns H.Ent miscellaneous PennecchiRSEv 1553 2020 7 31 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Uncertainty evaluation; Monte Carlo method; GUM uncertainty framework;Benzo[a]pyrene; Polycyclic Aromatic Hydrocarbons EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3968940 NA F.Pennecchi F.Rolle M.Sega S.L.R.Ellison A.M.H.van der Veen proceedings DorstE2020 1711 AMA SMSI 2020 2020 7 E2 Future 2020 17IND12: Met4FoF: Metrology for the Factory of the Future 366 - 367 EMPIR. European Union (EU), Horizon 2020, machine learning, uncertainty, GUM, sensor network https://www.ama-science.org/proceedings/details/3801 EMPIR 2017: Industry AMA

Wunstorf

virtual SMSI 2020 21-06-2020 to 24-06-2020 30 978-3-9819376-2-6 none NA https://doi.org/10.5162/SMSI2020/E2.3 T.Dorst S.Eichsädt miscellaneous ElsterECNKM 1527 2020 6 28 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Measurement model; GUM; Straight-line regression; Correlation; Weighted total least-squares; Method comparison; Haemoglobin; AHD; HiCN EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3911584 NA C.Elster S.Ellison S.Cowen J.Neukammer K.Klauenberg S.Martens article BossewCCCDEGPT2020 1837 International Journal of Environmental Research and Public Health 2020 6 10 17 11 16ENV10: MetroRADON: Metrology for radon monitoring 4134 geogenic radon hazard index, geogenic radon potential, European map of geogenic radon EMPIR 2016: Environment MDPI 30 EISSN 1660-4601 10.3390/ijerph17114134 NA P.Bossew G.Cinelli G.Ciotoli Q.G.Crowley M.De Cort J.Elío Medina V.Gruber E.Petermann T.Tollefsen proceedings BosseEZCBOYBMRF2020 1665 Proceedings 20th euspen International Conference and Exhibition 2020 6 2020 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing Advanced Manufacturing, Key Enabling Technology (KET), Strategic Research Agenda (SRA), European Metrology Network (EMN) EMPIR 2019: Support for Networks Online Conference 20th euspen International Conference and Exhibition 08-06-2020 to 12-06-2020 30 978-0-9957751-7-6 NA https://www.euspen.eu/knowledge-base/ICE20374.pdf H.Bosse A.Evans V.Zelený D.Czulek A.Balsamo D.O'Connor T.Yandayan D.Billington F.Meli C.Ragusa O.Flys miscellaneous ElsterKM 1501 2020 5 26 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Measurement model; GUM; Bayesian inference; Calibration; Straight-line regression, Least-squares estimation; Torque measuring device; VDI/VDE 2600 Blatt 2 EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3858121 NA C.Elster K.Klauenberg S.Martens techreport EbertWQ2020_2 1411 HostingInstitution: Physikalisch-Technische Bundesanstalt (PTB) 2020 4 16ENV08: IMPRESS 2: Metrology for air pollutant emissions We present our new dTDLAS based HCl spectrometer, specially designed and optimized to measure traceable HCl concentration in different matrices (high temperature, high water vapor and CO2 contents) motivated by large-scale power stations or biomass burning domestic boilers. This system is designed to serve as an optical gas standard (OGS) and thus as a traceable transfer standard to directly quantify HCl emissions or calibrate HCl sensors or dynamically generated gas standards in the field. It employs a mid-infrared interband cascade laser (ICL) and is targeting the HCl transition lines in the fundamental band to achieve less 1 ppm (at 1 meter) sensitivity and meet the compatibility goal set by lowered HCl ELVs in the European legislation such as the Industrial Emissions Directive (IED). https://oar.ptb.de/resources/show/10.7795/810.20191105 EMPIR 2016: Environment Physikalisch-Technische Bundesanstalt 30 ISNI: 0000 0001 2186 1887 10.7795/810.20191105 NA V.Ebert O.Werhahn Z.Qu article SliwczynskiKIESPB2020 1851 IEEE Communications Magazine 2020 4 58 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 67-73 time transfer, frequency transfer, fiber optic, 5G, network synchronization, synchronization supervision EMPIR 2018: SI Broader Scope IEEE 30 10.5281/zenodo.3903158 NA L.Śliwczyński P.Krehlik H.Imlau H.Ender H.Schnatz D.Piester A.Bauch miscellaneous SousaPvCFDBKE 1467 2020 3 25 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Bayesian statistics, measurement uncertainty, prior knowledge, calibration EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3726908 NA J.A.Sousa O.Pellegrino A.M.H.van der Veen M.G.Cox N.Fischer S.Demeyer A.Bošnjakovic V.Karahodžić C.Elster miscellaneous vanderVeenHCPE 1459 2020 3 22 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Conformity assessment; Multicomponent material; Measurement uncertainty; Risk of false decision; Correlated test results EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3723507 NA A.M.Hvan der Veen PHarris M.GCox FPennecchi S.L.REllison techreport QuNWE2020_2 1879 HostingInstitution: Physikalisch-Technische Bundesanstalt 2020 3 13 16ENV08: IMPRESS 2: Metrology for air pollutant emissions ISNI: 0000 0001 2186 1887 HCl-dTDLAS ; boundary layer ; temperature gradient ; gas matrix https://oar.ptb.de/files/download/5e6b76214c9390106c007858 EMPIR 2016: Environment Physikalisch-Technische Bundesanstalt 30 NA Z.Qu J.Nwaboh O.Werhahn V.Ebert article ElGawharyvU2020 1450 Physical Review Research 2020 3 13 2 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 013308 Strong scattering, Born series, perturbation methods, inverse problems, optical metrology, Padé approximants EMPIR 2017: Fundamental American Physical Society (APS) 30 2643-1564 10.1103/PhysRevResearch.2.013308 NA T. A.van der Sijs O.El Gawhary H. P.Urbach inbook EschelbachLHG2020 1637 2020 3 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy pp. 411-424 VGOS, VLBI, Radioteleskop Reflektor, Paraboloid, Ring-Fokus-Paraboloid, Unmanned Aircraft System, Deformation, Photogrammetrie, GeoMetre, JRP 18SIB01 EMPIR 2018: SI Broader Scope Wichmann Verlag Ingenieurvermessung 20: Beiträge zum 19. Internationalen Ingenieurvermessungskurs 43 978-3-87907-672-7 NA http://doi.org/10.5281/zenodo.4081146 C.Eschelbach M.Lösler R.Haas A.Greiwe article LucasTECSZ2020 1449 APL Materials 2020 3 8 3 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 031109 multiferroic, X-ray absorption spectroscopy, magnetic measurements https://aip.scitation.org/doi/10.1063/5.0002863 EMPIR 2016: Energy AIP Publishing 30 2166-532X 10.1063/5.0002863 NA M.Staruch H.ElBidweihy M.G.Cain P.Thompson C.A.Lucas P.Finkel article BaumannBKEZ2020 1497 Physics in Medicine & Biology 2020 3 65 5 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 055015 radiotherapy dosimetry, protons EMPIR 2016: Pre-Co-Normative IOP Publishing 30 1361-6560 10.1088/1361-6560/ab6e53 NA K-S.Baumann S.Kaupa C.Bach R.Engenhart-Cabillic K.Zink article TxoperenaRLFERAPCCCCHMZK2020 1505 Scientific Reports 2020 2 21 10 1 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics 3223 Characterization and analytical techniques,Electronic properties and devices,Imaging techniques,Materials science,Nanoscience and technology,Physics,Graphene https://www.nature.com/articles/s41598-020-59851-1 EMPIR 2016: Pre-Co-Normative Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-59851-1 NA C.Melios N.Huang L.Callegaro A.Centeno A.Cultrera A.Cordon V.Panchal I.Arnedo A.Redo-Sanchez D.Etayo M.Fernandez A.Lopez S.Rozhko O.Txoperena A.Zurutuza O.Kazakova techreport WeberHSRDBMHKMENHSW2020 1431 Zenodo 2020 2 12 17IND02: SmartCom: Communication and validation of smart data in IoT-networks digital calibration certificate (DCC) cryptography minimum requirements data communication IoT-communication IoT-networking SmartCom https://zenodo.org/record/3664211#.XlO2QTFKhaR EMPIR 2017: Industry Zenodo 30 10.5281/zenodo.3664211 NA H.Weber D.Hutzschenreuter I.Smith S.Rhodes J.Dawkins C.Brown O.Maennel K.Hovhannisyan P.Kuosmanen T.Mustapää T.Elo P.Nikander W.Heeren S.Schönhals Th.Wiedenhöfer techreport EBERTWQ2020_3 1410 HostingInstitution: Physikalisch-Technische Bundesanstalt (PTB) 2020 2 16ENV08: IMPRESS 2: Metrology for air pollutant emissions 1-5 direct tunable diode laser absorption spectroscopy (dTDLAS), approach targeting accurate HCl measurements in different matrices motivated by combustion emissions, large-scale power stations, biomass burning domestic boilers, Mid-IR interband cascade laser (ICL), absolute HCl concentrations,hot gas plumes https://oar.ptb.de/resources/show/10.7795/810.20191119A EMPIR 2016: Environment Physikalisch-Technische Bundesanstalt 30 ISNI: 0000 0001 2186 1887 10.7795/810.20191119A NA V.Ebert O.Werhahn Z.Qu techreport EbertWQ2020_4 1412 HostingInstitution: Physikalisch-Technische Bundesanstalt (PTB) 2020 2 16ENV08: IMPRESS 2: Metrology for air pollutant emissions Accurate measurement of emissions to the atmosphere is vital to control and reduce air pollution. Industry needs to measure and report emissions for regulatory purposes including assessing stack emissions against concentration limit values. IMPRESS 1 and IMPRESS 2 projects [1] go beyond state of the art in measuring the emissions of critical pollutants with lower emission limit values, requiring detection limits and uncertainties unachievable with current Standard Reference Methods, enabling traceability and directly traceable measurements. Laser-based optical gas sensors provide powerful tools for industrial emission monitoring.Tunable diode laser absorption spectroscopy (TDLAS) is frequently used in science and industry for online and in situ gas analysis. We present our direct TDLAS (dTDLAS) method for absolute gas concentration measurement [2]. Note that the TDLAS is one of the line-of-sight (LOS) absorption spectroscopy techniques, and its application is normally limited to uniform conditions with constant or negligible temperature and/or concentration gradients along the LOS. However, in many applications, for example, combustion diagnostic and cross-stack emission measurements, temperature and concentration gradients along the LOS may occur. In those scenarios, special care should be taken to spectral fitting, line width and concentration quantification [3].This contribution covers a 4.6 μm EC-QCL based TDLAS CO spectrometer. The two gas cells configuration enables to investigate the heterogeneity effects on dTDLAS applications. The CO concentration and line width were measured under different heterogeneous conditions and compared to those under uniform settings. Currently the dTDLAS method is implemented for HCl measurements as a principle technique for cross-stack emission control.The research was supported by IMPRESS2 within EMPIR. The EMPIR initiative is co-funded by the European Union’s Horizon 2020 research and innovation programme and the EMPIR Participating States. https://oar.ptb.de/resources/show/10.7795/810.20200114 EMPIR 2016: Environment Physikalisch-Technische Bundesanstalt 30 ISNI: 0000 0001 2186 1887 10.7795/810.20200114 NA V.Ebert O.Werhahn Z.Qu manual PearceABEdIKS2020 1766 2020 2 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 Thermocouples, calibration, thermoelectric, thermometry, ITS-90, EMPRESS 2 https://www.euramet.org/publications-media-centre/calibration-guidelines/ EMPIR 2017: Industry EURAMET

Braunschweig

30 ISBN 978-3-942992-57-2 N/A NA ISBN 978-3-942992-57-2 J.Pearce N.Arifovic J.Bojkovski F.Edler M.de Groot G.G.Izquierdo M.Kalemci R.Strnad article EbertWQ2020 1407 HostingInstitution: Physikalisch-Technische Bundesanstalt 2020 1 30 16ENV08: IMPRESS 2: Metrology for air pollutant emissions thermal boundary layers, tunable diode laser absorption spectroscopy (TDLAS), spectral collisional widths, gas concentration measurements https://oar.ptb.de/files/download/5e32e0934c9390355c0049d6 EMPIR 2016: Environment Physikalisch-Technische Bundesanstalt 30 ISNI: 0000 0001 2186 1887 NA https://doi.org/10.7795/EMPIR.16ENV08.JA.20200130 V.Ebert O.Werhahn Z.Qu article FortmeierSLMSHBBKSE2020 1374 Journal of the European Optical Society-Rapid Publications 2020 1 16 1 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses Freeform optical surfaces, Metrology, Interlaboratory comparison EMPIR 2015: SI Broader Scope Springer Science and Business Media LLC 30 1990-2573 10.1186/s41476-019-0124-1 NA I.Fortmeier R.Schachtschneider V.Lédl O.Matoušek J.Siepmann A.Harsch R.Beisswanger Y.Bitou Y.Kondo M.Schulz C.Elster article ArrheniusFBAELR2020 1602 RSC Advances 2020 10 20 16ENG05: Biomethane: Metrology for biomethane 11907-11917 Biomethane oilcarryoveranaytical method EnG EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 2046-2069 10.1039/D0RA01399D NA K.Arrhenius A.Fischer O.Büker H.Adrien A.El Masri F.Lestremau T.Robinson article RanitzschABBBEKKLMNPRW2019 1729 Journal of Low Temperature Physics 2019 12 199 1-2 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters 441-450 Electron-capture decay, Metallic magnetic calorimeter, Radionuclide metrology EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 0022-2291, 1573-7357 10.1007/s10909-019-02278-4 NA P.C-O.Ranitzsch D.Arnold J.Beyer L.Bockhorn J.J.Bonaparte C.Enss K.Kossert S.Kempf M.Loidl R.Mariam O. J.Nähle M.Paulsen M.Rodrigues M.Wegner proceedings EschelbachLHG2019 1421 Proceedings of the 24th European VLBI Group for Geodesy and Astrometry Working Meeting 2019 11 24 2019 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 17-21 VGOS, Ring-focus paraboloid, Antennadeformation, Focal length, Unmanned aircraft system http://www.oan.es/evga2019/24_EVGA_2019_Las_Palmas.pdf EMPIR 2018: SI Broader Scope Centro Nacional de Información Geográfica (CNIG). 2019.

Madrid

Las Palmas de Gran Canaria, Spain 24th European VLBI Group for Geodesy and Astrometry 17-03-2019 to 19-03-2019 30 978-84-416-5634-5 10.7419/162.08.2019 NA C.Eschelbach M.Loesler R.Haas A.Greiwe article RanitzschPNMKKEBBLRS2019 1234 Applied Radiation and Isotopes 2019 11 153 15SIB10: MetroBeta: Radionuclide beta spectra metrology 108830 Beta spectrometry; Metallic magnetic calorimeter; Ionizing radiation metrology EMPIR 2015: SI Broader Scope Elsevier BV 30 0969-8043 10.1016/j.apradiso.2019.108830 NA M.Loidl J.Beyer L.Bockhorn C.Enss S.Kempf K.Kossert R.Mariam O.Nähle M.Paulsen P.Ranitzsch M.Rodrigues M.Schmidt manual EloKnKALSZSFRBSHWHHHNHMMHP2019 1433 2019 11 17IND02: SmartCom: Communication and validation of smart data in IoT-networks Digital-SI (D-SI) metrology data digital exchange format SmartCom data communication IoT-networking IoT-communication https://zenodo.org/record/3522631#.XlTbaTFKhaQ EMPIR 2017: Industry Zenodo 30 10.5281/zenodo.3522631 NA T.Elo P.Kuosmanen T. Mustapää R.Klobucar B.Acko I.Linkeová J.Sýkora V.Zelený I.Smith A.Forbes S.Rhodes C.Brown A.Scheibner S.G.Hackel T.Wiedenhöfer W.Heeren F.Haertig D.Hutschenreuter P.Nikander K.Hovhannisyan O.Maennel B.Muller L.Heindorf V.Paciello inbook EnricoGF2019 1357 2019 10 10 17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology superconductivity, metamaterial, Josephson effect, parametric amplification, microwave photonics EMPIR 2017: Fundamental IntechOpen

IntechOpen Rijeka

Condensed Matter Physics 30 10.5772/intechopen.89305 NA L.Fasolo A.Greco E.Enrico article EschelbachHLG2019 1222 Journal of Geodesy 2019 9 28 2019 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 1-19 Ring-focus paraboloid, Radio telescope, Antenna deformation, VLBI, VGOS, Signal path variation, SQP, Reverse engineering, Photogrammetry, Unmanned aircraft system https://link.springer.com/content/pdf/10.1007%2Fs00190-019-01302-5.pdf
https://link.springer.com/article/10.1007/s00190-019-01302-5 EMPIR 2018: SI Broader Scope Springer Berlin Heidelberg 30 0949-7714 10.1007/s00190-019-01302-5 NA M.Lösler R.Haas C.Eschelbach A.Greiwe proceedings KhamlichiG2015 1097 Proceedings of IHS2019 2019 8 26 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients Calibration, setup, transients EMPIR 2015: Pre-Co-Normative Budapest, Hungary International Symposium on High Voltage Engineering 2019 30 10.5281/zenodo.3238169 NA A.Khamlichi F.Garnacho J.Hällström A.P.Elg proceedings HallstromMPE2019 1184 Proceedings of ISH2019 2019 8 26 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients high voltage measurement, fast transients EMPIR 2015: Pre-Co-Normative Budapest, Hungary 21st International Symposium on High Voltage Engineering 26-08-2019 to 30-08-2019 30 10.5281/zenodo.3244216 NA J.Hällström J.Meisner S.Passon A-P.Elg proceedings KaramanDMEBHHRGG2019 1186 Proceedings of ISH2019 2019 8 26 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients partial discharge, calibration EMPIR 2015: Pre-Co-Normative Budapest, Hungary 21st International Symposium on High Voltage Engineering 26-08-2019 to 30-08-2019 30 10.5281/zenodo.3243449 NA J.Hällström J.Havunen A.E.Bergman A-P.Elg A.Merev S.Dedeoğlu I.Karaman J.Rovira T.Garcia F.Garnacho proceedings NieminenHRGGE2019 1212 Proceedings of ISH2019 2019 8 26 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients Voltage instrument transformers, Transient overoltages, traceability EMPIR 2015: Pre-Co-Normative Budapest, Hungary 21st International Symposium on High Voltage Engineering (ISH2019) 26-08-2019 to 30-08-2019 30 10.5281/zenodo.3244088 NA T.Nieminen J.Hällström J.Rovira T.Garcia F.Garnacho A-P.Elg article RunzEMDKK2019 1205 Journal of Physics: Conference Series 2019 8 1305 15HLT08: MRgRT: Metrology for MR guided radiotherapy 012007 MRgRT, dosimetry https://doi.org/10.1088/1742-6596/1305/1/012007 EMPIR 2015: Health IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1305/1/012007 NA S.Dorsch P.Mann A.Elter A.Runz S.Klüter C.P.Karger article ColemanERGS2019 1191 Journal of the Air & Waste Management Association 2019 8 69 9 15NRM01: Sulf-Norm: Metrology for sampling and conditioning SO2 emissions from stacks 1070-1078 Uncertainty requirements, European Union’s Industrial Emissions Directive, monitoring sulfur dioxide emissions https://doi.org/10.1080/10962247.2019.1604449 EMPIR 2015: Pre-Co-Normative Informa UK Limited 30 1096-2247, 2162-2906 10.1080/10962247.2019.1604449 NA M.D.Coleman M.Ellison R.A.Robinson T.D.Gardiner T.O.M.Smith article NahleMLKKEBBPRR2019 1235 Journal of Instrumentation 2019 8 14 08 15SIB10: MetroBeta: Radionuclide beta spectra metrology P08012-P08012 Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers EMPIR 2015: SI Broader Scope IOP Publishing 30 1748-0221 10.1088/1748-0221/14/08/P08012 NA M.Paulsen J.Beyer L.Bockhorn C.Enss S.Kempf K.Kossert M.Loidl R.Mariam O.Nähle P.Ranitzsch M.Rodrigues article NahleMLKKEBBPRR20190 1235 Journal of Instrumentation 2019 8 14 08 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters P08012-P08012 Calorimeters, Cryogenic detectors, Data processing methods, Spectrometers EMPIR 2017: Fundamental IOP Publishing 30 1748-0221 10.1088/1748-0221/14/08/P08012 NA M.Paulsen J.Beyer L.Bockhorn C.Enss S.Kempf K.Kossert M.Loidl R.Mariam O.Nähle P.Ranitzsch M.Rodrigues article OrtolanoARCETCZSCC2019 1227 Scientific Reports 2019 7 23 9 1 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics graphene, electrical resistance tomography, conductivity, terahertz spectroscopy https://doi.org/10.1038/s41598-019-46713-8 EMPIR 2016: Pre-Co-Normative Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-019-46713-8 NA A.Cultrera D.Serazio A.Zurutuza A.Centeno O.Txoperena D.Etayo A.Cordon A.Redo-Sanchez I.Arnedo M.Ortolano L.Callegaro article RedshawQPMIHGEDBSRY2019 1232 Physical Review C 2019 7 11 100 1 15SIB10: MetroBeta: Radionuclide beta spectra metrology 014308 138La, high-precision Q-values, mass spectrometry, Penning trap https://arxiv.org/abs/1904.12076v2 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2469-9985, 2469-9993 10.1103/PhysRevC.100.014308 NA R.Sandler G.Bollen J.Dissanayake M.Eibach K.Gulyuz A.Hamaker C.Izzo X.Mougeot D.Puentes F. G. A.Quarati M.Redshaw R.Ringle I.Yandow article GulmezHGE2019 1137 IEEE Transactions on Instrumentation and Measurement 2019 6 68 6 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 2201-2207 Capacitors, Standards, Voltage measurement, Temperature measurement, Temperature sensors, Current measurement, Uncertainty https://arxiv.org/abs/1907.01389 EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2019.2895435 NA Ö.Erkan Y.Gülmez G.Gülmez C.Hayırlı article OliveroBOFCJGSPBFHBER2019 1261 Advanced Quantum Technologies 2019 5 20 2 5-6 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1900006 diamond, ion‐beam irradiation, nitrogen vacancies ,NV magnetometry, quantum sensing, ultrafast laser writing EMPIR 2017: Fundamental Wiley 30 2511-9044, 2511-9044 10.1002/qute.201900006 NA http://hdl.handle.net/2318/1704485 S.M.Eaton J.P.Hadden V.Bharadwaj J.Forneris F.Picollo F.Bosia B.Sotillo A.N.Giakoumaki O.Jedrkiewicz A.Chiappini M.Ferrari R.Osellame P.E.Barclay P.Olivero R.Ramponi proceedings SchulerREL2019 1247 Photogrammetrie - Laserscanning - Optische 3D-Messtechnik 2019 4 30 2019 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 162-175 geometric reference points, VLBI, SLR, ILRS, geodesy, satellite, local tie vectors EMPIR 2018: SI Broader Scope Wichmann Verlag Oldenburg 18. Oldenburger 3D-Tage 2019 06-02-2019 to 07-02-2019 43 978-3-87907-660-4 NA https://doi.org/10.5281/zenodo.3515831 T.Schüler S.Riepl C.Eschelbach M.Lösler article PisaniBE2019 1000 Sensors 2019 3 19 5 17IND03: LaVA: Large Volume Metrology Applications 1082 backscattering, retroreflectors, glory, ray tracing, high index ball lenses https://www.mdpi.com/1424-8220/19/5/1082 EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s19051082 NA A.Egidi A.Balsamo M.Pisani article SchulzFSSE2019 1027 Journal of Sensors and Sensor Systems 2019 2 27 8 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 105 - 110 SimOptDevice, opto-mechanical virtual experiments, https://www.j-sens-sens-syst.net/8/105/2019/ EMPIR 2015: SI Broader Scope Copernicus Publications 30 10.5194/jsss-8-105-2019 NA R.Schachtschneider M.Stavridis I.Fortmeier M.Schulz C.Elster article JohnenRMDEK2019 1052 Physics in Medicine & Biology 2019 2 64 4 15HLT08: MRgRT: Metrology for MR guided radiotherapy 04NT02 MRgRT EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aafef0 NA A.Elter S.Dorsch P.Mann A.Runz W.Johnen C.P.Karger article JohnsonKCE2019 1148 Physical Review B 2019 1 22 99 4 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 045306 electron quantum optics, hot electron, energy relaxation, phonon https://arxiv.org/abs/1807.11814 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.99.045306 NA C.Emary L.A.Clark M.Kataoka N.Johnson article ElsterSCWKL2019 1324 SIAM Journal on Imaging Sciences 2019 1 12 4 15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion 2035-2062 Bayesian spatial-temporal regression, cardiac MR, uncertainty quantification EMPIR 2015: Health Society for Industrial & Applied Mathematics (SIAM) 30 1936-4954 10.1137/19M1246274 NA J.Lehnert C.Kolbitsch G.Wübbeler A.Chiribiri T.Schaeffter C.Elster article HashadEJS2019 805 Measurement 2019 1 131 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range 723-729 Primary pressure standard, Effective area, FPG characterization, Rarefied gas flow, https://www.sciencedirect.com/science/article/pii/S0263224118308443 EMPIR 2014: Industry Elsevier BV 30 0263-2241 10.1016/j.measurement.2018.09.016 NA A.S.Hashad S.Ehlers O.Jusko W.Sabuga article NewellHMRLKHCPYKE2018 994 Communications Physics 2018 11 20 1 1 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics Confocal microscopy, graphene. EMPIR 2016: Pre-Co-Normative Springer Nature America, Inc 30 2399-3650 10.1038/s42005-018-0084-6 NA V.Panchal Y.Yang G.Cheng J.Hu M.Kruskopf C.I.Liu A.F.Rigosi C.Melios A.R.Hight Walker D.B.Newell O.Kazakova R.E.Elmquist article VasilatouE2018 895 Aerosol Science and Technology 2018 11 15 16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols 1-16 soot, black carbon, miniCAST, aerosol https://www.tandfonline.com/doi/full/10.1080/02786826.2018.1536818 EMPIR 2016: Environment Informa UK Limited 30 0278-6826, 1521-7388 10.1080/02786826.2018.1536818 NA M.N.Ess K.Vasilatou proceedings Elg2018 917 2018 Conference on Precision Electromagnetic Measurements 2018 10 22 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients Fast transients, high voltage, measurment uncertainty, traceability https://ieeexplore.ieee.org/document/8500980 EMPIR 2015: Pre-Co-Normative Paris, France Conference on Precision Electromagnetic Measurements 08-07-2018 to 13-07-2018 30 10.5281/zenodo.1473324 NA A.P.Elg article JakubowskiLKNPTRES2018 937 Neurology - Neuroimmunology Neuroinflammation 2018 10 19 6 1 15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease e515 Gadolinium, Gadolinium-based contrast agents, Human brain, MRI, LA-ICP-MS, Iron, Copper, Phosphorus http://nn.neurology.org/content/6/1/e515/ EMPIR 2015: Health Ovid Technologies (Wolters Kluwer Health) 30 2332-7812 10.1212/NXI.0000000000000515 NA A.H.El-Khatib H.Radbruch S.Trog B.Neumann F.Paul A.Koch M.W.Linscheid N.Jakubowski E.Schellenberger article PepperRFJGFSSREJJK2018 1113 Physical Review Letters 2018 9 26 121 13 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere Single electron pumps, hot electron transport, phonon emission, phonon relaxation, optical phonons, edge states, electron optics, electron quantum optics https://arxiv.org/abs/1712.09031 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.121.137703 NA N.Johnson C.Emary S.Ryu H.S.Sim P.See J.D.Fletcher J.P.Griffiths G.A.C.Jones I.Farrer D.A.Ritchie M.Pepper T.J.B.M.Janssen M.Kataoka article KonemannOWESFS2018 806 Measurement 2018 9 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range primary pressure standard, low pressure, liquid column manometer, vacuum oil, gas saturation EMPIR 2014: Industry Elsevier BV 30 0263-2241 10.1016/j.measurement.2018.09.017 NA S.Ehlers J.Könemann O.Ott H.Wolf J.Šetina A.Furtado W.Sabuga article IldayCEHe2018 1075 Physical Review Applied 2018 8 20 10 2 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 024027 frequency comb, low-noise EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2331-7019 NA https://arxiv.org/abs/1905.01116 F.O.Ilday M.Çelik C.Erdoğan R.Hamid C.Şenel article KazakovaMYEPL2018 991 ACS Sensors 2018 8 3 9 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics 1666-1674 air quality; environmental monitoring; epitaxial graphene; graphene sensors; Hall effect; nitrogen dioxide https://arxiv.org/abs/1808.09776 EMPIR 2016: Pre-Co-Normative American Chemical Society (ACS) 30 2379-3694, 2379-3694 10.1021/acssensors.8b00364 NA C.Melios V.Panchal K.Edmonds A.Lartsev R.Yakimova O.Kazakova article JelezkoDNAEBGJSMTFDGO2018 1010 Physical Review Applied 2018 7 25 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance https://arxiv.org/abs/1706.07935 EMPIR 2017: Fundamental American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.014024 NA J.Forneris S.Ditalia Tchernij P.Traina E.Moreva N.Skukan M.Jakšić V.Grilj F.Bosia E.Enrico G.Amato I.P.Degiovanni B.Naydenov F.Jelezko M.Genovese P.Olivero article JelezkoDNAEBGJSMTFDGO20180 1010 Physical Review Applied 2018 7 25 10 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance EMPIR 2017: Fundamental American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.014024 NA https://arxiv.org/abs/1706.07935 J.Forneris S.Ditalia Tchernij P.Traina E.Moreva N.Skukan M.Jakšić V.Grilj F.Bosia E.Enrico G.Amato I.P.Degiovanni B.Naydenov F.Jelezko M.Genovese P.Olivero article EllingsbergBAVLRWPS2018 1376 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 2018 7 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters. https://zenodo.org/record/3587786#.XiGxp3u7KUn EMPIR 2017: Pre-Co-Normative IEEE 30 10.1109/CPEM.2018.8500945 NA P.S.Wright G.Rietveld F.Leferink H.E.van den Brom F.R.IAlonso J.P.Braun K.Ellingsberg M.Pous M.Svoboda article WubbelerRPKHUHSKZ2018 1114 Optics Express 2018 6 28 26 14 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 18115 Infrared scattering scanning near-field optical microscopy, Optical spectroscopy, Compressed sensing https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-14-18115 EMPIR 2016: Energy The Optical Society 30 1094-4087 10.1364/OE.26.018115 NA BerndKästner FrankoSchmähling AndreaHornemann GeorgUlrich ArneHoehl MattiasKruskopf KlausPierz Markus B.Raschke GerdWübbeler C.Elster proceedings SteinhoffESM2018 943 Publications of the Institute of Geophysics, Polish Academy of Sciences; Geophysical Data Bases, Processing and Instrumentation 2018 6 27 423 C-112 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 145-146 DC-magnetometry, uncertainty budget, magnetic hysteresis, magnetic nanoparticles. https://pub.igf.edu.pl/files/Pdf/Pubs/26.pdf EMPIR 2016: Pre-Co-Normative Institute of Geophysics Polish Academy of Sciences

64 Ksiecia Janusza Warsaw 01-452 Poland

Chęciny, Poland 16th Castle Meeting New Trends on Paleo, Rock and Environmental Magnetism 10-06-2018 to 16-06-2018 30 2299-8020 10.25171/InstGeoph_PAS_Publs-2018-074 NA S.Spassov R.Egli G.Marks U.Steinhoff article IkonenGEVK2018 Atmospheric Measurement Techniques 2018 6 20 11 6 ENV59: atmoz: Traceability for atmospheric total column ozone 3595-3610 solar UV, spectral irradiance, total ozone column, systematic spectral deviations, spectral correlations, uncertainty https://doi.org/10.5194/amt-11-3595-2018 EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-11-3595-2018 NA E.Ikonen J.Gröbner L.Egli A.Vaskuri P.Kärhä article elGawharyLWNSRBF2018 Atmospheric Measurement Techniques 2018 6 11 11 6 ENV59: atmoz: Traceability for atmospheric total column ozone 3323-3337 Brewer, instrumental temperature https://www.atmos-meas-tech.net/11/3323/2018/amt-11-3323-2018.html EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-11-3323-2018 NA O.El Gawhary S.F.León-Luis K.Wilson S.Nevas M.M.Sildoja A.Redondas A.Berjon I.Fountoulakis article EbertWBSLW2018 Journal of Molecular Spectroscopy 2018 6 348 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 68-78 Nitrous oxide, Fourier transform infrared spectroscopy, Spectral line parameters, Air-broadening, Air-shift, Gas metrology https://www.sciencedirect.com/science/article/pii/S0022285217302059?via%3Dihub EMRP A169: Call 2010 Environment Elsevier BV 30 0022-2852 10.1016/j.jms.2017.07.002 NA V.Ebert O.Werhahn J.Brunzendorf A.Serdyukov G.Li V.Werwein article WidmaierVRLEHKL2018 Measurement Science and Technology 2018 6 29 7 ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems 074012 CMM, verification, metrology http://iopscience.iop.org/article/10.1088/1361-6501/aabd2b EMRP A169: Call 2013 Energy II IOP Publishing 30 10.1088/1361-6501/aabd2b NA T.Widmaier R.Viitala A.Rantanen P.Laukkanen V.P.Esala B.Hemming P.Kuosmanen A.Lassila article ErikssonHLCB2018 800 URSI 2018 5 14IND10: MET5G: Metrology for 5G communications Millimeter-waveSINRMIMO EMPIR 2014: Industry 30 10.23919/URSI-AT-RASC.2018.8471560 NA https://research.chalmers.se/en/publication/505084 KBuisman DCheadle T HLoh DHumphreys T Eriksson article ErikssonB2018 801 EuCAP 2018 5 14IND10: MET5G: Metrology for 5G communications MATE, MIMO ,MM-wave ,Testbed EMPIR 2014: Industry 30 NA https://research.chalmers.se/en/publication/508028 T Eriksson KBuisman article RedondasSSEMNKS2018 Atmospheric Measurement Techniques 2018 4 11 4 ENV59: atmoz: Traceability for atmospheric total column ozone 1989-1999 Total Ozone Column, spectrophotometers, Dobson, slit function, effective absorption coefficents https://www.atmos-meas-tech.net/11/1989/2018/ EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-11-1989-2018 NA A.Redondas M.Stanek M.Smid R.Evans G.McConville S.Nevas U.Köhler F.Schönenborn article MichlerWMDEC2018 858 Acta Materialia 2018 4 148 14IND03: Strength-ABLE: Metrology for length-scale engineering of materials 202-215 Titanium aluminides Micromechanics Electron backscattering diffraction (EBSD)Digital image correlation Deformation twinning EMPIR 2014: Industry Elsevier BV 30 1359-6454 10.1016/j.actamat.2018.01.007 NA T.E.J.Edwards F.Di Gioacchino G.Mohanty J.Wehrs J.Michler W.J.Clegg article WellerJEB2018 936 BMC Research Notes 2018 4 11 1 15HLT02: ReMiND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease 213-217 Ceruloplasmin, Immunocapture, ICP‑MS, ELISA, Human serum https://bmcresnotes.biomedcentral.com/articles/10.1186/s13104-018-3324-7 EMPIR 2015: Health Springer Nature 30 1756-0500 10.1186/s13104-018-3324-7 NA B.Bernevic A.H.El-Khatib N.Jakubowski M.G.Weller proceedings EbenhagWH2018 1120 2018 European Frequency and Time Forum (EFTF) 2018 4 1 1 15SIB05: OFTEN: Optical frequency transfer - a European network pp. 253-257 fiber, frequency transfer, heterodyne detection, coherent, polarization, https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2018.pdf EMPIR 2015: SI Broader Scope IEEE Torino, IT 2018 European Frequency and Time Forum (EFTF) 10-04-2018 to 12-04-2018 30 978-1-5386-4077-7 10.1109/EFTF.2018.8409044 NA P.O.Hedekvist L.Weddig S.C.Ebenhag article GrobnerEJ2018 Atmospheric Measurement Techniques 2018 3 27 11 3 ENV59: atmoz: Traceability for atmospheric total column ozone 1707-1723 total ozone, atmosphere, cross sections EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-11-1707-2018 NA J.Gröbner H.Elandaloussi C.Janssen article BarlowK2018 829 Journal of Physics: Conference Series 2018 3 969 15SIB02: InK 2: Implementing the new kelvin 2 012083 primary magnetic field fluctuation thermometer, SQUID-based, noise thermometer, low temperature EMPIR 2015: SI Broader Scope IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/969/1/012083 NA A.Kirste JEngert article FagerGLHE2018 788 IEEE 2018 3 14IND10: MET5G: Metrology for 5G communications Antenna crosstalk, digital predistortion (DPD), multiple-input multiple-output (MIMO) transmitter, power amplifier (PA) linearization https://research.chalmers.se/publication/252918/file/252918_Fulltext.pdf EMPIR 2014: Industry IEEE 30 10.1109/TMTT.2017.2748948 NA K.Hausmair P.N.Landin U.Gustavsson C.Fager T .Eriksson proceedings TunnermannESLW2018 906 Proceeding of the SPIE 2018 2 20 10513 waveguides and applications 105130U Fiber laser, high power laser, cladding light, fiber characterization, fiber system measurement, fiber laser measurement, double clad fiber https://www.spiedigitallibrary.org/conference-proceedings-of-spie/10513/2288266/Measurement-and-removal-of-cladding-light-in-high-power-fiber/10.1117/12.2288266.full?SSO=1 EMPIR 2014: Industry SPIE San Francisco Components and Packaging for Laser Systems IV 30-01-2018 to 01-02-2018 30 10.1117/12.2288266 NA T.Walbaum A.Liem T.Schreiber R.Eberhardt A.Tünnermann article EhlersSPPODBS2018 808 Measurement Science and Technology 2018 2 17 29 3 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range 035007 negative gauge pressure, piston pressure gauge, differential pressure, pressure, calibration, barometer, manometer calibration EMPIR 2014: Industry IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa92ea NA D.Bentouati Y.Durgut P.Otal M.Plimmer D.Pražák W.Sabuga S.Ehlers E.Sınır article PeyresERHVPLMGDMC2018 Applied Radiation and Isotopes 2018 2 132 IND57: MetoNORM: Metrology for processing materials with high natural radioactivity 72-78 γ-ray spectrometry, 235U, 231Th, Decay data, γ-ray emission probabilities, NORM EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.10.049 NA V.Peyres R.Eykens S.Richter M.Hult R.Van Ammel S.Pommé G.Lutter M.Marouli E.García-Toraño P.Dryák M.Mazánová P.Carconi article ScholzePEKHSB2018 478 Nanoscale 2018 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies GIXRF, nanostructure characterization, FEM https://arxiv.org/abs/1801.04157 EMPIR 2014: Industry Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/C8NR00328A NA V.Soltwisch P.Honicke Y.Kayser J.Eilbracht J.Probst F.Scholze B.Beckhoff article HauptE2017 529 tm - Technisches Messen 2017 12 20 84 12 14IND04: EMPRESS: Enhancing process efficiency through improved temperature measurement 779-786 Graphite, high temperatures, Seebeck coefficient, thermocouple EMPIR 2014: Industry Walter de Gruyter GmbH 43 0171-8096, 2196-7113 10.1515/teme-2017-0073 NA F.Edler S.Haupt article SassiLGWTMPLBPDCESK2017 Atmospheric Measurement Techniques Discussions 2017 11 28 ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change 1-17 zero gas, VOC measurements https://www.atmos-meas-tech-discuss.net/amt-2017-412/ EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8610 10.5194/amt-2017-412 NA G.Sassi M.Lecuna Y.Ghorafi R.Wortmann E.Tensing K.Michl C.Plass-Duelmer J.Li A.Baldan S.Persijn A.Demichelis A.Claude J.Englert M.P.Sassi D.Kubistin article EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017 602 Physics in Medicine & Biology 2017 11 14 62 23 15HLT08: MRgRT: Metrology for MR guided radiotherapy L41-L50 MRgRT, Radiotherapy, MRI EMPIR 2015: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/aa9517 NA B WRaaymakers I MJürgenliemk-Schulz G HBol MGlitzner A N T JKotte Bvan Asselen J C Jde Boer J JBluemink S LHackett M AMoerland S JWoodings J W HWolthaus H Mvan Zijp M E PPhilippens RTijssen J G MKok E Nde Groot-van Breugel IKiekebosch L T CMeijers C NNomden G GSikkes P A HDoornaert W S CEppinga NKasperts L G WKerkmeijer J H ATersteeg K JBrown BPais PWoodhead J J WLagendijk article SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017 Measurement Science and Technology 2017 11 13 ENV58: MeteoMet2: Metrology for essential climate variables Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta EMRP A169: Call 2013 Environment II IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa99fc NA L.Šindelárová D.Sestan J.Salminen H.Sairanen L.Rosso J.del Rio M.K.Rasmussen S.Oguz Aytekin M.de Podesta P.Pavlasek M.Nogueras Cervera J.Nielsen C.Musacchio P.Miao L.G.Lanza A.Kowal M.Kalemci D.Hudoklin R.Högström S.Hernandez de la Villa M.Heinonen D.Groselj A.Gonzalez Calvo E.Georgin T.Gardiner C.García Izquierdo A.Garcia-Benadí VFernicola V.Ebert J.Drnovsek M.Dobre R.Cuccaro G.Coppa M.Colli N.Chiodo A.Castrillo D.del Campo M.Brunet J.Bojkovski G.Beltramino S.A.Bell G.Beges F.Sanna A.Merlone D.Smorgon F.Sparasci R.Strnad M.Voldán R.J.Underwood G.Mana article GustavssonLSGHEF2017 319 IEEE 2017 11 14IND10: MET5G: Metrology for 5G communications Active antenna array, antenna crosstalk, mismatch, multiple-input multiple-output (MIMO) transmitter (TX), power-amplifier (PA) modeling https://research.chalmers.se/publication/252917/file/252917_Fulltext.pdf EMPIR 2014: Industry IEEE 30 10.1109/TMTT.2017.2699962 NA K.Hausmair S.Gustafsson C.Sanchez-Perez P.N.Landin U.Gustavsson T.Eriksson C.Fager article UlmKECCSHFB2017 450 Analytical & Bioanalytical Chemistry 2017 10 28 409 29 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 6907-6923 Fourier transforminfrared spectroscopy, Hierarchical cluster analysis (HCA), Principal componentsanalysis (PCA), Leishmania, DNA, Multivariate differentiation EMPIR 2015: Health Springer 30 1618-2642 10.1007/s00216-017-0655-5 NA A.Hornemann D.Sinning S.Cortes L.Campino P.Emmer K.Kuhls G.Ulm M.Frohme B.Beckhoff article TunnermannESHLWSSPB2017 388 Optics Letters 2017 10 18 42 21 14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications 4311-4314 Fiber optics amplifiers and oscillators, Thermal effects, Fiber properties, High power lasers https://www.osapublishing.org/ol/abstract.cfm?uri=ol-42-21-4311 EMPIR 2014: Industry The Optical Society of America 30 0146-9592, 1539-4794 10.1364/OL.42.004311 NA F.Beier M.Plötner B.Sattler F.Stutzki T.Walbaum A.Liem N.Haarlammert T.Schreiber R.Eberhardt A.Tünnermann proceedings GrandidierEBXFMDAHD2017 421 2017 47th European Microwave Conference (EuMC) 2017 10 14IND02: PlanarCal: Microwave measurements for planar circuits and components MEMS GSG Probe, nano-prober, Nanowire, on-wafer, microwave https://hal.archives-ouvertes.fr/hal-01726555 EMPIR 2014: Industry IEEE Nuremberg EuMC 08-10-2017 to 12-10-2017 30 10.23919/EuMC.2017.8230973 NA K.Daffé J.Marzouk A. ElFellahi T.Xu C.Boyaval S.Eliet B.Grandidier S.Arscott G.Dambrine K.Haddadi article RiechelmannHEKGS2017 Atmospheric Measurement Techniques 2017 9 15 10 9 ENV59: atmoz: Traceability for atmospheric total column ozone 3375-3383 extraterrestrail spectrum, QASUMEFTS, QASUME EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-10-3375-2017 NA S.Riechelmann G.Hülsen L.Egli I.Kröger J.Gröbner P.Sperfeld proceedings ZhouLLHBEK2017 463 e-cigre.org 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry lightning impulse, time parameters, front time, impulse generator EMPIR 2014: Industry Buenos Aires, Argentina International conference on high-voltage engineering 2017 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_569-measurement-of-the-internal-inductance-of-impulse-voltage-generators-and-the-limits-of-li-front-times L.Zhou Y.Li W.Larzelere J.Hällström A.Bergman A.P.Elg J.Klüss proceedings HallstromBNEMP2017 460 e-cigre.org 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry Step response, impulse measurment, lightning impulse EMPIR 2014: Industry Buenos Aires, Argentina International symposium on high-voltage engineering 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_484-characterization-of-a-fast-step-generator J.Hällström A.Bergman M. Nordlund A.P.Elg J.Meisner S.Passon proceedings BergmanNEHMH2017 461 e-cigre.org 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry Lightning impulse, pulse response, front time EMPIR 2014: Industry Buenos Aires, Argentina International symposium on high-voltage engineering 2017 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_487-influence-of-coaxial-cable-on-response-of-high-voltage-resistive-dividers A.Bergman M.Nordlund A.P.Elg J. Havunen J.Meisner J.Hällström proceedings ElgHB2017 462 e-cigre.org 2017 8 28 14IND08: ElPow: Metrology for the electrical power industry Step response, lightning impulse, transient recorder EMPIR 2014: Industry Buenos Aires, Argentina International symposium on high-voltage engineering 2017 28-08-2017 to 01-09-2017 30 NA https://e-cigre.org/publication/ISH2017_488-evaluation-of-step-response-of-transient-recorders-for-lightning-impulse A.P.Elg J.Hällström A.Bergman article LodewyckTBEBV2017 400 New Journal of Physics 2017 8 19 8 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 083002 optical clock, frequency stability, optical lattice clock, non-destructive detection, spin squeezing http://iopscience.iop.org/1367-2630/19/8/083002 EMRP A169: Call 2012 Open excellence call IOP Publishing 30 1367-2630 10.1088/1367-2630/aa7c84 NA J.Lodewyck R.L.Targat S.Bilicki U.Eismann E.Bookjans G.Vallet article SuEL2017 418 Optics Express 2017 7 25 25 16 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 18703 Image processing, Pattern recognition, Imaging systems, Metrology, Calibration, Microscopy https://www.osapublishing.org/oe/abstract.cfm?uri=oe-25-16-18703 EMPIR 2015: SI Broader Scope The Optical Society of America 30 1094-4087 10.1364/OE.25.018703 NA P.Ekberg R.Su R.Leach article FrazerESJCS2017 Tribology International 2017 7 111 ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems 184-191 gears, lubrication, profile errors, EHL http://www.sciencedirect.com/science/article/pii/S0301679X17300944?via%3Dihub EMRP A169: Call 2013 Energy II Elsevier BV 30 0301-679X 10.1016/j.triboint.2017.02.034 NA R.Frazer H.P.Evans K.J.Sharif H.U.Jamali A.Clarke B.Shaw proceedings SliwczynskiKKIPESB2017 444 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fiber, optical frequency transfer https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE Besançon, France 2017 European Frequency and Time Forum & International Frequency Control Symposium 10-07-2017 to 13-07-2017 30 10.1109/FCS.2017.8088999 NA L.Śliwczyński P.Krehlik J.Kolodziej H.Imlau H.Ender H.Schnatz D.Piester A.Bauch article SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017 477 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fibre, network, clock, time, dissemination, service https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE 30 10.1109/FCS.2017.8089004 NA P.Krehlik L.Śliwczyński J.Dostal J.Radil V.Smotlacha R.Velc J.Vojtech M.Campanella D.Calonico C.Clivati F.Levi O.Číp S.Rerucha R.Holzwarth M.Lessing F.Camargo B.Desruelle J.Lautier-Gaud E.L.English J.Kronjäger P.Whibberley P.E.Pottie R.Tavares P.Tuckey F.John M.Snajder J.Stefl P.Nogaś R.Urbaniak A.Binczewski W.Bogacki K.Turza G.Grosche H.Schnatz E.Camisard N.Quintin J.Diaz T.Garcia E.Ros A.Galardini A.Seeds Z.Yang A.Amy-Klein article ManderEBCB2017 Metrologia 2017 5 26 54 3 ENV58: MeteoMet2: Metrology for essential climate variables S63-S73 humidty, meteorology, sensor drift http://iopscience.iop.org/article/10.1088/1681-7575/aa6dd0/meta;jsessionid=69E0689027FB9B75F14F77239651C49F.ip-10-40-1-105 EMRP A169: Call 2013 Environment II IOP Publishing

Bristol

30 0026-1394, 1681-7575 10.1088/1681-7575/aa6dd0 NA NMander CEngland S LBeardmore P ACarroll S ABell article HemmingWLEKJHL2017 Precision Engineering 2017 4 48 IND62: TIM: Traceable in-process dimensional measuremen 181-190 Application of Monte Carlo simulation for estimation of uncertainty of four-point roundness measurements of rolls EMRP A169: Call 2012 Metrology for Industry (II) Elsevier BV

360 Park Ave S, New York, NY 10010, USA

30 0141-6359 10.1016/j.precisioneng.2016.12.001 NA B.Hemming T.Widmaier A.Lassila V.-P.Esala P.Kuosmanen J.Juhanko J.Haikio P.Laukkanen article BrunzendorfWSLEW2017 Applied Optics 2017 3 17 56 11 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring E99-E105 Nitrous oxide, Fourier transform infrared spectroscopy, spectral line parameters, line strengths, gas metrology EMRP A169: Call 2010 Environment The Optical Society

2010 Massachusetts Ave, NW Washington, DC 20036-1023, USA

30 0003-6935, 1539-4522 10.1364/ao.56.000e99 NA JensBrunzendorf ViktorWerwein AntonSerdyukov GangLi VolkerEbert OlavWerhahn article EbertWQN2017 Applied Optics 2017 3 56 11 ENV52: HIGHGAS: Metrology for high-impact greenhouse gases E84 optical transfer standard, CO measurement EMRP A169: Call 2013 Environment II The Optical Society 30 0003-6935, 1539-4522 10.1364/AO.56.000E84 NA V.Ebert O.Werhahn Z.Qu J.A.Nwaboh proceedings GrobnerVKEI2017 AIP Conference Proceedings 2017 2 22 1810 1 ENV59: atmoz: Traceability for atmospheric total column ozone 110005 Monte Carlo, TOC, Ozone, Uncertainty, Spectral irradiance http://aip.scitation.org/toc/apc/1810/1?size=all&expanded=1810 EMRP A169: Call 2013 Environment II American Institute of Physics The University of Auckland International Radiation Symposium 16-04-2016 to 22-04-2016 30 978-0-7354-1478-5 1551-7616 10.1063/1.4975567 NA J.Gröbner A.Vaskuri P.Kärhä L.Egli E.Ikonen article EswardSEE2017 390 Journal of Sensors and Sensor Systems 2017 2 14 6 1 14SIP08: Dynamic: Standards and software to maximise end user uptake of NMI calibrations of dynamic force, torque and pressure sensors 97-105 dynamic measurement, uncertainty, digital filtering, PyDynamic, software https://www.j-sens-sens-syst.net/6/97/2017/jsss-6-97-2017.pdf EMPIR 2014: Support for Impact Copernicus GmbH 30 2194-878X 10.5194/jsss-6-97-2017 NA S.Eichstädt C.Elster I.M.Smith T.J.Esward article IbraimETZHHHM2017 Journal of Geophysical Research: Atmospheres 2017 2 122 3 ENV52: HIGHGAS: Metrology for high-impact greenhouse gases 1850-1870 nitrous oxide, isotopic composition EMRP A169: Call 2013 Environment II Wiley-Blackwell 30 2169-897X 10.1002/2016JD025906 NA E.Ibraim L.Emmenegger B.Tuzson C.Zellweger C.Hüglin S.Henne E.Harris J.Mohn article MillesSSEGBNL2017 Measurement Science and Technology 2017 1 23 28 3 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects 034010 cantilever stiffness calibration, active reference spring, micro-electro-mechanical system http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034010/pdf EMRP A169: Call 2011 Metrology for New Technologies IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/28/3/034010 NA L.F.Milles S.W.Stahl T.Sulzbach W.Engl S.Gao U.Brand V.Nesterov Z.Li article ElGawhary2017 366 New Journal of Physics 2017 1 20 19 1 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 013021 electromagnetic EMRP A169: Call 2013 Energy II IOP Publishing

Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom

30 1367-2630 10.1088/1367-2630/aa57c3 NA OmarEl Gawhary article ElGawhary20170 366 New Journal of Physics 2017 1 20 19 1 14IND09: MetHPM: Metrology for highly-parallel manufacturing 013021 joint publication with ENG53 electromagnetic EMPIR 2014: Industry IOP Publishing

Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom

30 1367-2630 10.1088/1367-2630/aa57c3 NA OmarEl Gawhary proceedings PokatilovPNETLICDYNPVTC2017_2 1152 18th International Congress of Metrology 2017 15RPT04: TracePQM: Traceability routes for electrical power quality measurements 8 power quality; metrology; power; traceability; measurement EMPIR 2015: Research Potential EDP Sciences Paris 18th International Congress of Metrology 19-09-2017 to 21-09-2017 30 10.1051/metrology/201704001 NA V.Nováková Zachovalová A.Yovcheva J.Diaz de Aguilar R.Caballero Santos D.Ilić J.Lončarević B.Trinchera K.Ellingsberg H.Ndilimabaka A.Philominraj A.Pokatilov O.Power B.Voljc V.Tarasso H.Çaycı article ElsterCW2016 Color Research & Application 2016 12 Na Na IND52: XD Reflect: Multidimensional reflectometry for industry 1-7 Measurement uncertainty; CIELAB color coordinates; Monte Carlo method EMRP A169: Call 2012 Metrology for Industry (II) Wiley-Blackwell 30 0361-2317 10.1002/col.22109 NA ClemensElster JoaquinCampos Acosta GerdWübbeler article Journal of Luminescence 2016 11 1 179 November 2016 EXL02: SIQUTE: Single-photon sources for quantum technologies 59-63 Diamond; Color center; Defect; Ion implantation; Photoluminescence http://www.journals.elsevier.com/journal-of-luminescence EMRP A169: Call 2012 Open excellence call Elsevier

Amsterdam

30 0022-2313 10.1016/j.jlumin.2016.06.039 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-1 J.J. Forneris A.A. Tengattini S.S. Ditalia Tchernij F.F. Picollo A.A. Battiato P.P. Traina I.P.I.P. Degiovanni E.E. Moreva G.G. Brida V.V. Grilj N.N. Skukan M.M. Jakšić M.M. Genovese P.P. Olivero article PlagFHPFFMAEAFH2016 IEEE Journal of Photovoltaics 2016 11 6 4 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 1004-1011 Intercomparison, irradiance, calibration, solar simulator http://ieeexplore.ieee.org/document/7576644/ EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 2156-3381, 2156-3403 10.1109/JPHOTOV.2016.2606698 NA F.Plag M.Friederichs M.Halwachs M.Pravettoni R.Fucci N.Ferretti A.Minuto D.Alonso-Alvarez N.Ekins-Daukes D.Alonso-Alvarez D.Friedrich E.Haverkamp article YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016 321 The Journal of Physical Chemistry C 2016 10 27 120 42 14IND12: Innanopart: Metrology for innovative nanoparticles 24070-24079 VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory https://spiral.imperial.ac.uk/handle/10044/1/40824 EMPIR 2014: Industry American Chemical Society (ACS)

CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States

30 1932-7447, 1932-7455 10.1021/acs.jpcc.6b06713 NA N.A.Belsey D.Cant D.J.H.Cant C.Minelli J.R.Araujo B.Bock P.Brüner D.G.Castner G.Ceccone J.D.P.Counsell P.M.Dietrich M.H.Engelhard S.Fearn C.E.Galhardo H.Kalbe J.W.Kim L.Lartundo-Rojas H.S.Luftman T.S.Nunney J.Pseiner E.F.Smith V.Spampinato J.M.Sturm A.G.Thomas J.P.W.Treacy L.Veith M.Wagstaffe H.Wang M.Wang Y.C.Wang W.Werner L.Yang article Measurement Science and Technology. 2016 10 25 27 12 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics 125009 Kalman filter, measurement uncertainty, Monte Carlo, particle filter, extended Kalman filter, GUM http://iopscience.iop.org/article/10.1088/0957-0233/27/12/125009/meta EMRP A169: Call 2013 Energy II IOP Publishing Ltd.

Bristol

30 None 10.1088/0957-0233/27/12/125009 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-10-1 SEichstädt NMakarava CElster article EngertRGPMKHSCLSKMP2016 International Journal of Thermophysics 2016 10 20 37 12 15SIB02: InK 2: Implementing the new kelvin 2 Temperature, Thermodynamic Methods, Kelvin https://pure.royalholloway.ac.uk/portal/en/publications/new-evaluation-of-t-t2000-from-002k-to-1k-by-independent-thermodynamic-methods(dc393a64-8d59-4083-9435-f2bd70eea8ed).html EMPIR 2015: SI Broader Scope Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-016-2123-4 NA JEngert A.Kirste A.Shibahara A.Casey L.V.Levitin J.Saunders O.Hahtela A.Kemppinen E.Mykkänen M.Prunnila D.Gunnarsson L.Roschier M.Meschke J.Pekola article BrabanCEFBLPHTPMPVWvTNP2016 Measurement Science and Technology 2016 10 27 11 ENV55: MetNH3: Metrology for ammonia in ambient air 115012 ammonia in ambient air, traceability, reference gas standards, optical transfer standard, validation and testing infrastructure EMRP A169: Call 2013 Environment II IOP Publishing

Bristol, United Kingdom

30 0957-0233, 1361-6501 10.1088/0957-0233/27/11/115012 NA Christine FBraban NathanCassidy VolkerEbert ValerioFerracci DavidBalslev-Harder DaianaLeuenberger CélinePascale TuomasHieta CarloTiebe JariPeltola Nicholas AMartin StefanPersijn OlaviVaittinen KlausWirtz Jannekevan Wijk Marsailidh MTwigg BernhardNiederhauser AndreaPogány article Physical Review Letters 2016 9 28 117 14 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 143004 clock, spin squeezing, squeezed vacuum http://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.143004 EMRP A169: Call 2012 Open excellence call American Physical Society

Washington, DC, USA

30 0031-9007 10.1103/PhysRevLett.117.143004 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. IKruse KLange JPeise BLücke LPezzè JArlt WErtmer CLisdat LSantos ASmerzi CKlempt article RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016 Atmospheric Chemistry and Physics 2016 9 23 16 18 ENV51: MeTra: Traceability for mercury measurements 11915-11935 Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1680-7324 10.5194/acp-16-11915-2016 NA R.Ramachandran X.Fu H.Zhang X.B.Feng D.Wip V.Obolkin N.Mashyanov F.Sena B.M.Gawlik L.M.Neves K.A.Read J.Kotnik M.Horvat H.Skov O.Magand H.Angot A.Dommergue P.E.Garcia M.D.CDiéguez C.Barbante W.Cairns J.Brito H.D.M.JBarbosa F.Morais P.Artaxo I.Wängberg J.Munthe L.Martin C.Labuschagne E.G.Brunke A.Weigelt R.Ebinghaus M.Landis V.Mannarino S.Cinnirella F.Carbone F.D'Amore M.Bencardino N.Pirrone F.Sprovieri D.Cossa J.Knoery NicolasMarusczak M.Nerentorp P.Fisicaro proceedings Proceedings of the Conference on Precision Electromagnetic Measurements 2016 8 11 n/a n/a SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1-2 high frequency circuits, metrology, http://ieeexplore.ieee.org/document/7540504/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

Melville

Ottawa, Canada Conference on Precision Electromagnetic Measurements 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540504 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CEi⊘ DAllal PHuerlimann JRuefenacht SZinal article CIRP Annals Manufacturing Technology 2016 8 65/I 2016 ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems 643-665 Metrology, Measuring Instrument, Uncertainty, Simulation, Modelling, Information http://www.sciencedirect.com/science/article/pii/S0007850616301895 EMRP A169: Call 2013 Energy II Elsevier

Oxford

30 10.1016/j.cirp.2016.05.002 1 59 No, EURAMET is never allowed to make the publication publicly available. R.Schmitt M.Peterek E.Morse W.Knapp M.Galetto F.Härtig G.Goch B.Hughes A.Forbes W.T.Estler article WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016 Atmospheric Chemistry and Physics Discussions 2016 7 20 ENV51: MeTra: Traceability for mercury measurements 1-33 mercury, wet deposition flux, EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1680-7375 10.5194/acp-2016-517 NA I.Wängberg C.Walters M.Vardè P.Spandow V.Somerset F.Sena M.R.Islas V.Obolkin J.Munthe T.Mkololo N.Mashyanov L.Martin O.Magand C.Labuschagne J.Kotnik M.Horvat K.Hansson U.Hageström B.Gawlik P.E.Garcia X.Fu X.B.Feng R.Ebinghaus A.Dommergue M.D.C.Diéguez S.Comero W.Cairns F.Arcega-Cabrera E.G.Brunke C.Barbante H.Angot F.D'Amore M.Bencardino N.Pirrone F.Sprovieri A.Weigelt X.Yang P.Fisicaro proceedings Conference on Precision Electromagnetic Measurements 2016 (Digest) 2016 7 10 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids Analogue power amplifier, voltage gain, transconductance, test equipment, instrument transformers http://ieeexplore.ieee.org/document/7540559/ EMRP A169: Call 2013 Energy II Ottawa CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540559 1 59 No, EURAMET is never allowed to make the publication publicly available. MohnsEnrico FrickeSoeren PaulingFlorian article EbertWPN2016 Applied Spectroscopy 2016 7 71 5 ENV52: HIGHGAS: Metrology for high-impact greenhouse gases 888-900 laser absorption spectroscopy EMRP A169: Call 2013 Environment II SAGE Publications 30 0003-7028, 1943-3530 10.1177/0003702816658672 NA V.Ebert O.Werhahn S.Pratzler J.A.Nwaboh proceedings 19th World Conference on Non-Destructive Testing 2016 2016 7 2016 Modelling and Data Processing ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-8 Ultrasonic Testing (UT), Modelling and Data Processing http://www.ndt.net/article/wcndt2016/papers/fr1h5.pdf EMRP A169: Call 2013 Energy II NDT.net

Bad Breisig, Germany

Internationales Congress Center München Messegelände, Munich, Germany 19th World Conference on Non-Destructive Testing 2016 13-06-2016 to 17-06-2016 30 978-3-940283-78-8 1435-4934 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. KJJezzine DSSegur REEcault NDDominguez proceedings Conference on Precision Electromagnetic Measurements 2016 7 2016 1 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids ID127212 Optical fiber, Faraday efect, Verdet constant, birefringence, current sensor http://ieeexplore.ieee.org/document/7540523/ EMRP A169: Call 2013 Energy II IEEE

Danvers

30 10.1109/CPEM.2016.7540523 1 59 No, EURAMET is never allowed to make the publication publicly available. http://www.cpem2016.com/welcome_e.shtml D.Istrate R.Etienne J.Dubard A.Litwin O.Enouf article EkinsDaukesA2016 IEEE Journal of Photovoltaics 2016 7 6 4 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 1004-1011 III-V multijunction solar cell measurement, Photoluminescence, Characterization of PV http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=7452344 EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 2156-3381, 2156-3403 10.1109/JPHOTOV.2016.2547583 NA N.Ekins-Daukes D.Alonso-Alvarez article GiazottoE2016 Physical Review Applied 2016 6 30 5 6 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 064020 coulomb blockade, mesoscopics, proximity effect https://journals.aps.org/prapplied/abstract/10.1103/PhysRevApplied.5.064020 EMRP A169: Call 2012 Open excellence call American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.5.064020 NA FrancescoGiazotto EmanueleEnrico proceedings CalmonDESJ2016 QNDE16 2016 6 16 ENG57: VITCEA: Validated inspection techniques for composites in energy applications Hybrid ray-FDTD simulation ultrasonic inspection CFRP http://aip.scitation.org/doi/pdf/10.1063/1.4974660 EMRP A169: Call 2013 Energy II Atlanta QNDE16 17-07-2016 to 22-07-2016 30 10.1063/1.4974660 NA P.Calmon N.Dominguez R.Ecault D.Ségur K.Jezzine article ProfrockGBBNGEPGSG2016 Talanta 2016 5 152 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 251-258 IDMS, Method Validation, PBDE, Water, Water Framework Directive EMRP A169: Call 2010 Environment Elsevier BV 30 0039-9140 10.1016/j.talanta.2016.01.066 NA D.Pröfrock A.González-Gago B.Binici M.Bílsel M.Nousiainen H.Goenaga-Infante J.Entwisle P.Petrov F.Gantois C.Swart A.C.Goren proceedings Proceedings of the third Joint International Symposium on Deformation Monitoring 2016 4 SIB60: Surveying: Metrology for long distance surveying Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf EMRP A169: Call 2012 SI Broader scope (II) Vienna, Austria Joint International Symposium on Deformation Monitoring March 30-April 1, 2016 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Pollinger A.Bauch J.Leute K.Meiners-Hagen J.Mildner J.Guillory J.-P.Wallerand J.Jokela U.Kallio H.Koivula S.Lahtinen M.Poutanen M.Astrua C.Francese M.Zucco L.Eusebio F.Marques C.Pires F.Saraiva O.Pelligrino T.Tomberg T.Hieta T.Fordell M.Merimaa V.Kupko P.Neyezhmakov S.Bergstrand S.A.van den Berg T.Kersten T.Krawinkel article Journal of Applied Geodesy 2016 3 31 10 1 SIB60: Surveying: Metrology for long distance surveying 53-60 GNSS; Antenna Near-field Effects; Satellite Obstruction; EMRP JRP SIB60 EMRP A169: Call 2012 SI Broader scope (II) De Gruyter 30 (Online) 1862-9024, (Print) 1862-9016 10.1515/jag-2015-0026 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Zimmermann C.Eling H.Kuhlmann article Philos Trans A Math Phys Eng Sci 2016 3 28 374 2064 SIB01: InK: Implementing the new kelvin 1-16 PLTS-2000; SQUIDs; noise; primary thermometry; temperature scales http://www.ncbi.nlm.nih.gov/pubmed/26903105 EMRP A169: Call 2011 SI Broader Scope National Center for Biotechnology Information

Bethesda

30 NA 10.1098/rsta.2015.0050. 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. AKirste JEngert article PacynaHJDCBBBPHBGEPF2016 Environmental Science & Technology 2016 3 50 6 ENV51: MeTra: Traceability for mercury measurements 2767-2770 Mercury, Minamata Convention, EMRP A169: Call 2013 Environment II American Chemical Society (ACS) 30 0013-936X, 1520-5851 10.1021/acs.est.6b00573 NA J.Pacyna M.Horvat D.Jaffe C.T.Driscoll C.Chen P.Bustamante J.Blum N.Basu A.Pierce C.R.Hammerschmidt M.S.Bank M.S.Gustin D.C.Evers N.Pirrone P.Fisicaro article Philosophical Transactions of the Royal Society A 2016 2 22 374 2064 SIB01: InK: Implementing the new kelvin 20150054 noise, thermometry, PLTS-2000, SQUID, primary, uncertainty http://rsta.royalsocietypublishing.org/content/374/2064/20150054 EMRP A169: Call 2011 SI Broader Scope The Royal Society Publishing

London

30 1471-2962 10.1098/rsta.2015.0054 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-22 AShibahara OHahtela JEngert Hvan der Vliet L VLevitin ACasey C PLusher JSaunders DDrung ThSchurig article Nanotechnology 2016 2 8 27 (2016) 095303 2016 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects 8 pp silicon nanowire, deep reactive ion etching, transmission electron microscopy, MEMS & NEMS EMRP A169: Call 2011 Metrology for New Technologies IOP Publishing Ltd.

London

30 10.1088/0957-4484/27/9/095303 1 59 No, EURAMET is never allowed to make the publication publicly available. Z.Tasdemir N.Wollschläger W.Österle Y.Leblebici B.Erdem Alaca article EomJKKK2016_3 Measurement 2016 2 80 SIB58: Angles: Angle metrology 288-293 Absolute angle measurement, Angle encoder, Graduated disk, Absolute position binary code, Nonlinearity error EMRP A169: Call 2012 SI Broader scope (II) Elsevier BV 30 0263-2241 10.1016/j.measurement.2015.11.037 NA T.B.Eom J.Jin C.S.Kang J.W.Kim J.A.Kim article MonteyneVPRFEBE2016 Accreditation and Quality Assurance 2016 2 21 2 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 113-120 Homogeneity, Stability, Uncertainty, Whole water, Reference materials, PAHs, PBDEs, TBT, Water Framework Directive EMRP A169: Call 2010 Environment Springer Nature 30 0949-1775, 1432-0517 10.1007/s00769-015-1189-1 NA E.Monteyne G.Vanermen R.Philipp J.Richter I.Fettig S.Elordui-Zapatarietxe G.Boom H.Emteborg article SawalNPGZRBTGSGACFEERBP2016 Accreditation and Quality Assurance 2016 1 29 21 2 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 121-129 Water Framework Directive, Interlaboratory comparison, Whole water sample, Suspended particulate matter, Polycyclic aromatic hydrocarbons, Polybrominated diphenyl ethers, Tributlyltin EMRP A169: Call 2010 Environment Springer Nature 30 0949-1775, 1432-0517 10.1007/s00769-015-1190-8 NA G.Sawal M.Nousiainen D.Pröfrock A.G.Gago T.Zuliani A.Rodríguez-Cea B.Binici M.Tunç T.Gokcen C.Swart F.Gantois E.Alasonati J.Cabillic I.Fettig H.Emteborg S.Elordui-Zapatarietxe J.Richter M.Buzoianu R.Philipp article Journal of Molecular Spectroscopy 2016 1 23 323 Atmospheric Spectroscopy ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 28-42 Nitrous oxide, Fourier transform infrared spectroscopy, Line parameters; Self-broadening, Self-shift, Gas metrology http://www.sciencedirect.com/science/article/pii/S002228521630011X EMRP A169: Call 2010 Environment Elsevier B. V.

Kidlington (Oxford)

30 0022-2852 10.1016/j.jms.2016.01.010 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.sciencedirect.com/science/article/pii/S002228521630011X ViktorWerwein JensBrunzendorf AntonSerdyukov OlavWerhahn VolkerEbert article Metrologia 2016 1 13 53 1 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 32-39 MCMC, Metropolis–Hastings, Monte Carlo, Bayesian statistics, high-dimensional integration, proposal distribution, convergence diagnostics MAT - EMRP A169: Call 2011 Metrology for New Technologies BIPM

Sèvres

30 - 10.1088/0026-1394/53/1/S32 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Klauenberg C.Elster proceedings EbertWQN2016 Imaging and Applied Optics 2016 2016 ENV52: HIGHGAS: Metrology for high-impact greenhouse gases dTDLAS, atmospheric EMRP A169: Call 2013 Environment II OSA Heidelberg, Germany Laser Applications to Chemical, Security and Environmental Analysis 2016 25-07-2016 to 28-07-2016 30 10.1364/LACSEA.2016.LM3G.4 NA V.Ebert O.Werhahn Z.Qu J.A.Nwaboh proceedings LiEBWSW2016 Imaging and Applied Optics 2016 2016 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring LM3G.1 infrared spectroscopy, Fourier transform spectroscopy, high-Resolution spectroscopy, spectral line data, gas metrology EMRP A169: Call 2010 Environment The Optical Society

2010 Massachusetts Ave, NW Washington, DC 20036-1023, USA

Heidelberg Laser Applications to Chemical, Security and Environmental Analysis 2016 25-07-2016 to 28-07-2016 30 10.1364/LACSEA.2016.LM3G.1 NA GangLi VolkerEbert JensBrunzendorf OlavWerhahn AntonSerdyukov ViktorWerwein article WerweinBESLW2016 Imaging and Applied Optics 2016 2016 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring JT3A.14 infrared spectroscopy, Fourier transform spectroscopy, nitrous oxide, line position EMRP A169: Call 2010 Environment The Optical Society

2010 Massachusetts Ave, NW NW Washington DC 20036-1023, United States

30 10.1364/3D.2016.JT3A.14 NA ViktorWerwein JensBrunzendorf VolkerEbert AntonSerdyukov GangLi OlavWerhahn proceedings LuttschwagerGPWE2016 Imaging and Applied Optics 2016 2016 IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments LM3G.3 remote sensing and sensors, detectors, diode lasers, molecular spectroscopy, high resolution spectroscopy, air pollution monitoring, laser sensors, optical sensing and sensors, photothermal effects EMRP A169: Call 2012 Metrology for Industry (II) The Optical Society

2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States

Heidelberg Germany Laser Applications to Chemical, Security and Environmental Analysis 2016 25-07-2016 to 28-07-2016 30 978-1-943580-15-6 10.1364/LACSEA.2016.LM3G.3 NA Nils O. B.Lüttschwager JulianGrodde AndreaPogány OlavWerhahn VolkerEbert proceedings PoganyEW2016 Imaging and Applied Optics 2016 2016 ENV55: MetNH3: Metrology for ammonia in ambient air JT3A.15 absorption spectroscopy, diode lasers, molecular spectroscopy, high resolution spectroscopy EMRP A169: Call 2013 Environment II The Optical Society

Washington DC, USA

Heidelberg Germany Laser Applications to Chemical, Security and Environmental Analysis 2016 25-07-2016 to 28-07-2016 30 978-1-943580-15-6 10.1364/3D.2016.JT3A.15 NA AndreaPogány VolkerEbert OlavWerhahn article Metrologia 2016 52 Oct SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies 635–645 speed of light perturbation, absolute gravimeters, gravimetry, watt balance, SI http://iopscience.iop.org/article/10.1088/0026-1394/52/5/635 EMRP A169: Call 2011 SI Broader Scope Institute of Physics

Bristol (UK)

30 0026-1394 10.1088/0026-1394/52/5/635 1 59 No option selected HBaumann FPythoud DBlas SSibiryakov AEichenberger E EKlingelé article Physical Chemistry Chemical Physics 2016 17 14 IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry 9471-9 https://www.osapublishing.org/oe/abstract.cfm?uri=oe-22-15-17948 EMRP A169: Call 2012 Metrology for Industry (II) Royal Society of Chemistry

Piccadilly London

30 1463-9076 10.1039/c4cp05944a 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 AHornemann DEichert SFlemig GUlm BBeckhoff proceedings 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest 2016 n / a n / a SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 7540562 (2 pp.) AC Josephson voltage standards, binary-divided Josephson series arrays, NbSi barrier Josephson junctions, pulse-driven Josephson series arrays, SNS Josephson junctions http://ieeexplore.ieee.org/document/7540562/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

Piscataway, USA

Ottawa, Canada 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 Electronic ISSN: 2160-0171 10.1109/CPEM.2016.7540562 1 59 No, EURAMET is never allowed to make the publication publicly available. http://ieeexplore.ieee.org/document/7540562/ J.Kohlmann O.Kieler T.Scheller B.Egeling R.Wendisch R.Behr proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 SIB51: GraphOhm: Quantum resistance metrology based on graphene Calibration, graphene, quantum Hall effect, resistance standard http://ieeexplore.ieee.org/document/7540514/ EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540514 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.Bergsten G.Eklund proceedings 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest 2016 n / a n / a SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 7540509 (2 pp.) Impedance bridge, Josephson array, Josephson impedance bridge, Josephson voltage standard. http://ieeexplore.ieee.org/document/7540509/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

Piscataway, USA

Ottawa, Canada 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 Electronic ISSN: 2160-0171 10.1109/CPEM.2016.7540509 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://ieeexplore.ieee.org/document/7540509/ GEklund TBergsten K-ERydler proceedings 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest 2016 n / a n / a SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 7540584 (2 pp.) Impedance bridge, Josephson array, Josephson impedance bridge, Josephson voltage standard. http://ieeexplore.ieee.org/document/7540584/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

Piscataway, USA

Ottawa, Canada 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 Electronic ISSN: 2160-0171 10.1109/CPEM.2016.7540584 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://ieeexplore.ieee.org/document/7540584/ GEklund TBergsten THagen LPalafox RBehr article Applied Physics B 2016 122 8 IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments 226 FREQUENCY COMB; TEMPERATURE; MUMAS http://link.springer.com/article/10.1007/s00340-016-6499-4/fulltext.html EMRP A169: Call 2012 Metrology for Industry (II) Springer

New York

30 0946-2171 10.1007/s00340-016-6499-4 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SO'Hagan TPinto PEwart GADRitchie article Journal of Geophysical Research: Atmospheres 2016 121 10 ENV58: MeteoMet2: Metrology for essential climate variables 5115–5137 diurnal temperature range, data set, reassessment http://onlinelibrary.wiley.com/doi/10.1002/2015JD024583/abstract EMRP A169: Call 2013 Environment II Wiley

Hoboken

30 2169-897X 10.1002/2015JD024583 1 79,59 No, EURAMET is never allowed to make the publication publicly available. P WThorne M JMenne C NWilliams J JRennie J HLawrimore R SVose T CPetersono IDurre RDavy IEsau A M GKlein-Tank AMerlone article EkinsDaukesA2016_2 IEEE Journal of Photovoltaics 2016 6 4 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 1004-1011 Semiconductors, multi-junction solar cells, photoluminescence, SPICE http://www.riverpublishers.com/journal_read_html_article.php?j=JGE/5/4/3 EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 1904-4720 10.13052/jge1904-4720.5343 NA N.Ekins-Daukes D.Alonso-Alvarez article Metrologia 2015 12 16 53 1 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 1-9 inverse problem, Bayesian framework, Metropolis–Hastings, measurement uncertainty, prior distributions, thermal diffusivity MAT - EMRP A169: Call 2011 Metrology for New Technologies BIPM

Sèvres

30 - 10.1088/0026-1394/53/1/S1 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Allard N.Fischer G.Ebrard B.Hay P.Harris L.Wright D.Rochals J.Mattout article SmerziSHAEPLKLPK2015 Nature Communications 2015 11 27 6 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 8984 quantum mechanics, entanglement, heisenberg limit EMRP A169: Call 2012 Open excellence call Springer Nature

New York

30 2041-1723 10.1038/ncomms9984 NA A.Smerzi L.Santos K.Hammerer J.Arlt W.Ertmer L.Pezzè B.Lücke I.Kruse K.Lange J.Peise C.Klempt article Int. J. Metrol. Qual. Eng. 2015 11 23 6 3 SIB10: NOTED: Novel techniques for traceable temperature dissemination 303 Au/Pt thermocouple, reference function, temperature scale http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html EMRP A169: Call 2011 SI Broader Scope Dr. A. CHARKI

EDP Sciences - France 17, Avenue du Hoggar Parc d'Activité de Courtabœuf BP 112 91944 Les Ulis Cedex A France

30 10.1051/ijmqe/2015016 1 59 No, EURAMET is never allowed to make the publication publicly available. http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html F.Edler N.Arifovic G.Atance C.Dinu C. J.Elliott C. G.Izquierdo N.Hodzic S.Kalisz J.V.Pearce S.Simic R.Strnad D.Taubert article Metrologia 2015 11 18 52 6 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 878 - 892 Bayesian inference, prior knowledge, conjugate prior distribution, linear regression, Normal inverse Gamma distribution, Gaussian measurement error, sonic nozzle calibration MAT http://iopscience.iop.org/article/10.1088/0026-1394/52/6/878/meta EMRP A169: Call 2011 Metrology for New Technologies BIPM

Sèvres

30 - 10.1088/0026-1394/52/6/878 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Klauenberg G.Wuebbeler B.Mickan P.Harris C.Elster techreport CDDIS: NASA's Archive of Space Geodesy Data 2015 11 1 Revision 2 Draft 3.4 SIB60: Surveying: Metrology for long distance surveying GNSS, SLR, DORIS, VLBI, global network http://cddis.gsfc.nasa.gov/docs/2015/SiteRecDoc_Rev2_D3.4.pdf EMRP A169: Call 2012 SI Broader scope (II) NASA Goddard Space Flight Center

Greenbelt

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. G.Appleby D.Behrend S.Bergstrand H.Donovan C.Emerson J.Esper H.Hase J.Long C.Ma D.McCormick C.Noll E.Pavlis P.Ferrage M.Pearlman J.Saunier D.Stowers S.Wetzel article LiGWSE2015 Journal of Quantitative Spectroscopy and Radiative Transfer 2015 11 165 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 76-87 HCl, Self-induced broadening, Self-induced shift, Line intensity, First overtone band (2-0) EMRP A169: Call 2010 Environment Elsevier BV

New York, USA

30 0022-4073 10.1016/j.jqsrt.2015.06.021 NA GangLi MichaelGisi OlavWerhahn AntonSerdyukov VolkerEbert article EbertPK2015 Journal of Quantitative Spectroscopy and Radiative Transfer 2015 11 165 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 108-122 Line strength, Water vapor, Tunable diode laser absorption spectroscopy, Uncertainty, Metrology EMRP A169: Call 2010 Environment Elsevier BV

New York, USA

30 0022-4073 10.1016/j.jqsrt.2015.06.023 NA VolkerEbert AndreaPogány AlexanderKlein article PTB-Mitteilungen 2015 11 125 2 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 18-23 dynamic measurement, system identification, uncertainty, dynamic system, least-squares EMRP A169: Call 2010 Industry Physikalisch-Technische Bundesanstalt

Braunschweig

30 ISSN 0030-834X 10.7795/310.20150204 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S.Eichstädt article PTB-Mitteilungen 2015 11 125 2 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 68-69 dynamic measurement, uncertainty, GUM, guideline, deconvolution, dynamic calibration, pre-normative study https://oar.ptb.de/resources/show/10.7795/310.20150210 EMRP A169: Call 2010 Industry Physikalisch-Technische Bundesanstalt

Braunschweig

30 ISSN 0030-834X 10.7795/310.20150210 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S.Eichstädt T.Esward article OliveroGSGMEDBBAMTF2015 563 Scientific Reports 2015 10 29 5 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 15901 Single Photon Sources, NV centers https://www.nature.com/articles/srep15901 EMPIR 2014: Industry Springer Nature 30 2045-2322 10.1038/srep15901 NA J.Forneris P.Traina D.G.Monticone G.Amato L.Boarino G.Brida I.P.Degiovanni E.Enrico E.Moreva V.Grilj N.Skukan M.Jakšić M.Genovese P.Olivero article Measurement 2015 10 9 78 ENG01: GAS: Characterisation of Energy Gases 168-179 High temperature measurement High temperature fixed points (HTFPs) Industrial process control Radiation thermometry Thermocouples Reference functions http://www.sciencedirect.com/science/article/pii/S026322411500500X EMRP A169: Call 2009 Energy ELSEVIER

Amsterdam

30 0263-2241 10.1016/j.measurement.2015.09.033 1 59 No option selected GMachiin KAnhalt MBattuello FBourson PDekker ADiril FEdler C.J.Elliott FGirard AGreenen LKnazovická DLowe PPavlasek J.V.Pearce MSadli RStrnad MSeifert E.M.Vuelban proceedings International Congress of Metrology (CIM) 2015, Proceedings 2015 9 23 2015 n.a. ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions 07008 EMRP, industrial emissions http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07008/metrology_metr2015_07008.html EMRP A169: Call 2013 Environment II EDP Sciences - Web of Conferences

Les Ulis Cedex

Paris 17th International Comgress of Metrology 2015 2015-09-21 to 2015-09-24 30 n.a. n.a. 10.1051/metrology/20150007008 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. AnneRausch OlavWerhahn OliverWitzel VolkerEbert Edgar MorenoVuelban JanGersl GjermundKvernmo JohnKorsman MarcColeman TomGardiner RodRobinson proceedings International Congress of Metrology (CIM) 2015, Proceedings 2015 9 23 2015 IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments 07005 infrared laser spectroscopy, TILSAM, tunable diode laser absorption, cavity ring-down spectroscopy, photoacoustic spectroscopy, gas analysis http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07005/metrology_metr2015_07005.html EMRP A169: Call 2012 Metrology for Industry (II) EDP Sciences - Web of Conferences

Les Ulis Cedex

Paris 17th International Congress of Metrology 2015 21-09-2015 to 24-09-2015 30 10.1051/metrology/20150007005 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. NilsLüttschwager AndreaPogány JavisNwaboh AlexanderKlein BernhardBuchholz OlavWerhahn VolkerEbert article 17 International Congress of Metrology, 0 00 (20 5 ) 2015 9 21 17 17 14IND04: EMPRESS: Enhancing process efficiency through improved temperature measurement 08001 efficiency, temperature measurement http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08001.pdf EMPIR 2014: Industry International Congress of Metrology

London

30 NA 10.1051/metrology/20150008001 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J VPearce FEdler C JElliott LRosso GSutton RZante GMachin proceedings 17th International Congress of Metrology 2015 9 21 2015 ENV55: MetNH3: Metrology for ammonia in ambient air 07003 ammonia, reference gas mixture, reference gas generator, dilution, absolute spectroscopic measurements, sampling, gas cylinders http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_07003/metrology_metr2015_07003.html EMRP A169: Call 2013 Environment II EDP Sciences - Web of Conferences

Les Ulis Cedex

Paris, France 17th International Congress of Metrology 21-09-2015 to 24-09-2015 30 10.1051/metrology/201507003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Pogány D.Balslev-Harder C. F.Braban N.Cassidy V.Ebert V.Ferracci T.Hieta D.Leuenberger N.Lüttschwager N.Martin C.Pascale C.Tiebe M. M.Twigg O.Vaittinen J.van Wijk K.Wirtz B.Niederhauser article QuetelKHFEBB2015 Metrologia 2015 8 27 52 5 ENV51: MeTra: Traceability for mercury measurements L25-L30 Who should take responsibility for decisions on internationally recommended datasets? The case of the mass concentration of mercury in air at saturation EMRP A169: Call 2013 Environment II IOP Publishing 30 0026-1394, 1681-7575 10.1088/0026-1394/52/5/L25 NA C.R.Quétel K.H.Kim M.Horvat P.Fisicaro H.Ent P.J.Brewer R.J.C.Brown techreport - 2015 7 30 - - NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation - - MAT https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf EMRP A169: Call 2011 Metrology for New Technologies PTB

Brunswick & Berlin

- 30 - - 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf C.Elster K.Klauenberg M.Walzel G.Wuebbeler P.Harris M.Cox C.Matthews I.Smith L.Wright A.Allard N.Fischer S.Cowen S.Ellison P.Wilson F.Pennecchi G.Kok A.Van der Veen L.R.Pendrill article Biomed. Eng.-Biomed. 2015 7 20 60 4 HLT07: MeDD: Metrology for drug delivery 381-387 drug delivery; hospital policy; infusion; therapy; medical devices; metrology; multi-infusion; quality assurance; standards EMRP A169: Call 2011 Metrology for Health 30 10.1515/bmt-2014-0147 1 59 No, EURAMET is never allowed to make the publication publicly available. A.M.D.E.Timmerman S.M.Oliveira-Martens R.A.Snijder A.K.Niemann T.C.Egberts article LalereGPRFESE2015 Accreditation and Quality Assurance 2015 7 11 20 6 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 447-455 Water Framework Directive, Reference materials, Hydrophobic organic pollutants, Bottles, Adsorption, Glass, Aluminium, Fluorinated polyethylene EMRP A169: Call 2010 Environment Springer Nature 30 0949-1775, 1432-0517 10.1007/s00769-015-1150-3 NA B.Lalère F.Gantois R.Philipp J.Richter I.Fettig S.Elordui-Zapatarietxe C.Swart H.Emteborg article Biomed. Eng.-Biomed. Tech. 2015 7 10 60 4 HLT07: MeDD: Metrology for drug delivery 277-300 compliance; drug delivery; in vitro; infusion; metrology; pumps; review EMRP A169: Call 2011 Metrology for Health 30 10.1515/bmt-2014-0148 1 59 No, EURAMET is never allowed to make the publication publicly available. R.A.Snijder M.K.Koning P.Lucas T.C.Egberts A.M.D.E.Timmerman article Optics Letters 2015 6 1 40 11 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 2626-2629 https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-11-2626 EMRP A169: Call 2013 Energy II Optical Society of America 30 0146-9592 10.1364/OL.40.002626 1 59 No, EURAMET is never allowed to make the publication publicly available. OEGEl Gawhary article Acta Imeko 2015 6 4 2 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 45-51 Dynamic calibration, shock force, dynamic modelling, parameter identification https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-04%20(2015)-02-08/384 EMRP A169: Call 2010 Industry Imeko

Budapest

30 2221-870X 10.21014/acta_imeko.v4i2.214 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M.Kobusch S.Eichstädt L.Klaus T.Bruns article SuomalainenSNMMLLKHEDBHW2015 IEEE Transactions on Instrumentation and Measurement 2015 6 64 6 ENG07: HVDC: Metrology for High Voltage Direct Current 1390-1397 Voltage measurement, Calibration, Resistors, HVDC transmission, Uncertainty, Voltage control, Resistance EMRP A169: Call 2009 Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2015.2408795 NA E.P.Suomalainen M.Schmidt T.Nieminen A.Merev J.Meisner W.Lucas T.Lehtonen J.Klüss E.Houtzager A.P.Elg S.Dedeoğlu A.Bergman J.Hällström C.Weber article NieminenKHBE2015 IEEE Transactions on Instrumentation and Measurement 2015 6 64 6 ENG07: HVDC: Metrology for High Voltage Direct Current 1709-1715 Resistors, Resistance, Calibration, Uncertainty, Voltage measurement, Measurement uncertainty, HVDC transmission EMRP A169: Call 2009 Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2015.2410373 NA T.Nieminen M.Kharezy J.Hällström A.Bergman A.P.Elg article Carbon 2015 5 23 93 n/a NEW08: MetNEMS: Metrology with/for NEMS 896–902 grapheme, metrology, scanning Kelvin probe microscopy http://www.sciencedirect.com/science/article/pii/S0008622315004686 EMRP A169: Call 2011 Metrology for New Technologies Elsevier

Amsterdam

30 n/a 10.1016/j.carbon.2015.05.061 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-5-23 R. E.Hill-Pearce VEless ALartsev N. A.Martin I. L.Barker-Snook J. J.Helmore R.Yakimova J. C.Gallop LHao article Biogeosciences 2015 4 29 12 N/A ENV52: HIGHGAS: Metrology for high-impact greenhouse gases 2517-2531 None supplied. http://www.biogeosciences.net/12/2517/2015/ EMRP A169: Call 2013 Environment II Copernicus Publications

Gottingen

30 1726-4189 10.5194/bg-12-2517-2015 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BWolf LMerbold CDecock BTuzson EHarris JSix LEmmenegger JMohn article IEEE transactions on instrumentation and measurement 2015 4 20 64 6 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1355 - 1363 smart grid, metrology, synchrophasor, phasor measurement unit, revenue metering, power quality, grid modelling, electrical grids http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7089250 EMRP A169: Call 2013 Energy II IEEE

n/a

30 0018-9456 10.1109/TIM.2015.2406056 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. GertRietveld Jean-PierreBraun RicardoMartin PaulWright WeibkeHeins NikolaEll PaulClarkson NorbertZisky article Nature Communications 2015 4 14 6 1 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 6811 Physical sciences Atomic and molecular physics http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html#affil-auth EMRP A169: Call 2012 Open excellence call Macmillan Publishers Limited

Basingstoke, Hampshire RG21 6XS, United Kingdom

30 2041-1723 10.1038/ncomms7811 1 59 No, EURAMET is never allowed to make the publication publicly available. http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html#affil-auth JPeise BLücke LPezze FDeuretzbacher WErtmer JArlt ASmerzi LSantos CKlempt article Metrologia 2015 4 1 52 2 ENG01: GAS: Characterisation of Energy Gases 267-271 Eutectic fixed point; High temperature; HiTeMS; Self-validation; Thermocouple http://iopscience.iop.org/article/10.1088/0026-1394/52/2/267 EMRP A169: Call 2009 Energy IOP PUBLISHING LTD

Bristol

30 0026-1394 10.1088/0026-1394/52/2/267 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31 C.J.Elliott AGreenen DLowe J.V.Pearce GMachin article Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms 2015 4 1 348 8 EXL02: SIQUTE: Single-photon sources for quantum technologies 187-190 Diamond; Electroluminescence; Graphite; Ion beam micro-machining http://www.sciencedirect.com/science/journal/0168583X EMRP A169: Call 2012 Open excellence call Elsevier

London

30 0168-583X 10.1016/j.nimb.2014.12.036 1 59 No, EURAMET is never allowed to make the publication publicly available. J.Forneris A.Battiato D.Gatto Monticone F.Picollo G.Amato L.Boarino G.Brida I.P.Degiovanni E.Enrico M.Genovese E.Moreva P.Traina C.Verona G.Verona Rinati P.Olivero article Metrologia 2015 4 1 52 2 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 392-399 Bayesian analysis, prior knowledge, posterior distribution, calibration, flow meter, least squares, regression MAT http://iopscience.iop.org/article/10.1088/0026-1394/52/2/392/meta EMRP A169: Call 2011 Metrology for New Technologies BIPM

Sèvres

30 - 10.1088/0026-1394/52/2/392 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. G. J. P.Kok A. M. H.Van der Veen P. M.Harris I. M.Smith C.Elster article International Journal of Metrology and Quality Engineering (IJMQE) 2015 2 23 6 1 IND01: HiTeMS: High temperature metrology for industrial applications (>1000 °C) 7/103 Thermocouple, miniature fixed point, self-validation http://www.metrology-journal.org/ EMRP A169: Call 2010 Industry EDP Sciences 2015,

F-91944 Les Ulis Cedex A

30 2107-6839 10.1051/ijmqe/2015003 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on unknown-1-1 FEdler SHaupt S AMokdad GFailleau MSadli article ElgHK2015 Journal of Electrostatics 2015 2 73 ENG07: HVDC: Metrology for High Voltage Direct Current 140-150 HVDC transmission; Electromagnetic fields; Finite element methods; Voltage dividers; Voltage measurement EMRP A169: Call 2009 Energy Elsevier BV 30 0304-3886 10.1016/j.elstat.2014.11.005 NA A.P.Elg J.Hällström J.Klüss proceedings 84th ARFTG Microwave Measurement Conference 2015 1 19 84 n/a SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits n/a Vector Network Analyzer (VNA), calibration, metrology, uncertainties, ripple technique http://ieeexplore.ieee.org/document/7013414/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

Melville

Boulder, Colorado, USA 84th ARFTG Microwave Measurement Conference 04-12-2014 to 05-12-2015 30 978-1-4799-7085-8 n/a 10.1109/ARFTG.2014.7013414 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. JStenarson CEio KYhland article Biostatistics 2015 1 9 16 3 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 454-464 4-parametric logistic function; Bayesian inference; CCQM-P58.1; ELISA; Heteroscedastic variance; Immunoassay; Informative prior; Metrology; Non-linear modeling; Prior knowledge. MAT http://biostatistics.oxfordjournals.org/content/16/3/454 EMRP A169: Call 2011 Metrology for New Technologies Oxford University Press

Oxford

30 - 10.1093/biostatistics/kxu057 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. K.Klauenberg M.Walzel B.Ebert C.Elster article IEEE Transactions on Instrumentation and Measurement 2015 64 6 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1559-1563 Active filters, analog circuits, Butterworth filters, harmonic distortion, Josephson voltage standards, low-pass filters, phase distortion, temperature dependence EMRP A169: Call 2012 SI Broader scope (II) 30 0018-9456 10.1109/TIM.2015.2418454 59 No, EURAMET is never allowed to make the publication publicly available. TobiasBergsten GunnarEklund ValterTarasso Karl-ErikRydler proceedings DGaO-Proceedings 2015 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices http://www.dgao-proceedings.de EMRP A169: Call 2010 Industry Eindhoven, The Netherlands 113th annual meeting of the DGaO 29 May - 1 June 2012 30 1614-8436 59 No, EURAMET is never allowed to make the publication publicly available. BerndBodermann JohannesEndres HermannGroß Mark-AlexanderHenn AkikoKato FrankScholze MatthiasWurm proceedings Frequency Control Symposium & the European Frequency and Time Forum (FCS), 2015 Joint Conference of the IEEE International 2015 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 276-279 Frequency transfer, Optical fiber network, Optical fiber, DWDM. http://ieeexplore.ieee.org/xpl/articleDetails.jsp?reload=true&arnumber=7138840 EMRP A169: Call 2011 SI Broader Scope IEEE Denver, CO 12-16 April 2015 30 978-1-4799-8865-5 10.1109/FCS.2015.7138840 59 No, EURAMET is never allowed to make the publication publicly available. S.-C.Ebenhag M.Zelan P. O.Hedekvist M.Karlsson B.Josefsson proceedings Proc SPIE 2015 9132 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices Scatterometry, CD, pitch, inverse diffraction problem EMRP A169: Call 2010 Industry Brussels, Belgium SPIE Optical Micro- and Nanometrology V April 14, 2014 30 10.1117/12.2052819 59 No, EURAMET is never allowed to make the publication publicly available. J.Endres N.Kumar P.Petrik M.-A.Henn S.Heidenreich S. F.Pereira H. P.Urbach B.Bodermann proceedings Proc SPIE 2015 9231 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices scatterometry, GISAXS, EUV-scatterometry, line structure EMRP A169: Call 2010 Industry Dresden, Germany 30th European Mask and Lithography Conference June 24, 2014 30 10.1117/12.2065941 59 No, EURAMET is never allowed to make the publication publicly available. F.Scholze B.Bodermann S.Burger J.Endres A.Haase M.Krumrey C.Laubis V.Soltwisch A.Ullrich J.Wernecke proceedings Proc SPIE 2015 9132 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices Scatterometry, CD metrology, traceability, reference standard, tool matching, AFM, SEM, rigorous modelling EMRP A169: Call 2010 Industry Brussels, Belgium SPIE Optical Micro- and Nanometrology V April 14, 2014 30 10.1117/12.2052278 59 No, EURAMET is never allowed to make the publication publicly available. B.Bodermann B.Loechel F.Scholze G.Dai J.Wernecke J.Endres J.Probst M.Schoengen M.Krumrey P.-E.Hansen V.Soltwisch article Metrologia 2015 52 2015 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies 433-443 watt balance, Planck’s constant, kilogram EMRP A169: Call 2011 SI Broader Scope IOP Publishing 30 10.1088/0026-1394/52/2/433 1 59 No, EURAMET is never allowed to make the publication publicly available. MatthieuThomas PatrickEspel DjamelZiane PatrickPinot PatrickJuncar FranckPereira Dos Santos SébastienMerlet FrançoisPiquemal GérardGenvès article International Journal of Quantum Information 2014 12 10 12 07n08 EXL02: SIQUTE: Single-photon sources for quantum technologies 1560011 Diamond; single-photon emitters; color centers. http://www.worldscientific.com/worldscinet/ijqi EMRP A169: Call 2012 Open excellence call worldscientific

Singapore

30 0219-7499 10.1142/S0219749915600114 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. D.Gatto Monticone J.Forneris M.Levi F.Picollo P.Olivero P.Traina E.E. Moreva E.Enrico G.Brida I. P.Degiovanni M.Genovese G.Amato L.Boarino article Meas. Sci. Technol. 2014 12 9 26 1 ENG01: GAS: Characterisation of Energy Gases 015102 in-situ validation, thermocouple, thermoelectric stability, noise thermometry http://iopscience.iop.org/article/10.1088/0957-0233/26/1/015102/meta EMRP A169: Call 2009 Energy IOP Publishing

Bristol

30 0957-0233 10.1088/0957-0233/26/1/015102 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31 FEdler PSeefeld article Measurement Science and Technology 2014 12 9 26 1 ENG01: GAS: Characterisation of Energy Gases 015101 thermocouple, reference function, Land–Jewell http://www.npl.co.uk/content/ConPublication/6429 EMRP A169: Call 2009 Energy IOP Publishing Ltd

Bristol

30 0957-0233 10.1088/0957-0233/26/1/015101 1 59 No option selected J.V.Pearce C.J.Elliott AGreenen Ddel Campo M.JMartin C.GIzquierdo PPavlasek PNemecek GFailleau TDeuzé MSadli GMachin article Journal of Physics 2014 12 4 568 3 SIB01: InK: Implementing the new kelvin 032012 http://iopscience.iop.org/article/10.1088/1742-6596/568/3/032012/pdf EMRP A169: Call 2011 SI Broader Scope IOP Science

Bristol

30 NA 10.1088/1742-6596/568/3/032012 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. AKirste MRegin JEngert DDrung TSchurig article VanermenGPSLGPFEBE2014 Analytical and Bioanalytical Chemistry 2014 12 407 11 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 3055-3067 Slurry, PBDE, PAH, TBT, Reference materials, Suspended particulate matter, Whole water, Water Framework Directive EMRP A169: Call 2010 Environment Springer Nature 30 1618-2642, 1618-2650 10.1007/s00216-014-8349-8 NA G.Vanermen H.Goenaga-Infante P.Petrov C.Swart B.Lalère F.Gantois R.Philipp I.Fettig S.Elordui-Zapatarietxe G.Boom H.Emteborg article Metrologia 2014 11 20 51 6 SIB57: NEWSTAR: New primary standards and traceability for radiometry 197-202 candela photometry radiometry http://iopscience.iop.org/journal/0026-1394 EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing

Bristol

30 0195-928X 10.1088/0026-1394/51/6/S276 1 59 No, EURAMET is never allowed to make the publication publicly available. T.Timo Dönsberg T.Tomi Pulli T.Tuomas Poikonen H.Hans Baumgartner A.Anna Vaskuri M.Meelis Sildoja F.Farshid Manoocheri P.Petri Kärhä E.Erkki Ikonen article TesaovaBGWERCTSJNMMN2014 Physical Review B 2014 10 23 90 15 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems Comparison of micromagnetic parameters of the ferromagnetic semiconductors (Ga,Mn)(As,P) and (Ga,Mn)As EMRP A169: Call 2012 Open excellence call American Physical Society (APS)

1 Research Rd, Ridge, NY 11961, USA

30 1098-0121, 1550-235X 10.1103/PhysRevB.90.155203 NA N.Tesařová D.Butkovičová B. L.Gallagher P.Wadley K. W.Edmonds A. W.Rushforth R. P.Campion F.Trojánek E.Schmoranzerová T.Jungwirth V.Novák P.Motloch P.Malý P.Němec proceedings NwabohBWSWE2014 Remote Sensing of Clouds and the Atmosphere XIX; and Optics in Atmospheric Propagation and Adaptive Systems XVII 2014 10 17 9242 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 92420D-1 92420D-14 spectral line parameters, infrared spectroscopy, Fourier transform spectroscopy, TDLAS, gas metrology EMRP A169: Call 2010 Environment SPIE Digital Library

Bellingham

Amsterdam Remote Sensing of Clouds and the Atmosphere XIX 22-09-2014 to 25-09-2014 30 10.1117/12.2067358 NA J.Nwaboh J.Brunzendorf O.Werhahn A.Serdyukov V.Werwein V.Ebert article CoenePRERPKU2014 Optics Express 2014 10 22 20 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 24678 sub-wavelength nano-positioning gratings coherent Fourier scatterometry EMRP A169: Call 2013 Energy II The Optical Society 30 1094-4087 10.1364/OE.22.024678 NA W.M.J.Coene S.F.Pereira S.Roy O.El Gawhary G.K.P.Ramanandan P.Petrik N.Kumar H.P.Urbach article Journal of Quantitative Spectroscopy and Radiative Transfer. 2014 10 146 Electromagnetic and Light Scattering by Nonspherical Particles XIV ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate 376-390 Bidirectional reflectance, BRF, Spectrum, Polarisation, Calibration http://www.sciencedirect.com/science/article/pii/S0022407314001666 EMRP A169: Call 2010 Environment Elsevier 30 0022-4073 10.1016/j.jqsrt.2014.04.011 1 59 No, EURAMET is never allowed to make the publication publicly available. JIPPeltoniemi THHakala JSSuomalainen EHHonkavaara LMMarkelin MGGritsevich JEEskelinen PJJaanson EIIkonen article EbertNW2014 Molecular Physics 2014 9 17 112 18 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 2451-2461 spectroscopy, water, line data, metrology, uncertainties EMRP A169: Call 2010 Environment Informa UK Limited

New York, USA

30 0026-8976, 1362-3028 10.1080/00268976.2014.916823 NA VolkerEbert Javis AnyangweNwaboh OlavWerhahn article ChoiRDYKSPLRNGECLSELS2014 Optics Express 2014 9 15 22 19 IND06: MIQC: Metrology for Industrial Quantum Communications 23121-23128 http://www.opticsinfobase.org/oe/home.cfm A169 EMRP A169: Call 2010 Industry English 1094-4087 10.1364/OE.22.023121 1 59 NA IrisChoi YuRong Zhou James F.Dynes ZhiliangYuan AndreasKlar AndrewSharpe AlanPlews MarcoLucamarini ChristianRadig JörgNeubert HelmutGriesser MichaelEiselt ChristopherChunnilall GuillaumeLepert AlastairSinclair Jörg-PeterElbers AndrewLord AndrewShields article WeberSHBDEHLMMS2014 IEEE Transactions on Instrumentation and Measurement 2014 9 63 9 ENG07: HVDC: Metrology for High Voltage Direct Current 2264-2270 Resistors, Voltage measurement, Capacitors, HVDC transmission, Uncertainty, Temperature measurement, Wideband EMRP A169: Call 2009 Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2014.2304857 NA C.Weber E.P.Suomalainen J.Hällström A.Bergman S.Dedeoğlu A.P.Elg E.Houtzager W.Lucas A.Merev J.Meisner M.Schmidt article BodnarE2014 Metrologia 2014 8 19 51 5 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 516-521 Birge ratio, modified Birge adjustment, Bayesian inference, general location-scale model MAT http://iopscience.iop.org/0026-1394/51/5/516/pdf/0026-1394_51_5_516.pdf A169 EMRP A169: Call 2011 Metrology for New Technologies 1 Online ISSN: 1681-7575; Print ISSN: 0026-1394 10.1088/0026-1394/51/5/516 1 59 NA OlhaBodnar ClemensElster article FortmeierSWSOE2014 Optics Express 2014 8 22 18 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 21313-21325 Geometric optics : Mathematical methods (general), Interferometry, Metrology, Aspherics http://www.opticsinfobase.org/oe/abstract.cfm?uri=oe-22-18-21313 A169 EMRP A169: Call 2010 Industry English 1 59 NA I.Fortmeier M.Stavridis A.Wiegmann M.Schulz W.Osten C.Elster proceedings MeesonPPGLMKLZLKEKMA2014 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 2014 8 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 324-325 Cryoelectronics, electromagnetic shielding, microwave photons, microwave sensors, microwave sources, nanoelectronics, single-electron devices, superconducting microwave devices, superconducting qubits EMRP A169: Call 2012 Open excellence call IEEE Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 24-08-2014 to 29-08-2014 30 10.1109/CPEM.2014.6898390 NA A.J.Manninen A.Kemppinen E.Enrico M.Kataoka T.Lindstrom A.B.Zorin S.V.Lotkhov M.Khabipov M.Möttönen R.E.Lake J.Govenius J.P.Pekola Yu.A.Pashkin P.J.Meeson O.V.Astafiev proceedings SuomalainenMHBDEHLKLMNSW2014 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 2014 8 ENG07: HVDC: Metrology for High Voltage Direct Current HVDC transmission, Voltage measurement, Calibration, Uncertainty, Capacitance, Resistors, Accuracy EMRP A169: Call 2009 Energy IEEE Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 24-08-2014 to 29-08-2014 30 10.1109/CPEM.2014.6898619 NA E.P.Suomalainen J.Meisner J.Hällström A.Bergman S.Dedeoğlu A.P.Elg E.Houtzager T.Lehtonen J.Klüss W.Lucas A.Merev T.Nieminen M.Schmidt C.Weber proceedings BergmanNKHE2014 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 2014 8 ENG07: HVDC: Metrology for High Voltage Direct Current Resistors, HVDC transmission, Calibration, Voltage measurement, Measurement uncertainty, Uncertainty, Resistance EMRP A169: Call 2009 Energy IEEE Rio de Janeiro, Brazil 9th Conference on Precision Electromagnetic Measurements (CPEM 2014) 24-08-2014 to 29-08-2014 30 10.1109/CPEM.2014.6898618 NA A.Bergman T.Nieminen M.Kharezy J.Hällström A.P.Elg article NevasBEPKEG2014 UV News: Newsletter of the Thematic Network for Ultraviolet Measurements 2014 7 10 ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation 9-11 Solar measurements, array spectroradiometer, linearity, characterisation http://metrology.tkk.fi/uvnet/reports.htm A169 EMRP A169: Call 2010 Environment English 1456-2537 1 59 NA SauliusNevas PeterBlattner OmarEl Gawhary TomiPulli PetriKärhä LucaEgli JulianGröbner article NevasGEB2014 Applied Optics 2014 6 30 53 19 ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation 4313 to 4319 Solar measurements, array spectroradiometers, stray light, correction. http://www.opticsinfobase.org/ao/abstract.cfm?uri=ao-53-19-4313 A169 EMRP A169: Call 2010 Environment English 10.1364/AO.53.004313 1 59 NA SauliusNevas JulianGröbner LucaEgli MarioBlumthaler article ElHayekNAGD2014 Precision Engineering 2014 6 19 38 4 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 13 Aspherical surface fitting, Form metrology, Large data, Limited memory BFGS. A169 EMRP A169: Call 2010 Industry 10.1016/j.precisioneng.2014.06.004 1 59 NA NEl-Hayek HNouira NAnwer OGibaru MDamak article Journal of Materials Chemistry C 2014 6 7 2 32 NEW01: TReND: Traceable characterisation of nanostructured devices 6655-6664 http://pubs.rsc.org/en/Content/ArticleLanding/2014/TC/c4tc00756e#!divAbstract EMRP A169: Call 2011 Metrology for New Technologies Royal Society of Chemistry

London UK

30 0003-2654 10.1039/c4tc00756e 1 59 No option selected M.Perego F.F.Lupi M.Ceresoli T.J.Giammaria G.Seguini E.Enrico L.Boarino D.Antoniol V.Gianotti K.Sparnacci M.Laus article Metrologia 2014 5 28 51 3 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 1-22 Traceability, dynamic measurement, pressure sensor calibration, shock tube, drop-weight system http://iopscience.iop.org/article/10.1088/0026-1394/51/3/326/meta EMRP A169: Call 2010 Industry IOP Publishing Ltd

Bristol

30 0026-1394 10.1088/0026-1394/51/3/326 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CMMatthews FPPennecchi SEEichstadt AMMalengo TEEsward ISSmith CEElster AKKnott FAArrhén ALLakka article Int. J. Thermophysic, 2014 2014 5 17 35 3 SIB01: InK: Implementing the new kelvin 405-416 Kelvin mise en pratique of the definition of the kelvin MeP-K Primary thermometry Redefinition of the kelvin Temperature scales http://link.springer.com/article/10.1007%2Fs10765-014-1606-4 http://www.npl.co.uk/content/ConPublication/6263 EMRP A169: Call 2011 SI Broader Scope Springer Link

Europe/Asia/Africa

30 10.1007/s10765-014-1606-4 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. NPL Doc. Ref:PDB: 7184 | DDB: 5950 GMachin JEngert RGavioso MSadli EWooliams article Journal of Optics 2014 5 8 16 6 IND07: Thin Films: Metrology for the manufacturing of thin films ellipsometry, thin films, large area http://iopscience.iop.org/article/10.1088/2040-8978/16/6/065701/meta EMRP A169: Call 2010 Industry IOP Publishing Ltd 30 2040-8978 10.1088/2040-8978/16/6/065701 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. RKKoops PSSonin MVVeghel OEGEl Gawhary article Metrologia 2014 5 1 51 3 SIB57: NEWSTAR: New primary standards and traceability for radiometry 197-202 Absolute radiometry http://iopscience.iop.org/journal/0026-1394 EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing

Bristol

30 0026-1394 10.1088/0026-1394/51/3/197 1 59 No, EURAMET is never allowed to make the publication publicly available. T.Timo Dönsberg1,2, F.Meelis Sildoja2, M.Farshid Manoocheri1,2, M.Mikko Merimaa1, E.Leo Petroff3 L.Erkki Ikonen1,2 article ElHayekNADG2014 International Journal of Precision Engineering and Manufacturing 2014 5 15 5 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 821 to 829 Aspherical surface, chromatic confocal probe, form metrology, L-BFGS method, profilometer, tactile probe http://link.springer.com/article/10.1007/s12541-014-0405-y A169 EMRP A169: Call 2010 Industry English 2005-4602 10.1007/s12541-014-0405-y 1 59 NA NadimEl-Hayek HichemNouira NabilAnwer MohamedDamak OlivierGibaru article ElHayekNDGA2014 Journal of Physics: Conference Series 483 (2014) 012003 2014 4 7 483 IND10: Form metrology: Optical and tactile metrology for absolute form characterization http://iopscience.iop.org/1742-6596/483/1/012003 A169 EMRP A169: Call 2010 Industry English Online ISSN: 1742-6596 10.1088/1742-6596/483/1/012003 1 59 NA NEl-Hayek HNouira MDamak OGibaru NAnwer article Metrologia 2014 4 51 2 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies S88-S95 kilogram, International System of units SI, watt balance, guiding system, flexure mechanical ele-ments. http://iopscience.iop.org/article/10.1088/0026-1394/51/2/S88/meta EMRP A169: Call 2011 SI Broader Scope IOP

Bristol BS1 6HG

30 0026-1394 10.1088/0026-1394/51/2/S88 1 59 No, EURAMET is never allowed to make the publication publicly available. FCosandier AEichenberger HBaumann BJeckelmann BBonny VChatagny RClavel proceedings Proceedings 9th International DAAAM Baltic Conference - Industrial Engineering 2014 4 IND62: TIM: Traceable in-process dimensional measurement 232-237 metrology, roll, roundness, calibration http://innomet.ttu.ee/daaam14/proceedings/Mechatronics%20and%20System%20Engineering/Hemming.pdf EMRP A169: Call 2012 Metrology for Industry (II) Tallinn, Estronia 9th International DAAAM Baltic Conference - Industrial Engineering 24-04-2014 to 26-04-2014 30 978-9949-23-620-6 2346-612X (print), 2346-6138 (online) 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. B.Hemming T.Widmaier I.Palosuo V.-P.Esala P.Laukkanen L.Lillepea K.Simson D.Brabandt J.Haikio article Journal of Physics: Conference Series 2014 3 11 490 - NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 012007 scatterometry, photomask geometry, surrogate model, polynomial chaos MAT http://iopscience.iop.org/article/10.1088/1742-6596/490/1/012007/pdf EMRP A169: Call 2011 Metrology for New Technologies IOPScience

Bristol & Philadelphia

30 - 10.1088/1742-6596/490/1/012007 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SHeidenreich HGross M-AHenn CElster MBär article NouiraSEDDA2014 Measurement Science and Technology 2014 3 5 25 IND10: Form metrology: Optical and tactile metrology for absolute form characterization profilometer, atomic force microscopy, confocal chromatic probe, tactile/inductive probe, error sources, dimensional and mechanical metrology, evaluation http://iopscience.iop.org/0957-0233/25/4/044011/article?fromSearchPage=true A169 EMRP A169: Call 2010 Industry English Online ISSN: 1742-6596 10.1088/0957-0233/25/4/044011 1 59 NA HNouira J-ASalgado NEl-Hayek SDucourtieux ADelvallée NAnwer article Measurement Science and Technology 2014 3 5 25 4 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices scatterometry, nanometrology, linewidth, critical dimension, grating http://iopscience.iop.org/0957-0233/25/4/044004/ EMRP A169: Call 2010 Industry 30 10.1088/0957-0233/25/4/044004 59 No, EURAMET is never allowed to make the publication publicly available. J.Endres A.Diener M.Wurm B.Bodermann article Measurement Science and Technology 2014 3 5 25 4 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 044003 (9pp) Scatterometry, metrology, EUV-lithography MAT http://iopscience.iop.org/article/10.1088/0957-0233/25/4/044003/meta EMRP A169: Call 2011 Metrology for New Technologies IOPScience

Bristol & Philadelphia

30 - 10.1088/0957-0233/25/4/044003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M-AHenn HGross SHeidenreich FScholze CElster MBär article Measurement Science and Technology 2014 3 25 5 SIB58: Angles: Angle metrology angle encoder, rotary encoder, angle measurement, angle standard, calibration EMRP A169: Call 2012 SI Broader scope (II) 30 10.1088/0957-0233/25/5/055003 59 No, EURAMET is never allowed to make the publication publicly available. R DGeckeler ALink MKrause CElster article Int. J. Thermophys. 2014 2 27 35 3-4 IND01: HiTeMS: High temperature metrology for industrial applications (>1000 °C) 547-559 Fixed points · High-temperature fixed points · Reference function · Thermocouples http://download.springer.com/static/pdf/172/art%253A10.1007%252Fs10765-014-1567-7.pdf?originUrl=http%3A%2F%2Flink.springer.com%2Farticle%2F10.1007%2Fs10765-014-1567-7&token2=exp=1442936025~acl=%2Fstatic%2Fpdf%2F172%2Fart%25253A10.1007%25252Fs10765-014-156 EMRP A169: Call 2010 Industry Springer

New York

30 0195-928X 10.1007/s10765-014-1567-7 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31 J.V.Pearce C.J.Elliott D.H.Lowe GFailleau TDeuzé FBourson MSadli GMachin article Physical Review A 2014 2 19 89 2 IND07: Thin Films: Metrology for the manufacturing of thin films 1-8 http://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.023834 EMRP A169: Call 2010 Industry American Physical Society (APS)

Maryland

30 1050-2947 10.1103/PhysRevA.89.023834 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. OEGEl Gawhary AAAdam HPUUrbach article HertzbergCFEBW2014 IEEE Transactions on Power Delivery 2014 2 29 1 ENG07: HVDC: Metrology for High Voltage Direct Current 472-479 Harmonic analysis, Power system harmonics, HVDC transmission, Current measurement, Voltage measurement, Switches, Impedance EMRP A169: Call 2009 Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0885-8977, 1937-4208 10.1109/TPWRD.2013.2276408 NA K.Hertzberg P.Clarkson M.Flood A.P.Elg A.Bergman P.S.Wright article Journal of Materials Chemistry C 2014 1 4 2014 2 SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology 2175–2182 www.rsc.org/MaterialsC EMRP A169: Call 2012 SI Broader scope (II) The Royal Society of Chemistry 30 10.1039/c3tc32283a 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Lupi T.Giammaria G.Seguini M.Laus E.Enrico N.De Leo L.Boarino C.Ober M.Perego proceedings KohlmannMKSEWB2014 CPEM 2014 Digest 2014 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 466 - 467 AC Josephson voltage standards NbSi barrier Josephson junctions SNS Josephson junctions binary-divided Josephson series arrays pulse-driven Josephson series arrays http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250 A169 EMRP A169: Call 2012 SI Broader scope (II) Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements 24 - 29 August 2014 English 0589-1485 10.1109/CPEM.2014.6898461 1 59 NA J.Kohlmann F.Müller O.Kieler T.Scheller B.Egeling R.Wendisch R.Behr article MonteGAKEOH2014 Atmos. Meas. Tech 2014 7 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate Radiation Thermometry, Radiance, Remote Sensing, Vacuum, Emissivity http://www.atmos-meas-tech.net/7/13/2014/amt-7-13-2014.html A169 EMRP A169: Call 2010 Environment English 10.5194/amt-7-13-2014 1 59 NA C.Monte B.Gutschwager A.Adibekyan M.Kehrt A.Ebersoldt F.Olschewski J.Hollandt proceedings EndresBDWHGSD2014 Fringe 2013 - 7th International Workshop on Advanced Optical Imaging and Metrology 2014 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices 695-700 http://link.springer.com/chapter/10.1007%2F978-3-642-36359-7_128#page-1 EMRP A169: Call 2010 Industry Nürtingen, Germany FRINGE 2013 8 - 11 September 2013 English 978-3-642-36358-0 10.1007/978-3-642-36359-7_128 1 59 NA J.Endres B.Bodermann G.Dai M.Wurm M.-A.Henn H.Gross F.Scholze A.Diener proceedings BergstenETR2014 CPEM 2014 Digest 2014 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 518 to 519 Active filters, low pass filters, analog circuits, harmonic distortion, Josephson voltage standards http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250 A169 EMRP A169: Call 2012 SI Broader scope (II) Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements 24 to 29 August 2014 0589-1485 10.1109/CPEM.2014.6898487 1 59 NA TobiasBergsten GunnarEklund ValterTarasso Karl-ErikRydler proceedings EklundBTR2014 CPEM 2014 Digest 2014 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 224 - 225 Josephson voltage standard, Josephson array,voltage measurement, impedance bridge. http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6898340 A169 EMRP A169: Call 2012 SI Broader scope (II) Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements 24 - 29 August 2014 English 0589-1485 10.1109/CPEM.2014.6898340 1 59 NA GunnarEklund TobiasBergsten ValterTarasso Karl-ErikRydler article ElliottFDSPM2014 International Journal of Thermophysics 2014 35 3 to 4 ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants 560 to 573 Fixed-point; High-temperature; MetroFission; Self-validation; Thermocouple. http://link.springer.com/article/10.1007%2Fs10765-014-1597-1 A169 EMRP A169: Call 2009 Energy English 1 59 NA C. JElliott GFailleau TDeuzé MSadli J. VPearce GMachin proceedings KohlmannBKDSSTGMJONLIWLVBECHvO2014 CPEM 2014 Digest 2014 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 522 - 523 AC Josephson voltage standards European Metrology Research Programme (EMRP) binary-divided Josephson series arrays pulse-driven Josephson series arrays http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=6892250 A169 EMRP A169: Call 2012 SI Broader scope (II) Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements 24 - 29 August 2014 English 0589-1485 10.1109/CPEM.2014.6898489 1 59 NA J.Kohlmann R.Behr O.Kieler J.Diaz de Aguilar Rois M.Sira A.Sosso B.Trinchera J.Gran H.Malmbekk B.Jeanneret F.Overney J.Nissilä T.Lehtonen J.Ireland J.Williams R.Lapuh B.Voljc T.Bergsten G.Eklund T.Coskun Ozturk E.Houtzager H.E.van den Brom P.Ohlckers proceedings PalafoxRKOCGZNELGFKR2014 Digest 2014 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity http://cfmetrologie.edpsciences.org/articles/metrology/abs/2013/01/metrology_metr2013_11001/metrology_metr2013_11001.html A169 EMRP A169: Call 2012 SI Broader scope (II) Paris, France 16th International Congress of Metrology 7-10 October 2013 English 10.1051/metrology/201311001 1 59 NA L.Palafox F.Raso J.Kucera F.Overney L.Callegaro P.Gournay A.Ziołek J.Nissilä G.Eklund T.Lippert Y.Gülmez P.Fleischmann M.Kampik R.Rybski article ThomasEBGBPJP2014 Metrologia 2014 51 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies S54, S64 watt balance, alignment, LNE A169 EMRP A169: Call 2011 SI Broader Scope English 10.1088/0026-1394/51/2/S54 1 59 NA MatthieuThomas PatrickEspel YvesBriand GérardGenevès FranckBielsa PatrickPinot PatrickJuncar FrançoisPiquemal proceedings GulmezGKEHG2014 URSI-TÜRKİYE’2014 VII. Bilimsel Kongresi, 28-30 Ağustos 2014, ELAZIĞ 2014 SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity 436-438 http://www.ursi.org.tr/2014-Kongre/bildiriler/TAM_155.pdf A169 EMRP A169: Call 2012 SI Broader scope (II) Elazığ TURKEY URSI-TÜRKİYE’2014 VII. Bilimsel Kongresi, 28-30 Ağustos 28 - 30 August 2014 1 59 NA http://web.firat.edu.tr/ursi/download/URSI_TUM_KITAP_PAGE.pdf G.Gülmez YGülmez H.Karacadağ Ö.Erkan C.Hayırlı N.Galiç article ZhiSFULE2014 Nanotechnology and Precision Engineering 2014 3 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects 182-188 nano-objects, nano-pillar, nanoscale material testing, nanoindentation technique, size effect http://caod.oriprobe.com/issues/1510064/toc.htm A169 EMRP A169: Call 2011 Metrology for New Technologies English 10.13494/j.npe.20130018 1 59 NA LiZhi GaoSai PohlenzFrank BrandUwe KoendersLudger PeinerErwin proceedings Lecture Notes in Engineering and Computer Science: Proceedings of the World Congress on Engineering and Computer Science 2014 2014 2 IND52: XD Reflect: Multidimensional reflectometry for industry 785-790 BRDF, computer graphics, metrology, data analysis, statistics of manifolds. http://www.iaeng.org/publication/WCECS2014/WCECS2014_pp785-790.pdf EMRP A169: Call 2012 Metrology for Industry (II) International Association of Engineers

Hong Kong

San Francisco, USA The World Congress on Engineering and Computer Science 2014 February 2014 30 978-988-19252-0-6 1 59 No, EURAMET is never allowed to make the publication publicly available. Mikhail A.Langovoy GerdWübbeler ClemensElster article WitzelNEPW2014 International Journal of Spectroscopy 2014 132607 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 1-9 optical path length, gas cell, laser absorption spectroscopy, Fourier transform spectroscopy EMRP A169: Call 2010 Environment Hindawi Publishing Corporation

3rd Floor Adam House, 1 Fitzroy Square, London ,W1T 5HE, United Kingdom

30 1687-9449, 1687-9457 10.1155/2014/132607 NA OliverWitzel Javis AnyangweNwaboh VolkerEbert AndreaPogány OlavWerhahn article International Journal of Thermophysics 2014 35 6-7 SIB01: InK: Implementing the new kelvin 971-984 Acoustic gas thermometry, microwave resonators, thermal expansivity. EMRP A169: Call 2011 SI Broader Scope Springer

unknown

30 0195-928X 10.1007/s10765-014-1726-x 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. R JUnderwood G JEdwards article Measurement Science Review 2014 14 2 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 52-61 linear mixed models, uncertainty, GUM, ANOVA, random effects EMRP A169: Call 2010 Industry De Gruyter 30 10.2478/msr-2014-0009 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BArendacká ATäubner SEichstädt ThBruns CElster proceedings 2014 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities dynamic calibration, torque, force, pressure, modelling www.imeko.org/publications/tc22-2014/IMEKO-TC3-TC22-2014-007.pdf EMRP A169: Call 2010 Industry International Measurement Conferderation

Budapest

Cape Town, Republic of South Africa Joint IMEKO Conference TC3, TC5 & TC22 03-02-2014 to 05-02-2014 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. C.Bartoli M.Beug Th.Bruns S.Eichstädt T.Esward L.Klaus A.Knott M.Kobusch C.Schlegel proceedings Proceedings of the 58th Ilmenau Scientific Colloquium 2014 IND62: TIM: Traceable in-process dimensional measurement Material standard, roundness, paper machine roll, steel mill roll, measurement uncertainty https://www.db-thueringen.de/receive/dbt_mods_00025013 http://nbn-resolving.de/urn:nbn:de:gbv:ilm1-2014iwk-136:5 EMRP A169: Call 2012 Metrology for Industry (II) TU Ilmenau

Ilmenau

Ilmenau, Germany 58th Ilmenau Scientific Colloquium 08-09-2014 to 12-09-2014 30 Online PPN: 802503594 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://nbn-resolving.de/urn:nbn:de:gbv:ilm1-2014iwk-136:5 T.Widmaier P.Kuosmanen V.-P.Esala D.Brabandt J.Haiko article Phys. Rev. A 2013 11 19 88 5 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 053624 67.85.Fg, 03.75.Lm, 03.75.Mn, 11.30.Qc http://arxiv.org/abs/1309.0424 EMRP A169: Call 2012 Open excellence call American Physical Society

College Park, MD

30 1094-1622 10.1103/PhysRevA.88.053624 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MScherer BLücke JPeise OTopic GGebreyesus FDeuretzbacher WErtmer LSantos CKlempt J JArlt article OlschewskiEFGHKMPPRSK2013 Atmospheric Measurement Techniques (AMT) 2013 11 6 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate http://www.atmos-meas-tech.net/6/3067/2013/amt-6-3067-2013.html EMRP A169: Call 2010 Environment English 10.5194/amt-6-3067-2013 1 59 NA F.Olschewski A.Ebersoldt F.Friedl-Vallon B.Gutschwager J.Hollandt A.Kleinert C.Monte C.Piesch P.Preusse C.Rolf P.Steffens R.Koppmann article OttEWP2013 Journal of Quantitative Spectroscopy and Radiative Transfer 2013 11 130 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 147-157 tunable diode laser absorption spectroscopy, carbon dioxide, line strength, gas metrology EMRP A169: Call 2010 Environment Elsevier BV

New York, USA

30 0022-4073 10.1016/j.jqsrt.2013.07.011 NA OliverOtt VolkerEbert OlavWerhahn AndreaPogány proceedings 16th International Congress of Metrology 2013 10 7 04010 2013 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation - - MAT http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_04010.pdf EMRP A169: Call 2011 Metrology for New Technologies EDP Sciences

Les Ulis & London

Paris 16th International Congress of Metrology 07-10-2013 to 10-10-2013 30 - - 10.1051/metrology/201304010 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MBär CElster SHeidenreich CMatthews L RPendrill LWright proceedings 16th International Congress of Metrology 2013 10 7 - 2013 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 04003 - MAT http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_04003.pdf EMRP A169: Call 2011 Metrology for New Technologies EDP Sciences

Les Ulis & London

Paris 16th International Congress of Metrology 07-10-2013 to 10-10-2013 30 - - 10.1051/metrology/201304003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CElster KKlauenberg MBär AAllard NFischer GKok Avan der Veen PHarris MCox ISmith SCowen PWilson SEllison article WubbelerE2013 Measurement Science and Technology 2013 10 1 41 11 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation measurement uncertainty, magnetic field fluctuation thermometry, Bayesian inference, GUM MAT http://iopscience.iop.org/0957-0233/24/11/115004/ A169 EMRP A169: Call 2011 Metrology for New Technologies 1 0957-0233 10.1088/0957-0233/24/11/115004 1 59 NA GWübbeler CElster article AIP Conf. Proc. 1552 2013 9 11 8 958 ENG01: GAS: Characterisation of Energy Gases 958-963 Industrial high temperature measurement, radiation thermometry, high temperature thermocouples, high temperature fixed points http://www.npl.co.uk/content/ConPublication/5950 EMRP A169: Call 2009 Energy AIP Publishing LLC

1305 Walt Whitman Rd Suite 300, Melville, NY 11747, United States

30 978-0-7354-1178-4 10.1063/1.4821414 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31 GMachin KAnhalt FEdler JPearce MSadli RStrnad EVeulban article GeorgJCESPBHVA2013 Radiotherapy and Oncology 2013 7 108 1 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 99-106 Alanine; Audit; Carbon ions; Dosimetry; Protons EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 0167-8140 10.1016/j.radonc.2013.04.029 NA D.Georg O.Jäkel N.Chaudhri S.Ecker P.Sharpe H.Palmans N.Bassler R.Herrmann S.Vatnitsky A.Ableitinger proceedings EndresBWB2013 Modeling Aspects in Optical Metrology IV 2013 5 13 8789 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1687350 EMRP A169: Call 2010 Industry Munich, Germany SPIE Modelling Aspects in Optical Metrology (World of Photonics Congress) 13.05. - 16.05.2013 978-0-8194-9605-8 10.1117/12.2022108 1 59 NA J.Endres S.Burger M.Wurm B.Bodermann proceedings WerweinEB Spectral reference line data for atmospheric monitoring : proceedings of the EUMETRISPEC workshop held at Wolfenbüttel castle and PTB Braunschweig 2013 5 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring infrared spectroscopy, Fourier transform spectroscopy, high-resolution spectroscopy, spectral line Parameters, gas metrology https://public.ptb.de/resource/210.20140408Y EMRP A169: Call 2010 Environment Physikalisch-Technische Bundesanstalt

Braunschweig, Germany

30 978-3-9560603-4-2 10.7795/210.20140408Y NA ViktorWerwein VolkerEbert JensBrunzendorf proceedings 2013 5 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 39-42 random effects, ANOVA, type A uncertainty http://www.measurement.sk/M2013/doc/proceedings/039_Arendacka-1.pdf EMRP A169: Call 2010 Industry Institute of Measurement Science

Bratislava

Smolenice, Slovakia 9th International Conference on Measurement 27-05-2013 to 30-05-2013 30 978-80-969-672-5-4 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BArendacká A.Täubner S.Eichstädt T.Bruns C.Elster article ErmelMKK2013 Instrumentation and Measurement, IEEE Transactions on 2013 62 9 ENG07: HVDC: Metrology for High Voltage Direct Current Measurement; IGBT; converters; voltage transients; discriminator http://www.researchgate.net/publication/260304197_Adaptive_Acquisition_of_Power_IGBT_Transients_With_Discrimination_Circuit A169 EMRP A169: Call 2009 Energy English 10.1109/tim.2013.2272395 1 59 NA V.Ermel J.Meisner M.Kurrat M.Kahmann proceedings SchulzEK2013 Nuclear Instruments and Methods in Physics Research A 2013 710 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 37-41 EMRP A169: Call 2010 Industry Elsevier

Amsterdam, Netherlands

Barcelona, Spain 4th International Workshop on Metrology for X-ray Optics, Mirror Design and Fabrication 4 - 6 July 2012 English 0168-9002 10.1016/j.nima.2012.10.112 1 59 NA M.Schulz G.Ehret P.Kren article NwabohWOSE2013 Measurement Science and Technology 2013 24 T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection 015202 (12pp) iMERA-Plus: Call 2007 Health English 10.1088/0957-0233/24/1/015202 1 59 NA J.Nwaboh O.Werhahn P.Ortwein D.Schiel V.Ebert proceedings EhretSBF2013 Journal of Physics: Conference Series: (2013) 2013 IND10: Form metrology: Optical and tactile metrology for absolute form characterization http://iopscience.iop.org/1742-6596/425/15/152016/pdf/1742-6596_425_15_152016.pdf EMRP A169: Call 2010 Industry IOP Lyon, France 11th International Conference on Synchrotron Radiation Instrumentation (SRI 2012) 09 - 13 July 2012 English ISSN 1742-6596 1 59 NA G.Ehret M.Schulz M.Baier A.Fitzenreiter article BaumannEJCCRT2013 Metrologia 2013 50 3 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies Kilogram, Planck constant, International System of Units SI, watt balance EMRP A169: Call 2011 SI Broader Scope English 10.1088/0026-1394/50/3/235 1 59 NA H.Baumann A.Eichenberger B.Jeckelmann F.Cosandier R.Clavel D.Reber D.Tommasini proceedings KoppmannOSRPEFKPHGM2012 AIP Conference Proceedings 2013 1531 322 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate GLORIA, Remote sensing, Blackbody, Calibration, Infrared, Limb sounder, Thermoelectric cooler, ITS-90 EMRP A169: Call 2010 Environment AIP Berlin, Germany Radiation Processes in the Atmosphere and Ocean (IRS2012) 6 - 10 August 2012 English 10.1063/1.4804774 1 59 NA R.Koppmann F.Olschewski P.Steffens C.Rolf P.Preusse A.Ebersoldt F.Friedl-Vallon A.Kleinert C.Piesch J.Hollandt B.Gutschwager C.Monte proceedings WerhahnPNWE2013 Proceeding of SPIE – Remote Sensing of Clouds and the Atmosphere XVIII; and Optics in Atmospheric Propagation and Adaptive Systems XVI 2013 8890 ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring 889007-1 889007-16 spectral line parameters, infrared spectroscopy, Fourier-transform spectroscopy, TDLAS, gas metrology EMRP A169: Call 2010 Environment SPIE Digital Library

Bellingham

Dresden, Germany Remote Sensing of Clouds and the Atmosphere XVIII 23 - 26 September 2013 English 10.1117/12.2028761 1 59 NA O.Werhahn A.Pogány J.Nwaboh V.Werwein V.Ebert proceedings PorrovecchioSGRPNE2013 AIP Conference Proceedings 2013 1531 837 ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation Solar radiation, UV scanning spectroradiometers. http://proceedings.aip.org/resource/2/apcpcs/1531/1/837_1?bypassSSO=1 EMRP A169: Call 2010 Environment Berlin, Germany International Radiation Symposium 2012: Radiation Processes in the Atmosphere and Ocean 6 - 10 August 2012 0094-243X 10.1063/1.4804900 1 59 NA G.Porrovecchio M.Smid J.Gröbner M.Rajteri C.Portesi K.Nield L.Egli article EgliGB2013 UV News: Newsletter of the Thematic Network for Ultraviolet Measurements 2013 9 ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation http://metrology.tkk.fi/uvnet/reports.htm EMRP A169: Call 2010 Environment English 1 59 NA L.Egli J.Gröbner M.Blumenthaler article NevasGE2013 UV News: Newsletter of the Thematic Network for Ultraviolet Measurements 2013 9 ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation http://metrology.tkk.fi/uvnet/reports.htm EMRP A169: Call 2010 Environment English 1 59 NA S.Nevas J.Gröbner L.Egli article KumarERPU2013 Journal of the European Optical Society Rapid Publications 2013 8 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices Fourier scatterometry A169 EMRP A169: Call 2010 Industry 30 10.2971/jeos.2013.13048 1 1 59 NA N.Kumar O.El Gawhary S.Roy S.Pereira H.Urbach proceedings MerloneLABBBdDDEGGHHJKKMMMdSSSSSV2013 AIP Conference Proceedings 2013 8 1552 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 1030-1035 air humidity, air pressure, air temperature, air speed and direction, historical temperature data series, meteorological instruments calibration, traceable climate measurements http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821419 EMRP A169: Call 2010 Environment Los Angeles (USA) 9th International Temperature Symposium 19-23 March 2012 10.1063/1.4821419 1 59 NA A.Merlone G.Lopardo I.Antonsen S.Bell RBenyon N.Boese D.del Campo M.Dobre J.Drnovsek A.Elkatmis E.Georgin E.Grudniewicz M.Heinonen C.Holstein-Rathlou J.Johansson P.Klason R.Knorova C.Melvad J.Merrison K.Migaa M.de Podesta H.Saathoff D.Smorgon F.Sparasci R.Strnad A.Szmyrka-Grzebyk E.Vuillermoz proceedings BlumthalerGEN2013 AIP Conf. Proc. 2013 1531 ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation Solar UV radiation, Array spectroradiometers, Stray light, Noise equivalent irradiance A169 EMRP A169: Call 2010 Environment Berlin IRS2012 6-10.8.2012 English 978-0-7354-1155-5 10.1063/1.4804892 1 59 NA MBlumthaler JGröbner LEgli SNevas article OliveiraPPRe2013 Medições e Ensaios, Maio 2013 2013 5 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry http://www.spmet.pt A169 EMRP A169: Call 2010 Industry Portuguese 2182-5424 1 59 NA CarlosOliveira LuisPortugal IsabelPaiva MárioReis Carlos Cruze Romão Trindade proceedings EPJ Web of Conferences 2013 77 00003 [open access] IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 1-8 dynamic measurement, uncertainty, Monte Carlo, digital filter, signal processing EMRP A169: Call 2010 Industry EDP Sciences

Les Ulis

Paris, France International Congress of Metrology 07-10-2013 to 10-10-2013 30 ISSN: 2100-014X 10.1051/epjconf/20147700003 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. https://cfmetrologie.edpsciences.org/index.php?option=com_toc&url=/articles/metrology/abs/2013/01/contents/contents.html S.Eichstädt B.Arendacká A.Link C.Elster proceedings BodermannHBHGBSEW2012 Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VI 2012 10 25 8466 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices Scatterometry, CD metrology, traceability, reference standard, tool matching, AFM, SEM, rigorous modelling http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1379467 EMRP A169: Call 2010 Industry San Diego, USA SPIE Optics & Photonics 2012 international meeting, conference: Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VI 12-16 August 2012 978-0-8194-9183-1 10.1117/12.929903 1 59 NA B.Bodermann P.-E.Hansen S.Burger M.-A.Henn H.Gross M.Bär F.Scholze J.Endres M.Wurm proceedings ErmelMKK2012_2 2012 IEEE International Workshop on Applied Measurements for Power Systems (AMPS 2012) 2012 9 28 ENG07: HVDC: Metrology for High Voltage Direct Current Measurement; IGBT; converters; voltage transients; discriminator A169 EMRP A169: Call 2009 Energy Aachen, Germany 2012 IEEE International Workshop on Applied Measurements for Power Systems (AMPS 2012) Sep. 26-28, 2012 English 1 59 NA V.Ermel J.Meisner M.Kurrat M.Kahmann article SieversBEGOSS2012_2 Small 2012 9 10 8 17 IND08: MetMags: Metrology for Advanced Industrial Magnetics 2675–2679 A169 EMRP A169: Call 2010 Industry English 10.1002/smll.201200420 1 59 NA S.Sievers K.-F.Braun D.Eberbeck S.Gustafsson E.Olsson H. W.Schumacher U.Siegner article EhretSSE2012 Measurement Science and Technology 2012 7 25 23 094007 IND10: Form metrology: Optical and tactile metrology for absolute form characterization EMRP A169: Call 2010 Industry English 10.1088/0957-0233/23/9/094007 1 59 NA G.Ehret M.Schulz M.Stavridis C.Elster article Journal of analytical atomic spectrometry 2012 5 30 27 9 HLT05: Metallomics: Metrology for metalloproteins 1474 - 1483 cisplatin–protein complexes, gel electrophoresis in biological samples, protein separation conditions https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/26562 EMRP A169: Call 2011 Metrology for Health Royal Society of Chemistry

Cambridge, United Kingdom

30 0267-9477 1364-5544 10.1039/c2ja30016h 1 No, EURAMET is never allowed to make the publication publicly available. EstefaniaMoreno-Gordaliza DiegoEsteban-Fernandez CharlotteGiesen KarolaLehmann AlbertoLazaro AlbertoTejedor ChristianScheler BenitoCanas NorbertJakubowski Michael W.Linscheid M. MilagrosGomez-Gomez article OPTICS EXPRESS 2012 5 23 20 12 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices 12771 - 12786 Diffraction gratings, Metrology https://www.osapublishing.org/oe/abstract.cfm?uri=oe-20-12-12771 EMRP A169: Call 2010 Industry 30 10.1364/OE.20.012771 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M.-A.Henn H.Gross F.Scholze M.Wurm C.Elster M.Baer proceedings HoutzagerRHEv2012 Proceedings of the Conference on Precision Electromagnetic Measurements 2012 2012 1 ENG07: HVDC: Metrology for High Voltage Direct Current HVDC, resistors, metrology, voltage coefficient, temperature coefficient, high-voltage techniques, resistance measurement EMRP A169: Call 2009 Energy IEEE Washington DC, USA CPEM 2012 01 - 06 July 2012 English 1 59 NA E.Houtzager G.Rietveldt J.Hällström A.-P.Elg J. H. N.van der Beek proceedings ElgKBH2012 Proceedings of the Conference on Precision Electromagnetic Measurements 2012 2012 ENG07: HVDC: Metrology for High Voltage Direct Current HVDC, dielectric, metrology, current measurement, high-voltage techniques EMRP A169: Call 2009 Energy IEEE Washington DC, USA CPEM 2012 01 - 06 July 2012 English 1 59 NA A.Elg M.Kharezy A.Bergman J.Hällström proceedings HallstromBDEHLMMSSW2012 Proceedings of the Conference on Precision Electromagnetic Measurements 2012 2012 ENG07: HVDC: Metrology for High Voltage Direct Current Measurement techniques, measurement uncertainty, voltage measurement, HVDC transmission, highvoltage techniques EMRP A169: Call 2009 Energy IEEE Washington DC, USA Language CPEM 2012 01 - 06 July 2012 English 1 59 NA J.Hällström A.Bergman S.Dedeoğlu A.Elg E.Houtzager W.Lucas A.Merev J.Meisner A.Sardi E.-P.Suomalainen C.Weber proceedings BartoliBBEKKKSS2012 Proceedings of the XX IMEKO World Congress : Metrology for Green Growth 2012 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities http://www.imeko.org/publications/wc-2012/IMEKO-WC-2012-TC21-O7.pdf EMRP A169: Call 2010 Industry Busan, Republic of Korea XX IMEKO World Congress : Metrology for Green Growth 9 - 14 September 2012 English 1 59 NA C.Bartoli M.Beug T.Bruns C.Elster L.Klaus A.Knott M.Kobusch S.Saxholm C.Schlegel article NevasWSET2012 Metrologia 2012 49 2 ENG05: Lighting: Metrology for Solid State Lighting http://iopscience.iop.org/0026-1394/49/2/S43 EMRP A169: Call 2009 Energy English ISSN 0026-1394 10.1088/0026-1394/49/2/S43 1 59 NA S.Nevas G.Wübbeler A.Sperling C.Elster A.Teuber proceedings EdlerL2012 Proceedings of the 9th European Conference on Thermoelectrics (AIP Conference Proceedings) 2012 ENG02: Harvesting: Metrology for Energy Harvesting 369-372 figure of merit, reference, material, Seebeck coefficient EMRP A169: Call 2009 Energy Thessaloniki, Greece 9th European Conference on Thermoelectrics (ETC2011) 28 - 30 September 2012 978-0-7354-1048-0; 1551-7616 (online) 0094-243X (print) 10.1063/1.4731573 59 NA F.Edler E.Lenz article LenzEHZP2012 Physica Status Solidi (c) 2012 9 12 ENG02: Harvesting: Metrology for Energy Harvesting 2432-2435 EMRP A169: Call 2009 Energy English 59 NA E.Lenz F.Edler S.Haupt P.Ziolkowski H.Pernau proceedings OlschewskiRSKPEMGHPFK2012 Proceedings of SPIE 8511 - Infrared Remote Sensing and Instrumentation XX, 85110I 2012 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate GLORIA, remote sensing, blackbody, calibration, infrared, limb sounder, thermoelectric cooler, ITS-90 http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1387106 EMRP A169: Call 2010 Environment San Diego, CA, United States SPIE 8511 Infrared Remote Sensing and Instrumentation XX 12 - 16 August 2012 English 10.1117/12.928194 1 59 NA F.Olschewski C.Rolf P.Steffens A.Kleinert C.Piesch A.Ebersoldt C.Monte B.Gutschwager J.Hollandt P.Preusse F.Friedl-Vallon R.Koppmann proceedings EgliGSPBNGDNT2012 AIP Conference Proceedings 2012 ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation http://proceedings.aip.org/resource/2/apcpcs/1531/1/825_1?ver=pdfcov&bypassSSO=1 EMRP A169: Call 2010 Environment Berlin, Germany International Radiation Symposium 2012: Radiation Processes in the Atmosphere and Ocean 6 - 10 August 2012 English 10.1063/1.4804897 1 59 NA L.Egli J.Gröbner M.Smid G.Porrovecchio T.Burnitt K.Nield S.Gibson J.Dubard S.Nevas M.Tormen article ElliottPFDBSM2012 Metrologia 2012 49 1 ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants http://iopscience.iop.org/0026-1394/49/1/013 A169 EMRP A169: Call 2009 Energy English 10.1088/0026-1394/49/1/013 1 59 NA CElliott JPearce GFailleau TDeuze SBriaudeau MSadli GMachin article IOP Metrologia 2012 499 3 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 401-410 dynamic measurement, digital filter, uncertainty, GUM, Monte Carlo EMRP A169: Call 2010 Industry IOP Publishing 30 10.1088/0026-1394/49/3/401 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2013-1-1 SEichstädt ALink PHarris CElster article International Journal of Metrology and Quality Engineering 2012 3 Int. J. Metrol. Qual. Eng. Volume 3, Number 3, 2012 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 127–135 (2012) Dynamic force, dynamic torque, dynamic pressure, traceability, measurement uncertainty http://www.metrology-journal.org/articles/ijmqe/abs/2012/03/ijmqe120020/ijmqe120020.html EMRP A169: Call 2010 Industry edp sciences

london

30 2107-6839 10.1051/ijmqe/2012020 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CBartoli FBeug TBruns CElster TEsward AKnott MKobusch SSaxholm CSchlegel proceedings MerevEHBDH2011 Proceedings II. ELEKTRİK TESİSAT ULUSAL KONGRESİ 2011 11 24 1 ENG07: HVDC: Metrology for High Voltage Direct Current 396-399 EMRP A169: Call 2009 Energy The Chamber of Turkish Electrical Engineers/Türkiye Elektrik Mühendisleri Odası Izmir, Turkey II. ELEKTRİK TESİSAT ULUSAL KONGRESİ 24 - 27 November 2011 Turkish 1 59 NA A.Merev A.Elg J.Hällström A.Bergman S.Dedeoğlu E.Houtzager proceedings BodermannBDBSKWKHKvYSEBS2011 AIP Conference Proceedings 2011 11 10 1395 319 (2011) IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices Scatterometry, CD metrology, AFM, reference standard, rigorous modelling, inverse diffraction problem EMRP A169: Call 2010 Industry American Institute of Physics Grenoble, France International Conference on Frontiers of Characterisation and Metrology for Nanoelectronics FCMN 2011 23-26 May 2011 30 10.1063/1.3657910 1 59 NA B.Bodermann E.Buhr H.-U.Danzebrink M.Bär F.Scholze M.Krumrey M.Wurm P.Klapetek P.-E.Hansen V.Korpelainen M.van Veghel A.Yacoot S.Siitonen O.El Gawhary S.Burger T.Saastamoinen article PearceDEM2011_2 Nuclear Engineering International 2011 11 ENG08: MetroFission: Metrology for New Generation Nuclear Power Plants http://www.neimagazine.com A169 EMRP A169: Call 2009 Energy English 1 59 NA JPearce MDe Podesta CElliott GMachin proceedings McCarthyBER2011 SPIE Proceedings of 23rd Annual Symposium of Electronic Imaging 2011 2 7864 78640K T3.J2.2: NIMTech: Metrology for New Industrial Measurement Technologies http://spiedigitallibrary.org/proceedings/resource/2/psisdg/7864/1/78640K_1?isAuthorized=no iMERA-Plus: Call 2007 Length San Francisco, CA, USA SPIE 23rd Annual Symposium of Electronic Imaging 23 - 27 January 2011 English 1 59 NA M.McCarthy S.Brown A.Evenden A.Robinson article EichenbergerGG2011 European Physical Journal Special Topics 2011 172 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram 363-383 No pdf available due to LNE copyright restrictions. iMERA-Plus: Call 2007 SI and Fundamental Metrology English 1 59 NA AliEichenberger GérardGenevès PierreGournay proceedings BielsaGEGJ2011 Proceedings 15th International Congress of Metrology 2011 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Paris 15th International Congress of Metrologyp 3 - 6 October 2011 French 1 59 NA F.Bielsa O.Gilbert A.Eichenberger G.Genevès P.Juncar proceedings GenevesBED2011 Proceedings 15th International Congress of Metrology 2011 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Paris 15th International Congress of Metrology 3 - 6 October 2011 French 1 59 NA G.Genevès F.Bielsa P.Espel J.David proceedings ElgHB2011 Proceedings of the 17th International Symposium on High Voltage Engineering ISH 2011 2011 ENG07: HVDC: Metrology for High Voltage Direct Current EMRP A169: Call 2009 Energy Hanover, Germany 17th International Symposium on High Voltage Engineering ISH 2011 22 - 26 August 2011 English 1 59 NA A.Elg J.Hällström A.Bergman proceedings ErmelMMBLKK2011 Proceedings of the 17th International Symposium on High Voltage Engineering ISH 2011 2011 ENG07: HVDC: Metrology for High Voltage Direct Current EMRP A169: Call 2009 Energy Hanover, Germany 17th International Symposium on High Voltage Engineering ISH 2011 22 - 26 August 2011 English 1 59 NA V.Ermel E.Mohns J.Meisner O.Binder W.Lucas M.Kahmann M.Kurrat proceedings BartoliBBEEKKS2011 Proceedings of the 15th International Metrology Congress 2011 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities EMRP A169: Call 2010 Industry Paris: Collège Français de Métrologie Paris, France 15th International Metrology Congress 3 - 6 October 2011 English 2-915416-11-7 1 59 NA C.Bartoli M.Beug T.Bruns C.Elster T.Esward A.Knott M.Kobusch C.Schlegel proceedings SchusterLEUS2011 Proceedings Lux Junior 2011: 10. Internationales Forum des lichttechnischen Nachwuchses 2011 ENG05: Lighting: Metrology for Solid State Lighting EMRP A169: Call 2009 Energy Doernfeld/Ilm, Germany Lux Junior 2011 - 10. Internationales Forum des lichttechnischen Nachwuchses 23 - 25 September 2011 German / English 1 59 NA M.Schuster D.Lindner M.Eltmann H.Ulrich A.Sperling proceedings KohlmannMKSEBODB2010 2010 Conference on Precision Electromagnetic Measurements digest 2010 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 56-57 iMERA-Plus: Call 2007 Electricity and Magnetism Daejeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13-18 June, 2010 English 1 59 NA J.Kohlmann F.Müller O.F.Kieler D.Schleußner B.Egeling R.Behr D.Olaya P.D.Dresselhaus S. P.Benz proceedings EichenbergerBJJ2010 Proceedings of the 2010 Conference on Precision Electromagnetic Measurements 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA A.Eichenberger H.Baumann B.Jeanneret B.Jeckelmann proceedings BielsaEGJG2010 Proceedings of the 2010 Conference on Precision Electromagnetic Measurements 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA F.Bielsa A.Eichenberger O.Gilbert P.Juncar G.Genevès proceedings BielsaEGJG2010_2 2010 Conference on Precision Electromagnetic Measurements (CPEM) 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA F.Bielsa A.Eichenberger O.Gilbert P.Juncar G.Genevès proceedings GenevesBEGJVDMPBP2010 2010 Conference on Precision Electromagnetic Measurements (CPEM) 2010 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram iMERA-Plus: Call 2007 SI and Fundamental Metrology Deajeon, Korea 2010 Conference on Precision Electromagnetic Measurements (CPEM) 13 - 18 June 2010 English 1 59 NA G.Genevès F.Bielsa A.Eichenberger O.Gilbert P.Juncar F.Villar G.D'Agostino S.Merlet P.Pinot H.Baumann F.Pereira Dos Santos article UnderwoodMPESd2010 Measurement Science and Technology 2010 21 7 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin 075103 iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0957-0233/21/7/075103 1 59 NA R- J.Underwood J. B.Mehl L.Pitre G.Edwards G.Sutton M.de Podesta article EichenbergerBJJRB2010 Metrologia 2010 48 3 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram 133-141 iMERA-Plus: Call 2007 SI and Fundamental Metrology 1 59 NA AliEichenberger H.Baumann BlaiseJeanneret BeatJeckelmann PhilippeRichard WalterBeer article KohlmannKILBEM2009 IEEE Transactions on Instrumentation and Measurement 2009 4 58 4 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 797-802 AC; AC Josephson voltage standard; Josephson arbitrary waveform synthesizer (JAWS); Josephson junction series arrays; superconductor-normal metal-superconductor (SNS) Josephson junctions iMERA-Plus: Call 2007 Electricity and Magnetism English 0018-9456 1 59 NA J.Kohlmann O. F.Kieler R.Iuzzolino J.Lee R.Behr B.Egeling F.Müller article NouiraEYAS201 Journal of Physics: Conference Series 201 4 7 483 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 12 http://iopscience.iop.org/1742-6596/483/1/012015 A169 EMRP A169: Call 2010 Industry 1742-6596 10.1088/1742-6596/483/1/012015 1 59 NA HNouira NEl-Hayek XYuan NAnwer JSalgado miscellaneous ElsterMKMYF 1588 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Measurement model; GUM; Monte Carlo, Straight-line regression; Calibration; Covariance; Weighted total least-squares; Sonic nozzle EMPIR 2017: Pre-Co-Normative 10.5281/zenodo.4016916 NA C.Elster S.Martens K.Klauenberg B.Mickan C.Yardin N.Fischer miscellaneous MarschallHWHRKE 2598 Opt. Express 28 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 38762-38772 FTIR hyperspectral, imulation data, Python scripts EMPIR 2018: Health BERND KAESTNER NA https://doi.org/10.5281/zenodo.4595934 M.Marschall A.Hornemann G.Wübbeler A.Hoehl E.Ruhl K.Kästner C.Elster proceedings NwabohWE 1780 29. Deutscher Flammentag - - 16ENG05: Biomethane: Metrology for biomethane - N.A. EnG EMPIR 2016: Energy - Bochum 29. Deutscher Flammentag 17-09-2020 to 18-09-2020 30 NA https://oar.ptb.de/files/download/5e7339f64c93902a78003af1 J.Nwaboh O.Werhahn V.Ebert article NwabohMLPLvCPQWE 1790 The Analyst 16ENG05: Biomethane: Metrology for biomethane biomethane, laser spectroscopy, TDLAS, hydrogen chloride, ion chromatography EnG EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 0003-2654, 1364-5528 10.1039/d0an01955k NA J.A.Nwaboh H.Meuzelaar J.Liu S.Persijn J.Li A.M.H.van der Veen N.Chatellier A.Papin Z.Qu O.Werhahn V.Ebert miscellaneous EdlerBIMTAASZ 2515 International Journal of Thermophysics 42 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 150 Noble metal thermocouples · Reference function · Thermoelectricstability and homogeneity https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf EMPIR 2017: Industry Springer 1572-9567 NA https://zenodo.org/record/5163783 F.Edler J.Bojkovski C.G.Izquierdo M.J.Martin D.Tucker N.Arifovic S.L.Andersen L.Sindelorva V.Žužek proceedings ElHayekANGDB This paper will be published in Procedia CIRP IND10: Form metrology: Optical and tactile metrology for absolute form characterization Aspheric surface; form characterization; high precision metrology; non linear least-squares method; computational metrology. A169 EMRP A169: Call 2010 Industry 13th CIRP Conference on Computer Aided Tolerancing English 1 59 NA N.El-Hayek N.Anwer H.Nouira O.Gibaru M.Damak P.Bourdet miscellaneous NaydenovDAEBGJSMTDFJO 1463 17FUN06: SIQUST: Single-photon sources as new quantum standards Crystal defectsQuantum Information with hybrid SystemsQuantum sensingelemantal semiconductorsNitrogen vacancy centers in Diamondwide band gap Systemsoptically detected magnetic resonance https://zenodo.org/record/3711403#.Xnh5L0BFz8d EMPIR 2017: Fundamental 30 NA B.Naydenov I.P.Degiovanni G.Amato E.Enrico F.Bosia V.Grilj M.Jakšić N.Skukan E.Moreva P.Traina T.Ditalia J.Forneris F.Jelezko P.Olivero miscellaneous MarzanoMDSEOPKC 2229 Zenodo 18SIB07: GIQS: Graphene impedance quantum standard quantum Hall effect, Cryogenic probe, metrology, impedance, graphene EMPIR 2018: SI Broader Scope NA https://doi.org/10.5281/zenodo.5082160 M.Marzano N.T.Mai Tran V.D'Elia D.Serazio E.Enrico M.Ortolano K.Pierz J.Kucera L.Callegaro miscellaneous EllisonSC 1998 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; soil contaminants; acid extraction; atomic emission spectrometry EMPIR 2017: Pre-Co-Normative 10.5281/zenodo.4665685 NA S.Ellison M.Singh M.Cox miscellaneous KruskopfBPCPREPPGS 2230 Zenodo 18SIB07: GIQS: Graphene impedance quantum standard epitaxial graphene, quantum Hall effect, electrical metrology, resistance metrology, quantum metrology EMPIR 2018: SI Broader Scope NA https://doi.org/10.5281/zenodo.5076039 M.Kruskopf S.Bauer Y.Pimsut A.Chatterjee D.K.Patel A.F.Rigosi R.E.Elmquist K.Pierz E.Pesel M.Götz J.Schurr miscellaneous KlussEW 2496 IEEE Transactions on Instrumentation and Measurement 70 19ENG02: FutureEnergy: Metrology for future energy transmission N/A current transformers, frequency-domain analysis, high-voltage techniques, partial discharge measurement, time-domain analysis EMPIR 2019: Energy IEEE N/A NA https://zenodo.org/record/5913175 J.Klüss A-P.Elg C.Wingqvist miscellaneous LoeslerERS 1586 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy Reference Point Determination, SLR, VLBI, Laser Tracker, Least-Squares Adjustment, In-Process Metrology, GGOS, VGOS EMPIR 2018: SI Broader Scope NA https://doi.org/10.5281/zenodo.3996200 M.Loesler C.Eschelbach S.Riepl T.Schüler miscellaneous KlugelELR 2014 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy close range photogrammetry, bundle adjustment, reference point determination, unscentedtransformation, stochastic model, satellite laser ranging, GeoMetre EMPIR 2018: SI Broader Scope NA https://github.com/applied-geodesy/bundle-adjustment T.Klügel C.Eschelbach M.Lösler S.Riepl miscellaneous RiemanAEBMSSRIF 2335 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases magnetic resonance spectroscopy (MRS), 7T, Reproducibility, Repeatability, Neurochemicals https://zenodo.org/record/5500320#.YZ9eudDP1aS EMPIR 2018: Health NA https://doi.org/10.5281/zenodo.5500319 L.T.Rieman C.S.Aigner S.L.R.Ellison R.Brühl R.Mekle S.. Schmitter O.Speck G.Rose B.Itterman A.Fillmer miscellaneous BauerBEGHKKLPPS 2231 Zenodo 18SIB07: GIQS: Graphene impedance quantum standard impedance measurement,quantized Hall resistor,coaxial impedance bridge,graphene,Josephson arbitrary waveform synthesizer EMPIR 2018: SI Broader Scope NA https://doi.org/10.5281/zenodo.4469532 S.Bauer R.Behr R.E.Elmqiost M.Götz J.Herick O.Kieler M.Kruskopf J.Lee L.Palafox Y.Pimsut J.Schurr