% % This file was created by the TYPO3 extension % bib % --- Timezone: CEST % Creation date: 2022-05-23 % Creation time: 02-22-47 % --- Number of references % 1772 % @Article { AmicoTPSN2022, subid = {2720}, title = {Recent applications and novel strategies for mercury determination in environmental samples using microextraction-based approaches: A review}, journal = {Journal of Hazardous Materials}, year = {2022}, month = {7}, volume = {433}, number2 = {19NRM03: SI-Hg: Metrology for traceable protocols for elemental and oxidised mercury concentrations}, pages = {128823}, keywords = {Mercury determination, Microextraction techniques, Environmental monitoring, Exposomics studies, Green analytical chemistry (GAC), Sample preparation}, web_url = {https://doi.org/10.1016/j.jhazmat.2022.128823}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3894}, DOI = {10.1016/j.jhazmat.2022.128823}, stag_bib_extends_levelofaccess = {NA}, author = {Amico, D. and Tassone, A. and Pirrone, N. and Sprovieri, F. and Naccarato, A.} } @Article { IrwinHSBSBSV2022, subid = {2623}, title = {Characterising the silver particle generator; a pathway towards standardising silver aerosol generation}, journal = {Journal of Aerosol Science}, year = {2022}, month = {6}, volume = {163}, number2 = {19ENV09: MetroPEMS: Improved vehicle exhaust quantification by portable emission measurement systems metrology}, pages = {105978}, keywords = {silver particle generator, calibration, reference aerosol, CPC calibration, DMA calibration}, web_url = {https://www.sciencedirect.com/science/article/pii/S002185022200026X?via\%3Dihub}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2022.105978}, stag_bib_extends_levelofaccess = {NA}, author = {Irwin, M. and Hammer, T. and Swanson, J. and Berger, V. and Sonkamble, U. and Boies, A. and Schulz, H. and Vasilatou, K.} } @Article { ChambersGWSMRMR2022, subid = {2754}, title = {Portable two-filter dual-flow-loop 222Rn detector: stand-alone monitor and calibration transfer device}, journal = {Advances in Geosciences}, year = {2022}, month = {5}, day = {18}, volume = {57}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, pages = {63-80}, keywords = {Radon monitor, two-filter dual loop detector, traceRadon, calibration, activity concentration}, misc2 = {EMPIR 2019: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7359}, DOI = {10.5194/adgeo-57-63-2022}, stag_bib_extends_levelofaccess = {NA}, author = {Chambers, S.D. and Griffiths, A.D. and Williams, A.G. and Sisoutham, O. and Morosh, V. and R{\"o}ttger, S. and Mertes, F. and R{\"o}ttger, A.} } @Article { RubenVogtRGDKMKKSBBMPFCRVSH2022, subid = {2751}, title = {PV Module Energy Rating Standard IEC 61853-3 Intercomparison and Best Practice Guidelines for Implementation and Validation}, journal = {IEEE Journal of Photovoltaics}, year = {2022}, month = {5}, volume = {12}, number = {3}, number2 = {19ENG01: Metro-PV: Metrology for emerging PV applications}, pages = {844-852}, keywords = {Standards, Meteorology, IEC Standards, Temperature measurement, Power measurement, Photovoltaic systems, Mathematical models}, web_url = {https://www.techrxiv.org/articles/preprint/PV_module_energy_rating_standard_IEC_61853-3_intercomparison_and_best_practice_guidelines_for_implementation_and_validation/19635333/1}, misc2 = {EMPIR 2019: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2021.3135258}, stag_bib_extends_levelofaccess = {NA}, author = {Ruben Vogt, M. and Riechelmann, S. and Gracia-Amillo, A.M. and Driesse, A. and Kokka, A. and Maham, K. and K{\"a}rh{\"a}, P. and Kenny, R. and Schinke, C. and Bothe, K. and Blakesley, J. and Music, E. and Plag, F. and Friesen, G. and Corbellini, G. and Riedel-Lyngskar, N. and Valckenborg, R. and Schweiger, M. and Herrmann, W.} } @Article { BriantKCLBWRMPCESTHPKKDZWMSNB2022, subid = {2714}, title = {Photonic and Optomechanical Thermometry}, journal = {Optics}, year = {2022}, month = {4}, day = {29}, volume = {3}, number = {2}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {159-176}, keywords = {thermometry; photonic; optomechanic; temperature sensors; photonic integrated circuit}, web_url = {https://doi.org/10.3390/opt3020017}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2673-3269}, DOI = {10.3390/opt3020017}, stag_bib_extends_levelofaccess = {NA}, author = {Briant, T. and Krenek, S. and Cupertino, A. and Loubar, F. and Braive, R. and Weituschat, L. and Ramos, D. and Martin, M.J. and Postigo, P.A. and Casas, A. and Eisermann, R. and Schmid, D. and Tabandeh, S. and Hahtela, O. and Pourjamal, S. and Kozlova, O. and Kroker, S. and Dickmann, W. and Zimmermann, L. and Winzer, G. and Martel, T. and Steeneken, P.G. and Norte, R.A. and Briaudeau, S.} } @Article { RubinSZHFABKLZA2022, subid = {2709}, title = {Thermodynamic effects in a gas modulated Invar-based dual Fabry–P{\'e}rot cavity refractometer}, journal = {Metrologia}, year = {2022}, month = {4}, day = {14}, volume = {59}, number = {3}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {035003}, keywords = {quantumpascal, GAMOR, optical pressure standard, gas refractometry, pV-work, Invar-based}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac5ef9}, stag_bib_extends_levelofaccess = {NA}, author = {Rubin, T. and Silander, I. and Zakrisson, J. and Hao, M. and Forss{\'e}n, C. and Asbahr, P. and Bernien, M. and Kussicke, A. and Liu, K. and Zelan, M. and Axner, O.} } @Article { vanHeerenSPB2022, subid = {2698}, title = {Metrology challenges for microfluidics}, journal = {CMM Magazine}, year = {2022}, month = {4}, day = {13}, volume = {15}, number = {2}, number2 = {20NRM02: MFMET: Establishing metrology standards in microfluidic devices}, pages = {20-25}, keywords = {Microfluidics, metrology, fabrication, testing}, web_url = {http://www.cmmmagazine.com/cmm-articles/metrology-challenges-for-microfluidics/}, misc2 = {EMPIR 2020: Pre-Co-Normative}, publisher = {MST Global Ltd}, language = {30}, ISSN = {2634-9167}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISSN 2634-9167}, author = {van Heeren, H. and Silverio, V. and Pecnik, C. and Batista, E.} } @Article { ZanovelloSBWZI2022, subid = {2551}, title = {CoSimPy: An open-source python library for MRI radiofrequency Coil EM/Circuit Cosimulation}, journal = {Computer Methods and Programs in Biomedicine}, year = {2022}, month = {4}, volume = {216}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {106684}, keywords = {Electromagnetic (EM) simulations, EM/Circuit cosimulation, Magnetic Resonance Imaging (MRI), Radio-frequency (RF) coils, Open source Python library}, web_url = {https://www.sciencedirect.com/science/article/pii/S0169260722000694?via\%3Dihub}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0169-2607}, DOI = {10.1016/j.cmpb.2022.106684}, stag_bib_extends_levelofaccess = {NA}, author = {Zanovello, U. and Seifert, F. and Bottauscio, O. and Winter, L. and Zilberti, L. and Ittermann, B.} } @Article { RabagoQVSRICCRCFFRG2022, subid = {2671}, title = {Intercomparison of Radon Flux Monitors at Low and at High Radium Content Areas under Field Conditions}, journal = {International Journal of Environmental Research and Public Health}, year = {2022}, month = {4}, volume = {19}, number = {7}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, pages = {4213}, keywords = {exhalation; traceRadon; proficiency test; interlaboratory comparison}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1660-4601}, DOI = {10.3390/ijerph19074213}, stag_bib_extends_levelofaccess = {NA}, author = {Rabago, D. and Quindos, L. and Vargas, A. and Sainz, C. and Radulescu, I. and Ioan, M-R. and Cardellini, F. and Capogni, M. and Rizzo, A. and Celaya, S. and Fuente, I. and Fuente, M. and Rodriguez, M. and Grossi, C.} } @Article { KranzerSBHPLLP2022, subid = {2662}, title = {Response of diamond detectors in ultra-high dose-per-pulse electron beams for dosimetry at FLASH radiotherapy}, journal = {Physics in Medicine \& Biology}, year = {2022}, month = {3}, day = {21}, volume = {67}, number = {7}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {075002}, keywords = {dosimetry, FLASH radiotherapy, ultra-high dose-per-pulse, microDiamond}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac594e}, stag_bib_extends_levelofaccess = {NA}, author = {Kranzer, R. and Sch{\"u}ller, A. and Bourgouin, A. and Hackel, T. and Poppinga, D. and Lapp, M. and Looe, H.K. and Poppe, B.} } @Article { GogneauCSCLTHJTH2022, subid = {2666}, title = {Electromechanical conversion efficiency of GaN NWs: critical influence of the NW stiffness, the Schottky nano-contact and the surface charge effects}, journal = {Nanoscale}, year = {2022}, month = {3}, day = {17}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, keywords = {piezoelectric nanowires, NW, AFM, stiffness, GaN, energy, harvesting}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2022/NR/D1NR07863A}, misc2 = {EMPIR 2019: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/d1nr07863a}, stag_bib_extends_levelofaccess = {NA}, author = {Gogneau, N. and Chr{\'e}tien, P. and Sodhi, T. and Couraud, L. and Leroy, L. and Travers, L. and Harmand, J-C. and Julien, F.H. and Tchernycheva, M. and Houz{\'e}, F.} } @Article { McManusRRBSPS2022, subid = {2661}, title = {Determination of beam quality correction factors for the Roos plane-parallel ionisation chamber exposed to very high energy electron (VHEE) beams using Geant4}, journal = {Physics in Medicine \& Biology}, year = {2022}, month = {3}, day = {17}, volume = {67}, number = {6}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {065011}, keywords = {geant4, Monte Carlo, perturbation factors, beam quality correction, VHEE}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac5a94}, stag_bib_extends_levelofaccess = {NA}, author = {McManus, M. and Romano, F. and Royle, G. and Botnariuc, D. and Shipley, D. and Palmans, H. and Subiel, A.} } @Article { BourgouinKMKSK2022, subid = {2663}, title = {Characterization of the PTB ultra-high pulse dose rate reference electron beam}, journal = {Physics in Medicine \& Biology}, year = {2022}, month = {3}, day = {15}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {Ultra-High Dose Rate, Dosimetry for FLASH, Monte Carlo, Diamond detector,electron beams}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac5de8}, stag_bib_extends_levelofaccess = {NA}, author = {Bourgouin, A. and Knyziak, A. and Marinelli, M. and Kranzer, R. and Sch{\"u}ller, A. and Kapsch, R-P.} } @Article { LetiziaSC2022, subid = {2718}, title = {Impact of DC Transient Disturbances on Harmonic Performance of Voltage Transformers for AC Railway Applications}, journal = {Sensors}, year = {2022}, month = {3}, day = {15}, volume = {22}, number = {6}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {2270}, keywords = {instrument transformers; harmonic measurements; DC transient disturbances; powerquality in AC railway systems}, web_url = {https://www.mdpi.com/1424-8220/22/6/2270}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s22062270}, stag_bib_extends_levelofaccess = {NA}, author = {Letizia, P. and Signorino, D. and Crotti, G.} } @Article { KronerABBBCPSSUW2022, subid = {2643}, title = {Evaluation of the measurement performance of water meters depending on water quality}, journal = {Water Supply}, year = {2022}, month = {3}, day = {14}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {cold water meters, test regime, water quality, water meter accuracy}, misc2 = {EMPIR 2017: Industry}, publisher = {IWA Publishing}, language = {30}, ISSN = {1606-9749, 1607-0798}, DOI = {10.2166/ws.2022.133}, stag_bib_extends_levelofaccess = {NA}, author = {Kroner, C. and Akselli, B. and Benkova, M. and Borchling, A. and B{\"u}ker, O. and Christoffersen, N. and Pavlas, J. and Schumann, D. and Seypka, V. and Unsal, B. and Warnecke, H.} } @Article { GeorgiKNSSTJ2022, subid = {2621}, title = {Toward 3D dose verification of an electronic brachytherapy source with a plastic scintillation detector}, journal = {Medical Physics}, year = {2022}, month = {3}, volume = {1-12}, number = {1-12}, number2 = {18NRM02: PRISM-eBT: Primary standards and traceable measurement methods for X-ray emitting electronic brachytherapy devices}, pages = {1-12}, keywords = {dose verification, electronic brachytherapy, Monte Carlo dosimetry, plastic scintillators}, web_url = {https://doi.org/10.1002/mp.15568}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.15568}, stag_bib_extends_levelofaccess = {NA}, author = {Georgi, P. and Kertzscher, G. and Nyvang, L. and Solc, J. and Schneider, T. and Tanderup, K. and Johansen, J.G.} } @Article { GarciaYipSRBBG2022, subid = {2620}, title = {Characterization of small active detectors for electronic brachytherapy dosimetry}, journal = {Journal of Instrumentation}, year = {2022}, month = {3}, volume = {17}, number = {03}, number2 = {18NRM02: PRISM-eBT: Primary standards and traceable measurement methods for X-ray emitting electronic brachytherapy devices}, pages = {P03001}, keywords = {Detector alignment and calibration methods (lasers, sources, particle-beams), X-ray detectors, Diamond Detectors}, web_url = {https://doi.org/10.1088/1748-0221/17/03/P03001}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/17/03/P03001}, stag_bib_extends_levelofaccess = {NA}, author = {Garcia Yip, F. and Schneider, T. and Reginatto, M. and Behrens, R. and B{\"u}ermann, L. and Grote, F.} } @Article { ChaeKKPTKPGYSCCS2022, subid = {2653}, title = {Investigation of the stability of graphene devices for quantum resistance metrology at direct and alternating current}, journal = {Measurement Science and Technology}, year = {2022}, month = {3}, volume = {33}, number = {6}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {065012}, keywords = {quantum Hall effect, quantized Hall resistance, graphene, impedance standard,F4-TCNQ doping, stability}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/ac4a1a}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac4a1a}, stag_bib_extends_levelofaccess = {NA}, author = {Chae, D-H. and Kruskopf, M. and Kucera, J. and Park, J. and Tran, N.T.M. and Kim, D.B. and Pierz, K. and G{\"o}tz, M. and Yin, Y. and Svoboda, P. and Chrobok, P. and Cou{\"e}do, F. and Schopfer, F.} } @Article { SantourianQS2022, subid = {2622}, title = {Uncertainty budget for PTB’s gonioreflectometers and ways to improve it in the short VIS spectral range}, journal = {Metrologia}, year = {2022}, month = {2}, day = {28}, volume = {59}, number = {2}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {025004}, keywords = {gonioreflectometer, measurement uncertainty analysis, absolute spectral radiancefactor, BRDF, sphere radiation source, LED-sphere radiator}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/ac4e76}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac4e76}, stag_bib_extends_levelofaccess = {NA}, author = {Santourian, I. and Quast, T. and Schirmacher, A.} } @Article { SteindlK2022, subid = {2690}, title = {Dimension-Dependent Phenomenological Model of Excitonic Electric Dipole in InGaAs Quantum Dots}, journal = {Nanomaterials}, year = {2022}, month = {2}, day = {21}, volume = {12}, number = {4}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {719}, keywords = {quantum dots}, web_url = {https://www.mdpi.com/2079-4991/12/4/719}, misc2 = {EMPIR 2020: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12040719}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Klenovsk{\'y}, P.} } @Article { AguirreSM2022, subid = {2580}, title = {SPICE Implementation of the Dynamic Memdiode Model for Bipolar Resistive Switching Devices}, journal = {Micromachines}, year = {2022}, month = {2}, day = {19}, volume = {13}, number = {2}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {330}, keywords = {memristor; resistive switching; memory; memdiode}, web_url = {https://doi.org/10.3390/mi13020330}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-666X}, DOI = {10.3390/mi13020330}, stag_bib_extends_levelofaccess = {NA}, author = {Aguirre, F.L. and Su{\~n}{\'e}, J. and Miranda, E.} } @Article { ForssenSZZA2022, subid = {2600}, title = {An optical pascal in Sweden}, journal = {Journal of Optics}, year = {2022}, month = {2}, day = {17}, volume = {24}, number = {3}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {033002}, keywords = {optical, pascal, Sweden, refractometry, pressure, Fabry–Perot}, web_url = {https://iopscience.iop.org/article/10.1088/2040-8986/ac4ea2}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {2040-8978, 2040-8986}, DOI = {10.1088/2040-8986/ac4ea2}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Proceedings { SunCGLJBB2022, subid = {2584}, title = {Evaluation of X-ray computed tomography for surface texture measurements using a prototype additively manufactured reference standard}, journal = {Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022,}, year = {2022}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {calibration, X-ray computed tomography, additive manufacturing, Reference standard, surface texture, areal}, web_url = {https://www.ndt.net/search/docs.php3?id=26568}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {11th Conference on Industrial Computed Tomography (iCT) 2022}, event_date = {08-02-2022 to 11-02-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id260.pdf}, author = {Sun, W. and Chen, X. and Giusca, C. and Lou, S. and Jones, C. and Boulter, H. and Brown, S.} } @Article { SunGLYCFJWBB2022, subid = {2588}, title = {Establishment of X-ray computed tomography traceability for additively manufactured surface texture evaluation}, journal = {Additive Manufacturing}, year = {2022}, month = {2}, volume = {50}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {102558}, keywords = {Additive manufacturing, Surface texture, Reference standard, X-ray computed tomography}, web_url = {https://www.sciencedirect.com/science/article/pii/S2214860421007053?via\%3Dihub}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {2214-8604}, DOI = {10.1016/j.addma.2021.102558}, stag_bib_extends_levelofaccess = {NA}, author = {Sun, W. and Giusca, C. and Lou, S. and Yang, X. and Chen, X. and Fry, T. and Jiang, X. and Wilson, A. and Brown, S. and Boulter, H.} } @Proceedings { SinghRathoreLBSV2022, subid = {2587}, title = {Benchmarking of different reconstruction algorithms for industrial cone-beam CT}, journal = {Proceedings 11th Conference on Industrial Computed Tomography (iCT) 2022,}, year = {2022}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {reconstruction, tomography, iterative, Analytical}, web_url = {https://www.ndt.net/search/docs.php3?id=26640}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {11th Conference on Industrial Computed Tomography (iCT) 2022}, event_date = {08-02-2022 to 11-02-2022}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2022/papers/ICT2022_paper_id244.pdf}, author = {Singh Rathore, J. and Laquai, R. and Biguri, A. and Soleimani, M. and Vienne, C. } } @Article { KuckLHGCRPSGBFLTTCMDTRR2022, subid = {2486}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Single photon sources, quantum radiometry, quantum metrology}, web_url = {https://doi.org/10.1007/s00340-021-07734-2}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { KuckLHGCRPSGBFLTTCMDTRR2022_2, subid = {2752}, title = {Single photon sources for quantum radiometry: a brief review about the current state-of-the-art}, journal = {Applied Physics B}, year = {2022}, month = {1}, day = {23}, volume = {128}, number = {2}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, keywords = {Single-photon sources, quantum radiometry, calibration, single photon detectors. defect centres, (nano-)diamonds, molecule semiconductor quantum dots, photon flux, single-photon purity, spectral power distribution}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-021-07734-2}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}ck, S. and L{\'o}pez, M. and Hofer, H. and Georgieva, H. and Christinck, J. and Rodiek, B. and Porrovecchio, G. and Smid, M. and G{\"o}tzinger, S. and Becher, C. and Fuchs, P. and Lombardi, P. and Toninelli, C. and Trapuzzano, M. and Colautti, M. and Margheri, G. and Degiovanni, I.P. and Traina, P. and Rodt, S. and Reitzenstein, S.} } @Article { DeVisMHMSB2022, subid = {2536}, title = {Ancillary Data Uncertainties within the SeaDAS Uncertainty Budget for Ocean Colour Retrievals}, journal = {Remote Sensing}, year = {2022}, month = {1}, day = {21}, volume = {14}, number = {3}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {497}, keywords = {Ocean Colour, Atmospheric correction, uncertainty, ancillary parameters}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs14030497}, stag_bib_extends_levelofaccess = {NA}, author = {De Vis, P. and M{\'e}lin, F. and Hunt, S.E. and Morrone, R. and Sinclair, M. and Bell, B.} } @Article { DeVisMHMSB2022_2, subid = {2590}, title = {Ancillary Data Uncertainties within the SeaDAS Uncertainty Budget for Ocean Colour Retrievals}, journal = {Remote Sensing}, year = {2022}, month = {1}, day = {21}, volume = {14}, number = {3}, number2 = {19ENV07: MetEOC-4: Metrology to establish an SI traceable climate observing system}, pages = {497}, keywords = {ocean colour, atmospheric correction, uncertainty, ancillary parameters}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs14030497}, stag_bib_extends_levelofaccess = {NA}, author = {De Vis, P. and M{\'e}lin, F. and Hunt, S.E. and Morrone, R. and Sinclair, M. and Bell, B.} } @Article { MittelstadtSK2022, subid = {2680}, title = {Modeling electronic and optical properties of III–V quantum dots—selected recent developments}, journal = {Light: Science \& Applications}, year = {2022}, month = {1}, day = {17}, volume = {11}, number = {1}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {17}, keywords = {quantum dots, empirical tight binding}, web_url = {https://www.nature.com/articles/s41377-021-00700-9}, misc2 = {EMPIR 2020: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/s41377-021-00700-9}, stag_bib_extends_levelofaccess = {NA}, author = {Mittelst{\"a}dt, A. and Schliwa, A. and Klenovsk{\'y}, P.} } @Article { ChristensenDLSLRSMSMVMRLMLQKSGMMYYISDVVFLPBFNSMRTPKTTBCPLPMMHMDTGCHIP2022, subid = {2567}, title = {2022 roadmap on neuromorphic computing and engineering}, journal = {Neuromorphic Computing and Engineering}, year = {2022}, month = {1}, day = {12}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, keywords = {neuromorphic computing, neuromorphic engineering}, web_url = {https://iopscience.iop.org/article/10.1088/2634-4386/ac4a83}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2634-4386}, DOI = {10.1088/2634-4386/ac4a83}, stag_bib_extends_levelofaccess = {NA}, author = {Christensen, D.V. and Dittmann, R. and Linares-Barranco, B. and Sebastian, A. and Le Gallo, M. and Redaelli, A. and Slesazeck, S. and Mikolajick, T. and Spiga, S. and Menzel, S. and Valov, I. and Milano, G. and Ricciardi, C. and Liang, S-J. and Miao, F. and Lanza, M. and Quill, T.J. and Keene, S.T. and Salleo, A. and Grollier, J. and Markovic, D. and Mizrahi, A. and Yao, P. and Yang, J.J. and Indiveri, G. and Strachan, J.P. and Datta, S. and Vianello, E. and Valentian, A. and Feldmann, J. and Li, X. and Pernice, W.H.P. and Bhaskaran, H. and Furber, S. and Neftci, E. and Scherr, F. and Maass, W. and Ramaswamy, S. and Tapson, J. and Panda, P. and Kim, Y. and Tanaka, G. and Thorpe, S. and Bartolozzi, C. and Cleland, T.A. and Posch, C. and Liu, S-C. and Panuccio, G. and Mahmud, M. and Mazumder, A.N. and Hosseini, M. and Mohsenin, T. and Donati, E. and Tolu, S. and Galeazzi, R. and Christensen, M.E. and Holm, S. and Ielmini, D. and Pryds, N.} } @Article { ClivatiMDVGLMPYSLDC2022, subid = {2524}, title = {Coherent phase transfer for real-world twin-field quantum key distribution}, journal = {Nature Communications}, year = {2022}, month = {1}, day = {10}, volume = {13}, number = {1}, number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware}, pages = {s41467-021-27808-1}, keywords = {QKD, Single photons and quantum effects, Optical metrology, Fibre optics and optical communications, Optoelectronic devices and components, Quantum information}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-021-27808-1}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Meda, A. and Donadello, S. and Virz{\`i}, S. and Genovese, M. and Levi, F. and Mura, A. and Pittaluga, M. and Yuan, Z. and Shields, A.J. and Lucamarini, M. and Degiovanni, I.P. and Calonico, D.} } @Article { SantourianQTHS2022, subid = {2420}, title = {Novel LED-based radiation source and its application in diffuse reflectometry and polarization measurements}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149 (2022}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {1-8}, keywords = {Source based radiometry, BRDF, Spectral radiance factor, LED sphere radiator, polarisation, diffuse reflection}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {NEWRAD 2021 - IOP Publishing}, language = {30}, ISSN = {1742-6588}, DOI = {10.1088/1742-6596/2149/1/012010}, stag_bib_extends_levelofaccess = {NA}, author = { Santourian, I. and Quast, T. and Teichert, S. and Hauer, K-O. and Schirmacher, A.} } @Article { SchaudeGH2022, subid = {2443}, title = {Effect of a Misidentified Centre of a Type ASG Material Measure on the Determined Topographic Spatial Resolution of an Optical Point Sensor}, journal = {Metrology}, year = {2022}, month = {1}, volume = {2}, number = {1}, number2 = {20IND07: TracOptic: Traceable industrial 3D roughness and dimensional measurement using optical 3D microscopy and optical distance sensors}, pages = {19-32}, keywords = {surface metrology, topographic spatial resolution, lateral period limit, type ASG materialmeasure, Siemens star, confocal sensor, nano measuring machine}, web_url = {https://www.mdpi.com/2673-8244/2/1/2}, misc2 = {EMPIR 2020: Industry}, publisher = {MDPI}, language = {30}, DOI = {10.3390/metrology2010002}, stag_bib_extends_levelofaccess = {NA}, author = {Schaude, J. and Gr{\"o}schl, A. and Hausotte, T. } } @Article { KatonaTSKN2022, subid = {2568}, title = {Geometric system analysis of ILMD-based LID measurement systems using Monte-Carlo simulation}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {1}, number2 = {19NRM02: RevStdLED: Revision and extension of standards for test methods for LED lamps, luminaires and modules}, pages = {012015}, keywords = {ILMD, goniophotometer, geoemtric uncertainty, monte carlo simulation,}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/2149/1/012015}, stag_bib_extends_levelofaccess = {NA}, author = {Katona, M. and Trampert, K. and Schwanengel, C. and Kr{\"u}ger, U. and Neumann, C.} } @Article { ChavelSLSHO2022, subid = {2684}, title = {Advocating a statistical definition for the BRDF}, journal = {Journal of Physics: Conference Series}, year = {2022}, month = {1}, volume = {2149}, number = {1}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {012013}, keywords = {BRDF, metrology, spectrophotometry, speckle}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/2149/1/012013}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/2149/1/012013}, stag_bib_extends_levelofaccess = {NA}, author = {Chavel, P. and Sortais, Y. and Labardens, T. and Simonot, L. and Hebert, M. and Obein, G.} } @Article { ShellingNetoDK2022, subid = {2719}, title = {Deep learning assisted design of high reflectivity metamirrors}, journal = {Optics Express}, year = {2022}, month = {1}, volume = {30}, number = {2}, number2 = {20FUN08: NEXTLASERS: Next generation ultrastable lasers: reducing thermal noise limit and overcoming technical limitations with new materials and tech}, pages = {986}, keywords = {deep learning, nanostructured mirrors, metamirrors}, misc2 = {EMPIR 2020: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.446442}, stag_bib_extends_levelofaccess = {NA}, author = {Shelling Neto, L. and Dickmann, J. and Kroker, S.} } @Article { FasoloBBCCCCCDEFFFFGGGGKLLLMMMMMMMNOPPPRRRSUV2022, subid = {2612}, title = {Bimodal Approach for Noise Figures of Merit Evaluation in Quantum-Limited Josephson Traveling Wave Parametric Amplifiers}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2022}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, keywords = {Physics, Gain, Microwave amplifiers, Noise figure, Superconducting microwave devices, Microwave photonics, Bandwidth}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2022.3148692}, stag_bib_extends_levelofaccess = {NA}, author = {Fasolo, L. and Barone, C. and Borghesi, M. and Carapella, G. and Caricato, A.P. and Carusotto, I. and Chung, W. and Cian, A. and Di Gioacchino, D. and Enrico, E. and Falferi, P. and Faverzani, M. and Ferri, E. and Filatrella, G. and Gatti, C. and Giachero, A. and Giubertoni, D. and Greco, A. and Kutlu, C. and Leo, A. and Ligi, C. and Livreri, P. and Maccarone, G. and Margesin, B. and Maruccio, G. and Matlashov, A. and Mauro, C. and Mezzena, R. and Monteduro, A.G. and Nucciotti, A. and Oberto, L. and Pagano, S. and Pierro, V. and Piersanti, L. and Rajteri, M. and Rettaroli, A. and Rizzato, S. and Semertzidis, Y.K. and Uchaikin, S.V. and Vinante, A.} } @Article { PolanskyS2022, subid = {2696}, title = {Implementation of turbulence damping in the OpenFOAM multiphase flow solver interFoam}, journal = {Archives of Thermodynamics}, year = {2022}, volume = {43}, number = {1}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {21-43}, keywords = {Multiphase flow, Stratified flow, Turbulence damping, Computational fluid dynamics, OpenFOAM, Reynolds-averaged Navier-Stokes, Detached eddy simulation, Delayed detached eddy simulation}, web_url = {http://journals.pan.pl/Content/122890/PDF/art02_internet.pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {The Committee of Thermodynamics and Combustion of the Polish Academy of Sciences and The Institute of Fluid-Flow Machinery Polish Academy of Sciences}, address = {Gdańsk}, language = {30}, ISSN = {1231-0956}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {10.24425/ather.2022.140923}, author = {Polansky, Jiri and Schmelter, Sonja} } @Article { ArrheniusBSCGBB2021, subid = {2487}, title = {Detection of Contaminants in Hydrogen Fuel for Fuel Cell Electrical Vehicles with Sensors—Available Technology, Testing Protocols and Implementation Challenges}, journal = {Processes}, year = {2021}, month = {12}, day = {24}, volume = {10}, number = {1}, number2 = {19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2}, pages = {20}, keywords = {sensors, hydrogen quality, FCEV, testing protocols}, misc2 = {EMPIR 2019: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-9717}, DOI = {10.3390/pr10010020}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Bacquart, T. and Schr{\"o}ter, K. and Carr{\'e}, M. and Gozlan, B. and Beurey, C. and Blondeel, C.} } @Article { McManusRRPS2021, subid = {2658}, title = {A Geant4 Fano test for novel very high energy electron beams}, journal = {Physics in Medicine \& Biology}, year = {2021}, month = {12}, day = {21}, volume = {66}, number = {24}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {245023}, keywords = {Fano, VHEE, dosimetry, geant4}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac3e0f}, stag_bib_extends_levelofaccess = {NA}, author = {McManus, M. and Romano, F. and Royle, G. and Palmans, H. and Subiel, A.} } @Article { DieudonneSHCL2021, subid = {2400}, title = {A Study of Experiment-based Radio Frequency Electromagnetic Field Exposure Evidence on Stochastic Nature of A Massive MIMO System}, journal = {A Study of Experiment-based Radio Frequency Electromagnetic Field}, year = {2021}, month = {12}, day = {17}, volume = {1}, number = {1}, number2 = {18SIP02: 5GRFEX: Metrology for RF exposure from massive MIMO 5G base station: Impact on 5G network deployment}, pages = {1-5}, keywords = {exposure, radiofrequency, electromagnetic field, massive mimo, stochastic nature, measurements.}, web_url = {https://arxiv.org/abs/2112.09637}, misc2 = {EMPIR 2018: Support for Impact}, publisher = {Tian Hong Loh}, language = {30}, ISSN = {arXiv:2112.09637v1}, DOI = {10.23919/EuCAP51087.2021.9411325}, stag_bib_extends_levelofaccess = {NA}, author = {Dieudonne, M. and Sunday, A. and Heliot, F. and Cheadle, D. and Loh, T.} } @Article { BassottiSC2021, subid = {2437}, title = {From the spin eigenmodes of isolated Nel skyrmions to the magnonic bands of a skyrmionic crystal: a micromagnetic study as a function of the strength of both the interfacial Dzyaloshinskii-Moriya and the exchange constants}, journal = {IEEE Magnetic Letters}, year = {2021}, month = {12}, day = {16}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {Micromagnetic simulations, skyrmiond, magnetic crystals, DMI}, web_url = {https://arxiv.org/ftp/arxiv/papers/2112/2112.04967.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IEEE}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://ieeexplore.ieee.org/document/9653803}, author = {Bassotti, M. and Silvani, R. and Carlotti, G.} } @Thesis { Seppalainen2021, subid = {2404}, title = {Reducing the statistical and systematic uncertainty of the VTT MIKES 88Sr+ ion clock}, year = {2021}, month = {12}, day = {14}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {metrology, atomic clocks, optical clocks, simulation, SI second, ion trap}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Aalto University}, school = {Aalto University}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://urn.fi/URN:NBN:fi:aalto-2021121910848}, author = {Sepp{\"a}l{\"a}inen, L.} } @Article { GollwitzerDSTCMPDFCH2021, subid = {2389}, title = {Correlative Analysis of the Dimensional Properties of Bipyramidal Titania Nanoparticles by Complementing Electron Microscopy with Other Methods}, journal = {Nanomaterials}, year = {2021}, month = {12}, day = {10}, volume = {11}, number = {12}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {3359}, keywords = {nanoparticle; complex‐shape; bipyramid; electron microscopy; atomic force microscopy;size measurements; TKD; STEM‐in‐SEM; SAXS; nanoparticle concentration; correlative analysis}, web_url = {https://www.mdpi.com/2079-4991/11/12/3359}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11123359}, stag_bib_extends_levelofaccess = {NA}, author = {Gollwitzer, C. and Deumer, J. and Salzmann, C. and Tokarski, T. and Cios, G. and Maurino, V. and Pellegrino, F. and Delvall{\'e}e, A. and Feltin, N. and Crouzier, L. and Hodoroaba, V-D.} } @Article { OlbrichHLvBOS2021, subid = {2175}, title = {Comparing temporal characteristics of slug flow from tomography measurements and video observations}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {100222}, keywords = {slug flow, interface dynamics, tomography, video observation}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001859}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100222}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and Hunt, A. and Leonard, T. and van Putten, D.S. and B{\"a}r, M. and Oberleithner, K. and Schmelter, S.} } @Article { SchmelterOKB2021, subid = {2196}, title = {Analysis of multiphase flow simulations and comparison with high-speed video observations}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {100154}, keywords = {Multiphase flowSlug flowPlug flowComputational fluid dynamics (CFD)High-speed video observationsLiquid level time series}, web_url = {https://doi.org/10.1016/j.measen.2021.100154}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100154}, stag_bib_extends_levelofaccess = {NA}, author = {Schmelter, S. and Olbrich, M. and Knotek, S. and B{\"a}r, M.} } @Article { BatistaSAAM2021, subid = {2276}, title = {Development of an experimental setup for micro flow measurement using the front tracking method}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {100152}, keywords = {Microflow measurementFront trackingCalibrationMeasurement uncertainty}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100152}, stag_bib_extends_levelofaccess = {NA}, author = {Batista, E. and Sousa, J.A. and Alvares, M. and Afonso, J. and Martins, R.F.} } @Article { GersakSNJFDRPSP2021, subid = {2330}, title = {Physiology-based patient simulator for blood pressure meter testing}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18RPT02: adOSSIG: Developing an infrastructure for improved and harmonised metrological checks of blood-pressure measurements in Europe}, pages = {100260}, keywords = {Blood pressure, Sphygmomanometer, Simulator, Patient simulator, Oscillometry, Metrology}, misc2 = {EMPIR 2018: Research Potential}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100260}, stag_bib_extends_levelofaccess = {NA}, author = {Geršak, G. and Schiebl, M. and Nawotka, M. and Jugo, E. and Ferreira, M. do C. and Duffy, A. and Rosu, D.M. and Pavlasek, P. and Sedl{\'a}k, V. and Praž{\'a}k, D.} } @Article { SedlakPSNJFDRPG2021, subid = {2331}, title = {Smart specialisation concept in metrology for blood and intraocular pressure measurements}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18RPT02: adOSSIG: Developing an infrastructure for improved and harmonised metrological checks of blood-pressure measurements in Europe}, pages = {100283}, keywords = {Medical metrology, Smart specialisation concept, Metrological traceability, Intraocular pressure, Blood pressure}, misc2 = {EMPIR 2018: Research Potential}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100283}, stag_bib_extends_levelofaccess = {NA}, author = {Sedl{\'a}k, V. and Praž{\'a}k, D. and Schiebl, M. and Nawotka, M. and Jugo, E. and Ferreira, M. do C. and Duffy, A. and Rosu, D.M. and Pavlasek, P. and Geršak, G.} } @Article { ForssenSZZA2021, subid = {2351}, title = {Fabry–Perot-cavity-based refractometry without influence of mirror penetration depth}, journal = {Journal of Vacuum Science \& Technology B}, year = {2021}, month = {12}, volume = {39}, number = {6}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {065001}, keywords = {Refractometry, Fabry-Perot cavity, Penetration depth}, web_url = {https://avs.scitation.org/doi/10.1116/6.0001501}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/6.0001501}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Article { LieberherrACCCGKMMMOSSTV2021, subid = {2368}, title = {Assessment of real-time bioaerosol particle counters using reference chamber experiments}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {12}, volume = {14}, number = {12}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {7693-7706}, keywords = {bioaerosol monitors, calibration, counting efficiency, fluorescence}, web_url = {https://amt.copernicus.org/articles/14/7693/2021/}, misc2 = {EMPIR 2019: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-7693-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Lieberherr, G. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Gysel-Beer, M. and Konzelmann, T. and Manzano, J. and Mihajlovic, A. and Moallemi, A. and O'Connor, D. and Sikoparija, B. and Sauvageat , E. and Tummon, F. and Vasilatou, K.} } @Article { SudTSBSDSSWZZRCKKC2021, subid = {2383}, title = {Tailoring interfacial effect in multilayers with Dzyaloshinskii–Moriya interaction by helium ion irradiation}, journal = {Scientific Reports}, year = {2021}, month = {12}, volume = {11}, number = {23626}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {Spintronics, Nano magnetism, Magnetic skyrmions, Dzyaloshinskii–Moriya interaction}, web_url = {https://www.nature.com/articles/s41598-021-02902-y.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, DOI = {10.1038/s41598-021-02902-y}, stag_bib_extends_levelofaccess = {NA}, author = { Sud, A. and Tacchi, S. and Sagkovits, D. and Barton, C. and Sall, M. and Diez, L.H. and Stylianidis, E. and Smith, N. and Wright, L. and Zhang, S. and Zhang, X. and Ravelosona, D. and Carlotti, G. and Kurebayashi, H. and Kazakova, O. and Cubukcu, M. } } @Article { LisdatDNS2021, subid = {2373}, title = {Blackbody radiation shift in strontium lattice clocks revisited}, journal = {Physical Review Research}, year = {2021}, month = {12}, volume = {3}, number = {4}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {L042036}, keywords = {optical clocks, lattice clocks, strontium, blackbody radiation shift}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.3.L042036}, stag_bib_extends_levelofaccess = {NA}, author = {Lisdat, Ch. and D{\"o}rscher, S. and Nosske, I. and Sterr, U.} } @Article { MertesKHKSWRRWW2021, subid = {2423}, title = {Ion implantation of 226Ra for a primary 222Rn emanation standard}, journal = {Applied Radiation and Isotopes}, year = {2021}, month = {12}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {Ion implantation222Rn emanationLaser ionizationDefined solid-angle alpha-particle spectrometry}, misc2 = {EMPIR 2019: Environment}, language = {30}, DOI = {10.1016/j.apradiso.2021.110093}, stag_bib_extends_levelofaccess = {NA}, author = {Mertes, F. and Kneip, N. and Heinke, R. and Kieck, T. and Studer, D. and Weber, F. and R{\"o}ttger, S. and R{\"o}ttger, A. and Wendt, K. and Walther, C.} } @Article { WojtyaRFSB2021, subid = {2605}, title = {Verification of sensitivity analysis method of measurement uncertainty evaluation}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number = {Part of sp}, number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry}, pages = {100274}, keywords = {Coordinate measuring machines, Measurement uncertainty, Geometrical product specification, Sensitivity analysis, GUM uncertainty Framework, Uncertainty evaluating software}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421002373}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100274}, stag_bib_extends_levelofaccess = {NA}, author = {Wojtyła, M. and Rosner, P. and Forbes, A.B. and Savio, E. and Balsamo, A.} } @Article { MiuraNTS2021, subid = {2604}, title = {GD\&T task specific measurement uncertainty evaluation for manufacturing floor}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number = {Part of sp}, number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry}, pages = {100141}, keywords = {Coordinate measuring machine, Uncertainty, Analysis of variance, Maximum entropy model}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001045}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100141}, stag_bib_extends_levelofaccess = {NA}, author = {Miura, Y. and Nakanishi, S. and Takatsuji, T. and Sato, O.} } @Article { SanderK2021, subid = {2669}, title = {Comparison of force measuring devices with static and continuous loading}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services}, pages = {100241}, keywords = {Piezoelectric; Drift; Creep; Creep recovery; Continuous load; Hysteresis; Force transducer}, web_url = {https://www.sciencedirect.com/science/article/pii/S266591742100204X}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100241}, stag_bib_extends_levelofaccess = {NA}, author = {Sander, J. and Kumme, R.} } @Article { DierikxXSLG2021, subid = {2477}, title = {White Rabbit Multi-Point Time Distribution Network}, journal = {IEEE TechRxiv}, year = {2021}, month = {11}, day = {29}, number2 = {17IND14: WRITE: Precision Time for Industry}, keywords = {Time and Frequency transfer; White Rabbit; Precision Time Protocol}, misc2 = {EMPIR 2017: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, DOI = {10.36227/techrxiv.17069279.v1}, stag_bib_extends_levelofaccess = {NA}, author = {Dierikx, E. and Xie, Y. and Savencu, A. and Lopez, J. and Guti{\'e}rrez, J.L.} } @Article { KoybasiNTPRPBMSKGOIG2021, subid = {2601}, title = {High Performance Predictable Quantum Efficient Detector Based on Induced-Junction Photodiodes Passivated with SiO2/SiNx}, journal = {Sensors}, year = {2021}, month = {11}, day = {24}, volume = {21}, number = {23}, number2 = {18SIB10: chipS·CALe: Self-calibrating photodiodes for the radiometric linkage to fundamental constants}, pages = {7807}, keywords = {silicon photodetector; inversion layer photodiode; induced-junction; surface passivation;PECVD silicon nitride; radiometry; optical power; primary standard; predictable quantum efficiency}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21237807}, stag_bib_extends_levelofaccess = {NA}, author = {Koybasi, O. and Nordseth, {\O}. and Tran, T. and Povoli, M. and Rajteri, M. and Pepe, C. and Bardalen, E. and Manoocheri, F. and Summanwar, A. and Korpusenko, M. and Getz, M.N. and Ohlckers, P. and Ikonen, E. and Gran, J.} } @Article { NugrohoHPRYIKPWS2021, subid = {2473}, title = {Vertically Aligned n-Type Silicon Nanowire Array as a Free-Standing Anode for Lithium-Ion Batteries}, journal = {Nanomaterials}, year = {2021}, month = {11}, day = {20}, volume = {11}, number = {11}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {3137}, keywords = {silicon nanowire, nanowire array, silicon anode, n-type silicon anode, Li-ion battery}, misc2 = {EMPIR 2019: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11113137}, stag_bib_extends_levelofaccess = {NA}, author = {Nugroho, A.P. and Hawari, N.H. and Prakoso, B. and Refino, A.D. and Yulianto, N. and Iskandar, F. and Kartini, E. and Peiner, E. and Wasisto, H.S. and Sumboja, A.} } @Article { ChretienGST2021, subid = {2471}, title = {Fast Hyperparameter Calibration of Sparsity Enforcing Penalties in Total Generalised Variation Penalised Reconstruction Methods for XCT Using a Planted Virtual Reference Image}, journal = {Mathematics}, year = {2021}, month = {11}, day = {19}, volume = {9}, number = {22}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {2960}, keywords = {XCT reconstruction, sparsity enforcing penalties, hyperparameter selection, Bayesian optimisation, virtual planted reference image}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-7390}, DOI = {10.3390/math9222960}, stag_bib_extends_levelofaccess = {NA}, author = {Chretien, S. and Giampiccolo, C. and Sun, W. and Talbott, J.} } @Article { RottgerVSPDISBAGGBWPiN2021, subid = {2317}, title = {Metrology for radiation protection: a new European network in the foundation phase}, journal = {Advances in Geosciences}, year = {2021}, month = {11}, day = {17}, volume = {57}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, pages = {1-7}, keywords = {supportBSS, EMN for Radiation Protection, metrology, regulation, EURAMET, EURATOM}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7359}, DOI = {10.5194/adgeo-57-1-2021}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and Veres, A. and Sochor, V. and Pinto, M. and Derlacinski, M. and Ioan, M-R. and Sabeta, A. and Bernat, R. and Adam-Guillermin, C. and Gracia Alves, J.H. and Glavič-Cindro, D. and Bell, S. and Wens, B. and Persson, L. and Živanović, M. and Nylund, R.} } @Article { RiemannAEBMSSRIF2021, subid = {2569}, title = {Assessment of measurement precision in single‐voxel spectroscopy at 7 T: Toward minimal detectable changes of metabolite concentrations in the human brain in vivo}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {11}, day = {16}, volume = {87}, number = {3}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {1119-1135}, keywords = {CRLBs, measurement precision, minimal detectable change, MR spectroscopy, reproducibility/repeatability, SPECIAL}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/mrm.29034}, misc2 = {EMPIR 2018: Health}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.29034}, stag_bib_extends_levelofaccess = {NA}, author = {Riemann, L.T. and Aigner, C.S. and Ellison, S.L.R. and Br{\"u}hl, R. and Mekle, R. and Schmitter, S. and Speck, O. and Rose, G. and Ittermann, B. and Fillmer, A.} } @Article { PellegrinoOMSMH2021, subid = {2347}, title = {Customizing New Titanium Dioxide Nanoparticles with Controlled Particle Size and Shape Distribution – A Feasibility Study towards Reference Materials for Quality Assurance of Non‐Spherical Nanoparticle Characterization}, journal = {Advanced Engineering Materials}, year = {2021}, month = {11}, day = {13}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, keywords = {nanoparticles, titanium dioxide, reference materials, standardization, particle size and shape distribution}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/adem.202101347}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Wiley}, language = {30}, ISSN = {1438-1656, 1527-2648}, DOI = {10.1002/adem.202101347}, stag_bib_extends_levelofaccess = {NA}, author = {Pellegrino, F. and Ortel, E. and Mielke, J. and Schmidt, R. and Maurino, V. and Hodoroaba, V-D.} } @Article { FarooquiMWWHPWS2021, subid = {2284}, title = {Development of High Temperature Multi-Layer Laser Flash Artefacts}, journal = {International Journal of Thermophysics}, year = {2021}, month = {11}, volume = {43}, number = {1}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Hafnium, Isotropic graphite, Laser flash analysis, Multi-layer systems, Partial de-bonding, Reference artefacts}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-021-02928-4}, stag_bib_extends_levelofaccess = {NA}, author = {Farooqui, A. and Morrell, R. and Wu, J. and Wright, L. and Hay, B. and Pekris, M. and Whiting, M.J. and Saunders, T.} } @Article { HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021, subid = {2336}, title = {Frequency drift in MR spectroscopy at 3T}, journal = {NeuroImage}, year = {2021}, month = {11}, volume = {241}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {118430}, keywords = {Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2021.118430}, stag_bib_extends_levelofaccess = {NA}, author = {Hui, S.C.N. and Mikkelsen, M. and Z{\"o}llner, H.J. and Ahluwalia, V. and Alcauter, S. and Baltusis, L. and Barany, D.A. and Barlow, L.R. and Becker, R. and Berman, J.I. and Berrington, A. and Bhattacharyya, P.K. and Blicher, J.U. and Bogner, W. and Brown, M.S. and Calhoun, V.D. and Castillo, R. and Cecil, K.M. and Choi, Y.B. and Chu, W.C.W. and Clarke, W.T. and Craven, A.R. and Cuypers, K. and Dacko, M. and de la Fuente-Sandoval, C. and Desmond, P. and Domagalik, A. and Dumont, J. and Duncan, N.W. and Dydak, U. and Dyke, K. and Edmondson, D.A. and Ende, G. and Ersland, L. and Evans, C.J. and Fermin, A.S.R. and Ferretti, A. and Fillmer, A. and Gong, T. and Greenhouse, I. and Grist, J.T. and Gu, M. and Harris, A.D. and Hat, K. and Heba, S. and Heckova, E. and Hegarty, J.P. and Heise, K-F. and Honda, S. and Jacobson, A. and Jansen, J.F.A. and Jenkins, C.W. and Johnston, S.J. and Juchem, C. and Kangarlu, A. and Kerr, A.B. and Landheer, K. and Lange, T. and Lee, P. and Levendovszky, S.R. and Limperopoulos, C. and Liu, F. and Lloyd, W. and Lythgoe, D.J. and Machizawa, M.G. and MacMillan, E.L. and Maddock, R.J. and Manzhurtsev, A.V. and Martinez-Gudino, M.L. and Miller, J.J. and Mirzakhanian, H. and Moreno-Ortega, M. and Mullins, P.G. and Nakajima, S. and Near, J. and Noeske, R. and Nordh{\o}y, W. and Oeltzschner, G. and Osorio-Duran, R. and Otaduy, M.C.G. and Pasaye, E.H. and Peeters, R. and Peltier, S.J. and Pilatus, U. and Polomac, N. and Porges, E.C. and Pradhan, S. and Prisciandaro, J.J. and Puts, N.A. and Rae, C.D. and Reyes-Madrigal, F. and Roberts, T.P.L. and Robertson, C.E. and Rosenberg, J.T. and Rotaru, D-G. and O'Gorman Tuura, R.L. and Saleh, M.G. and Sandberg, K. and Sangill, R. and Schembri, K. and Schrantee, A. and Semenova, N.A. and Singel, D. and Sitnikov, R. and Smith, J. and Song, Y. and Stark, C. and Stoffers, D. and Swinnen, S.P. and Tain, R. and Tanase, C. and Tapper, S. and Tegenthoff, M. and Thiel, T. and Thioux, M. and Truong, P. and van Dijk, P. and Vella, N. and Vidyasagar, R. and Vovk, A. and Wang, G. and Westlye, L.T. and Wilbur, T.K. and Willoughby, W.R. and Wilson, M. and Wittsack, H-J. and Woods, A.J. and Wu, Y-C. and Xu, J. and Lopez, M.Y. and Yeung, D.K.W. and Zhao, Q. and Zhou, X. and Zupan, G. and Edden, R.A.E.} } @Article { CorteSDLPTDMOMGF2021, subid = {2503}, title = {Spectral Emission Dependence of Tin‐Vacancy Centers in Diamond from Thermal Processing and Chemical Functionalization}, journal = {Advanced Photonics Research}, year = {2021}, month = {11}, volume = {3}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {2100148}, keywords = {tin vacancy centers, single-photon sources, nanodiamond}, web_url = {https://onlinelibrary.wiley.com/doi/epdf/10.1002/adpr.202100148}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2699-9293, 2699-9293}, DOI = {10.1002/adpr.202100148}, stag_bib_extends_levelofaccess = {NA}, author = {Corte, E. and Sachero, S. and Ditalia Tchernij, S. and L{\"u}hmann, T. and Pezzagna, S. and Traina, P. and Degiovanni, I.P. and Moreva, E. and Olivero, P. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { CorteSDLPTDMOMGF2021_2, subid = {2678}, title = {Spectral Emission Dependence of Tin‐Vacancy Centers in Diamond from Thermal Processing and Chemical Functionalization}, journal = {Advanced Photonics Research}, year = {2021}, month = {11}, volume = {3}, number = {1}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {2100148}, keywords = {color centers, confocal microscopy}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/adpr.202100148}, misc2 = {EMPIR 2020: Industry}, publisher = {Wiley}, language = {30}, ISSN = {2699-9293, 2699-9293}, DOI = {10.1002/adpr.202100148}, stag_bib_extends_levelofaccess = {NA}, author = {Corte, E. and Sachero, S. and Ditalia Tchernij, S. and L{\"u}hmann, T. and Pezzagna, S. and Traina, P. and Degiovanni, I.P. and Moreva, E. and Olivero, P. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { RipaIGSGFBLDG2021_2, subid = {2694}, title = {Corrigendum: Refractive index gas thermometry between 13.8 K and 161.4 K (2021 Metrologia 58 025008)}, journal = {Metrologia}, year = {2021}, month = {10}, day = {25}, volume = {58}, number = {6}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {069501}, keywords = {refractive index gas thermometry}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac2d9e}, stag_bib_extends_levelofaccess = {NA}, author = {Ripa, D.M. and Imbraguglio, D. and Gaiser, C. and Steur, P.P.M. and Giraudi, D. and Fogliati, M. and Bertinetti, M. and Lopardo, G. and Dematteis, R. and Gavioso, R.M.} } @Article { RipaIGSGFBLDG2021_3, subid = {2716}, title = {Corrigendum: Refractive index gas thermometry between 13.8 K and 161.4 K (2021 Metrologia 58 025008)}, journal = {Metrologia}, year = {2021}, month = {10}, day = {25}, volume = {58}, number = {6}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {069501}, keywords = {Corrigendum, Refractive index, gas thermometry}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/ac2d9e}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac2d9e}, stag_bib_extends_levelofaccess = {NA}, author = {Ripa, D.M. and Imbraguglio, D. and Gaiser, C. and Steur, P.P.M. and Giraudi, D. and Fogliati, M. and Bertinetti, M. and Lopardo, G. and Dematteis, R. and Gavioso, R.M.} } @Article { DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021, subid = {2365}, title = {A Comprehensive Description of Multi-Term LSM for Applying Multiple a Priori Constraints in Problems of Atmospheric Remote Sensing: GRASP Algorithm, Concept, and Applications}, journal = {Frontiers in Remote Sensing}, year = {2021}, month = {10}, day = {19}, volume = {2}, number2 = {19ENV04: MAPP: Metrology for aerosol optical properties}, keywords = {GRASP, Radiative Transfer, Inversion model}, web_url = {https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full}, misc2 = {EMPIR 2019: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-6187}, DOI = {10.3389/frsen.2021.706851}, stag_bib_extends_levelofaccess = {NA}, author = {Dubovik, O. and Fuertes, D. and Litvinov, P. and Lopatin, A. and Lapyonok, T. and Doubovik, I. and Xu, F. and Ducos, F. and Chen, C. and Torres, B. and Derimian, Y. and Li, L. and Herreras-Giralda, M. and Herrera, M. and Karol, Y. and Matar, C. and Schuster, G.L. and Espinosa, R. and Puthukkudy, A. and Li, Z. and Fischer, J. and Preusker, R. and Cuesta, J. and Kreuter, A. and Cede, A. and Aspetsberger, M. and Marth, D. and Bindreiter, L. and Hangler, A. and Lanzinger, V. and Holter, C. and Federspiel, C.} } @Article { deGrootCSCL2021, subid = {2432}, title = {Modeling of coherence scanning interferometry using classical Fourier optics}, journal = {Optical Engineering}, year = {2021}, month = {10}, day = {18}, volume = {60}, number = {10}, number2 = {20IND07: TracOptic: Traceable industrial 3D roughness and dimensional measurement using optical 3D microscopy and optical distance sensors}, pages = {104106}, keywords = {interferometry, interferometer, metrology, topography, coherence scanning interferometry,Fourier optics}, web_url = {https://www.spiedigitallibrary.org/journals/optical-engineering/volume-60/issue-10/104106/Modeling-of-coherence-scanning-interferometry-using-classical-Fourier-optics/10.1117/1.OE.60.10.104106.full}, misc2 = {EMPIR 2020: Industry}, language = {30}, DOI = {10.1117/1.OE.60.10.104106}, stag_bib_extends_levelofaccess = {NA}, author = {de Groot, P. and Colonna de Lega, X. and Su, R. and Coupland, J. and Leach, R.} } @Article { ArrheniusABMBWBGLCSBNR2021, subid = {2482}, title = {Strategies for the sampling of hydrogen at refuelling stations for purity assessment}, journal = {International Journal of Hydrogen Energy}, year = {2021}, month = {10}, day = {11}, volume = {46}, number = {70}, number2 = {19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2}, pages = {34839-34853}, keywords = {Hydrogen,Refuelling stations,Sampling device,Fuel quality assessment}, web_url = {https://www.sciencedirect.com/science/article/pii/S0360319921031694}, misc2 = {EMPIR 2019: Energy}, publisher = {Elsevier}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2021.08.043}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Aarhaug, T.A. and Bacquart, T. and Morris, A. and Bartlett, S. and Wagner, L. and Blondeel, C. and Gozlan, B. and Lescornes, Y. and Chramosta, N. and Spitta, C. and Basset, E. and Nouvelot, Q. and Rizand, M.} } @Article { SantafeGabardaFTC2021, subid = {2273}, title = {Primary facility for traceable measurement of the BSSRDF}, journal = {Optics Express}, year = {2021}, month = {10}, volume = {29}, number = {21}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {34175}, keywords = {BSSRDF, translucency, reflectance, measurement, gonispectrophotometry}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.439108}, stag_bib_extends_levelofaccess = {NA}, author = {Santaf{\'e}-Gabarda, P. and Ferrero, A. and Tejedor-Sierra, N. and Campos, J.} } @Article { SteindlSABK2021, subid = {2345}, title = {On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001)}, journal = {New Journal of Physics}, year = {2021}, month = {10}, volume = {23}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {103029}, keywords = {Quantum Dots, carrier dynamics, optical spectroscopy, memory devices}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac2bd6}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { AguirrePPMSM2021, subid = {2451}, title = {Assessment and Improvement of the Pattern Recognition Performance of Memdiode-Based Cross-Point Arrays with Randomly Distributed Stuck-at-Faults}, journal = {Electronics}, year = {2021}, month = {10}, volume = {10}, number = {19}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {2427}, keywords = {stuck-at fault; RRAM; pattern recognition; memristor; QMM; neural network; neuromorphics}, web_url = {https://www.mdpi.com/2079-9292/10/19/2427}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-9292}, DOI = {10.3390/electronics10192427}, stag_bib_extends_levelofaccess = {NA}, author = {Aguirre, F.L. and Pazos, S.M. and Palumbo, F. and Morell, A. and Su{\~n}{\'e}, J. and Miranda, E.} } @Article { RefinoYSNHSKIVSPW2021, subid = {2474}, title = {Versatilely tuned vertical silicon nanowire arrays by cryogenic reactive ion etching as a lithium-ion battery anode}, journal = {Scientific Reports}, year = {2021}, month = {10}, volume = {11}, number = {1}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, keywords = {high-aspect-ratio silicon (Si), nanowire array, lithium ion batteries, ICP-RIE}, web_url = {https://www.nature.com/articles/s41598-021-99173-4}, misc2 = {EMPIR 2019: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-99173-4}, stag_bib_extends_levelofaccess = {NA}, author = {Refino, A.D. and Yulianto, N. and Syamsu, I. and Nugroho, A.P. and Hawari, N.H. and Syring, A. and Kartini, E. and Iskandar, F. and Voss, T. and Sumboja, A. and Peiner, E. and Wasisto, H.S.} } @Article { KnotekSO2021, subid = {2193}, title = {Assessment of different parameters used in mesh independence studies in two-phase slug flow simulations}, journal = {Measurement: Sensors}, year = {2021}, month = {9}, day = {29}, volume = {18}, number = {2021}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {100317}, keywords = {Multiphase flow, Slug flow, Computational fluid dynamics (CFD), Mesh study, Grid refinement}, web_url = {https://doi.org/10.1016/j.measen.2021.100317}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100317}, stag_bib_extends_levelofaccess = {NA}, author = {Knotek, S. and Schmelter, S. and Olbrich, M.} } @Article { BukerSKBPS2021, subid = {2207}, title = {Investigations on the Influence of Total Water Hardness and pH Value on the Measurement Accuracy of Domestic Cold Water Meters}, journal = {MDPI Water}, year = {2021}, month = {9}, day = {29}, volume = {13}, number = {19}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {domestic water meters; total hardness; pH value; wear test; flow measurement}, misc2 = {EMPIR 2017: Industry}, language = {30}, DOI = {10.3390/w13192701}, stag_bib_extends_levelofaccess = {NA}, author = {B{\"u}ker, O. and Stolt, K. and Kroner, C. and Benkova, M. and Pavlas, J. and Seypka, V.} } @Proceedings { SeferiCB2021, subid = {2268}, title = {Review of PMU Algorithms Suitable for Real-Time Operation With Digital Sampled Value Data}, journal = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2021}, month = {9}, day = {29}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {6}, keywords = {Algorithms, frequency, phasor measurement unit, real-time operation, ROCOF, sample value data, synchrophasor}, web_url = {https://strathprints.strath.ac.uk/78316/}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Online}, event_name = {IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {29-09-2021 to 01-10-2021}, language = {30}, ISBN = {978-1-7281-6923-1}, ISSN = {2475-2304}, DOI = {10.1109/AMPS50177.2021.9586034}, stag_bib_extends_levelofaccess = {NA}, author = {Seferi, Y. and Cetina, R.G.Q. and Blair, S.M.} } @Proceedings { ChenMSd2021, subid = {2309}, title = {Traceable calibration system for non-conventional current sensors with analogue or digital output}, journal = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems}, year = {2021}, month = {9}, day = {29}, volume = {-}, number = {-}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {6}, keywords = {digital, current transformer, merging unit, standalone merging unit, traceability, calibration, sampled values}, web_url = {https://zenodo.org/record/5704497}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Cagliari, Italy}, event_name = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {29-09-2021 to 01-10-2021}, language = {30}, ISBN = {Electronic ISBN:978-1-7281-692}, ISSN = {Electronic ISSN: 2475-2304 Pri}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {Electronic ISBN:978-1-7281-6923-1 Print on Demand(PoD) ISBN:978-1-7281-6924-8}, author = {Chen, Y. and Mohns, E. and Seckelmann, M. and de Rose, S.} } @Article { FogliettaGBCBFDSC2021, subid = {2263}, title = {5-Aminolevulinic Acid Triggered by Ultrasound Halts Tumor Proliferation in a Syngeneic Model of Breast Cancer}, journal = {Pharmaceuticals}, year = {2021}, month = {9}, day = {25}, volume = {14}, number = {10}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {972}, keywords = {ultrasound; sonodynamic therapy; breast cancer}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8247}, DOI = {10.3390/ph14100972}, stag_bib_extends_levelofaccess = {NA}, author = {Foglietta, F. and Gola, G. and Biasibetti, E. and Capucchio, M.T. and Bruni, I. and Francovich, A. and Durando, G. and Serpe, L. and Canaparo, R.} } @Article { AguirrePPSM2021, subid = {2450}, title = {SPICE Simulation of RRAM-Based Cross-Point Arrays Using the Dynamic Memdiode Model}, journal = {Frontiers in Physics}, year = {2021}, month = {9}, day = {23}, volume = {9}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {735021}, keywords = {RRAM, resistive switching, cross-point, memristor, neuromorphic, pattern recognition, write-verify,frequency}, web_url = {https://www.frontiersin.org/articles/10.3389/fphy.2021.735021/full}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2021.735021}, stag_bib_extends_levelofaccess = {NA}, author = {Aguirre, F.L. and Pazos, S.M. and Palumbo, F. and Su{\~n}{\'e}, J. and Miranda, E.} } @Proceedings { SongWEZYK2021, subid = {2252}, title = {10 MW mechanical power transfer standard for nacelle test benches using a torque transducer and an inclinometer}, journal = {Measurement: Sensors}, year = {2021}, month = {9}, day = {22}, volume = {18}, number2 = {19ENG08: WindEFCY: Traceable mechanical and electrical power measurement for efficiency determination of wind turbines}, pages = {100249}, keywords = {nacelle test bench, wind turbine, inclinometer, rotational speed measurement, mechanical power measurement}, misc2 = {EMPIR 2019: Engergy}, publisher = {Elsevier BV}, event_place = {Yokohama, JAPAN}, event_name = {XXIII IMEKO World Congress}, event_date = {30-08-2021 to 03-09-2021}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100249}, stag_bib_extends_levelofaccess = {NA}, author = {Song, Z. and Weidinger, P. and Eich, N. and Zhang, H. and Yogal, N. and Kumme, R.} } @Article { ForssenSZAZ2021, subid = {2174}, title = {The Short-Term Performances of Two Independent Gas Modulated Refractometers for Pressure Assessments}, journal = {Sensors}, year = {2021}, month = {9}, day = {18}, volume = {21}, number = {18}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {6272}, keywords = {refractometry,pressure, short-term performance,Fabry–Perot cavity, gas modulation, modulation techniques, metrology}, web_url = {https://www.mdpi.com/1424-8220/21/18/6272}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21186272}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Zakrisson, J. and Axner, O. and Zelan, M.} } @Article { ArduiniMSEH2021, subid = {2199}, title = {Development and Evaluation of an Improved Apparatus for Measuring the Emissivity at High Temperatures}, journal = {Sensors}, year = {2021}, month = {9}, day = {17}, volume = {21}, number = {18}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, pages = {6252}, keywords = {emissivity, reflectivity, infrared radiation, high temperature, FTIR-spectrometer, blackbody,uncertainty, X-point, inductive heating, direct radiative method}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21186252}, stag_bib_extends_levelofaccess = {NA}, author = {Arduini, M. and Manara, J. and Stark, T. and Ebert, H-P. and Hartmann, J.} } @Article { TangSJHCMT2021, subid = {2730}, title = {Cavity-immune spectral features in the pulsed superradiant crossover regime}, journal = {Physical Review Research}, year = {2021}, month = {9}, day = {17}, volume = {3}, number = {3}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {superradiance}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.3.033258}, stag_bib_extends_levelofaccess = {NA}, author = {Tang, M. and Sch{\"a}ffer, S.A. and J{\o}rgensen, A.A. and Henriksen, M.R. and Christensen, B.T.R. and M{\"u}ller, J.H. and Thomsen, J.W.} } @Article { LainelaLHCACS2021, subid = {2180}, title = {Toward Unified pH of Saline Solutions}, journal = {Water}, year = {2021}, month = {9}, day = {15}, volume = {13}, number = {18}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {2522}, keywords = {acidity;seawater;pH scales; unified scaleabsolute pHdifferential potentiometric measurementsminimization of liquid junction potential ionic liquid salt bridgesresidual liquid junction potential}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4441}, DOI = {10.3390/w13182522}, stag_bib_extends_levelofaccess = {NA}, author = {Lainela, S. and Leito, I. and Heering, A. and Capitaine, G. and Anes, B. and Cam{\~o}es, F. and Stoica, D.} } @Article { LainelaLHCACS2021_2, subid = {2288}, title = {Toward Unified pH of Saline Solutions}, journal = {Water}, year = {2021}, month = {9}, day = {15}, volume = {13}, number = {18}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {2522}, keywords = {acidity; seawater; pH scales; unified scale; absolute pH; differential potentiometric measurements; minimization of liquid junction potential; ionic liquid salt bridges; residual liquid junction potential}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4441}, DOI = {10.3390/w13182522}, stag_bib_extends_levelofaccess = {NA}, author = {Lainela, S. and Leito, I. and Heering, A. and Capitaine, G. and Anes, B. and Cam{\~o}es, F. and Stoica, D.} } @Article { BuonacorsiSSTKHHRWB2021, subid = {2168}, title = {Non-adiabatic single-electron pumps in a dopant-free GaAs/AlGaAs 2DEG}, journal = {Applied Physics Letters}, year = {2021}, month = {9}, day = {13}, volume = {119}, number = {11}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {114001}, keywords = {Single electron transport, quantum dot, dopant-free GaAs/AlGaAs system, quantum transport, single electron pump}, web_url = {https://arxiv.org/abs/2102.13320}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0062486}, stag_bib_extends_levelofaccess = {NA}, author = {Buonacorsi, B. and Sfigakis, F. and Shetty, A. and Tam, M.C. and Kim, H.S. and Harrigan, S.R. and Hohls, F. and Reimer, M.E. and Wasilewski, Z.R. and Baugh, J.} } @Article { VasilatouWKHISSSWA2021, subid = {2082}, title = {Calibration of optical particle size spectrometers against a primary standard: Counting efficiency profile of the TSI Model 3330 OPS and Grimm 11-D monitor in the particle size range from 300 nm to 10 \(\mu\)m}, journal = {Journal of Aerosol Science}, year = {2021}, month = {9}, volume = {157}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {105818}, keywords = {calibration, aerosol spectrometers, PSL particles, primary standard, particle number concentration}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2021.105818}, stag_bib_extends_levelofaccess = {NA}, author = {Vasilatou, K. and W{\"a}lchli, C. and Koust, S. and Horender, S. and Iida, K. and Sakurai, H. and Schneider, F. and Spielvogel, J. and Wu, T.Y. and Auderset, K.} } @Article { SeegerT2021, subid = {2194}, title = {Primary calibration of mechanical sensors with digital output for dynamic applications}, journal = {Acta IMEKO}, year = {2021}, month = {9}, volume = {10}, number = {3}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, pages = {177 - 184}, keywords = {Primary calibration; MEMS; complex frequency response; digital interface; dynamic measurement}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-10\%20\%282021\%29-03-24/0}, misc2 = {EMPIR 2017: Industry}, publisher = {IMEKO}, address = {Braunschweig}, language = {30}, ISSN = {2221-870X}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {IMEKO-ACTA-10 (2021)-03-24}, author = {Seeger, B. and Thomas, B.} } @Article { StoreyBPOHWBH2021, subid = {2597}, title = {Single base mutations in the nucleocapsid gene of SARS-CoV-2 affects amplification efficiency of sequence variants and may lead to assay failure}, journal = {Journal of Clinical Virology Plus}, year = {2021}, month = {9}, volume = {1}, number = {3}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {100037}, keywords = {SARS-CoV-2, Nucleocapsid, Mutations, PCR, Failure, Silico}, web_url = {https://www.sciencedirect.com/science/article/pii/S2667038021000296}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2667-0380}, DOI = {10.1016/j.jcvp.2021.100037}, stag_bib_extends_levelofaccess = {NA}, author = {Storey, N. and Brown, J.R. and Pereira, R.P.A. and O'Sullivan, D.M. and Huggett, J.F. and Williams, R. and Breuer, J. and Harris, K.A.} } @Article { DollemanCLvSS2021, subid = {2244}, title = {Squeeze-Film Effect on Atomically Thin Resonators in the High-Pressure Limit}, journal = {Nano Letters}, year = {2021}, month = {8}, day = {30}, volume = {21}, number = {18}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {7617-7624}, keywords = {graphene, nanoelectromechanical systems (NEMS), pressure sensor, gas damping}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1530-6984, 1530-6992}, DOI = {10.1021/acs.nanolett.1c02237}, stag_bib_extends_levelofaccess = {NA}, author = {Dolleman, R.J. and Chakraborty, D. and Ladiges, D.R. and van der Zant, H.S.J. and Sader, J.E. and Steeneken, P.G.} } @Article { SmithHKWPSDS2021, subid = {2242}, title = {High precision integrated photonic thermometry enabled by a transfer printed diamond resonator on GaN waveguide chip}, journal = {Optics Express}, year = {2021}, month = {8}, day = {25}, volume = {29}, number = {18}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {29095}, keywords = {photonic thermometer, diamond micro-disk resonator}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.433607}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, J.A. and Hill, P. and Klitis, C. and Weituschat, L. and Postigo, P.A. and Sorel, M. and Dawson, M.D. and Strain, M.J.} } @Article { DorstRESS2021, subid = {2170}, title = {Influence of synchronization within a sensor network on machine learning results}, journal = {Journal of Sensors and Sensor Systems}, year = {2021}, month = {8}, day = {24}, volume = {10}, number = {2}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, pages = {233-245}, keywords = {synchronization, machine learning, sensor network}, web_url = {https://jsss.copernicus.org/articles/10/233/2021/}, misc2 = {EMPIR 2017: Industry}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-10-233-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Dorst, T. and Robin, Y. and Eichst{\"a}dt, S. and Sch{\"u}tze, A. and Schneider, T.} } @Article { SteinKP2021, subid = {2160}, title = {A Unified Theory for 3D Gear and Thread Metrology}, journal = {Applied Sciences}, year = {2021}, month = {8}, day = {19}, volume = {11}, number = {16}, number2 = {19ENG07: Met4Wind: Metrology for enhanced reliability and efficiency of wind energy systems}, pages = {7611}, keywords = {coordinate metrology, gear metrology, thread metrology, helical machine elements, holistic evaluation, areal measurements}, misc2 = {EMPIR 2019: Engergy}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11167611}, stag_bib_extends_levelofaccess = {NA}, author = {Stein, M. and Keller, F. and Przyklenk, A.} } @Article { SilemekSPHPSRIW2021, subid = {2173}, title = {Rapid safety assessment and mitigation of radiofrequency induced implant heating using small root mean square sensors and the sensor matrix Q s}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {8}, day = {16}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {magnetic resonance imaging, MR safety, implant safety, parallel transmission, sensor-equipped implants, rms sensors}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/mrm.28968}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28968}, stag_bib_extends_levelofaccess = {NA}, author = {Silemek, B. and Seifert, F. and Petzold, J. and Hoffmann, W. and Pfeiffer, H. and Speck, O. and Rose, G. and Ittermann, B. and Winter, L.} } @Article { SteenekenDDAv2021, subid = {2239}, title = {Dynamics of 2D material membranes}, journal = {2D Materials}, year = {2021}, month = {8}, day = {12}, volume = {8}, number = {4}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {042001}, keywords = {2D material, dynamics, mechanics, graphene, NEMS}, web_url = {https://arxiv.org/ct?url=https\%3A\%2F\%2Fdx.doi.org\%2F10.1088\%2F2053-1583\%2Fac152c\&v=8246bcbf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/ac152c}, stag_bib_extends_levelofaccess = {NA}, author = {Steeneken, P.G. and Dolleman, R.J. and Davidovikj, D. and Alijani, F. and van der Zant, H.S.J.} } @Article { NagelSDL2021, subid = {2439}, title = {A bi-atrial statistical shape model for large-scale in silico studies of human atria: Model development and application to ECG simulations}, journal = {Medical Image Analysis}, year = {2021}, month = {8}, day = {10}, volume = {Volume 74}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, keywords = {Statistical shape modelingBi-atrial shape modelElectrophysiological simulation12-Lead ECGP waves}, web_url = {https://www.sciencedirect.com/science/article/pii/S1361841521002553?via\%3Dihub}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.media.2021.102210}, stag_bib_extends_levelofaccess = {NA}, author = {Nagel, C. and Schuler, S. and D{\"o}ssel, O. and Loewe, A.} } @Article { AhlawatSGTW2021, subid = {2479}, title = {Observation of systematic deviations between Faraday cup aerosol electrometers for varying particle sizes and flowrates—results of the AEROMET FCAE workshop}, journal = {Metrologia}, year = {2021}, month = {8}, day = {5}, volume = {58}, number = {5}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {8}, keywords = {Faraday cup aerosol electrometer, CPC calibration, inter-comparison}, web_url = {https://iopscience.iop.org/journal/0026-1394}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/1681-7575/ac0710}, stag_bib_extends_levelofaccess = {NA}, author = {Ahlawat, A. and Seeger, S. and Gottschalk, M. and Tuch, T. and Wiedensohler, A.} } @Article { EdlerBGJTAASZ2021, subid = {2137}, title = {Pt-40\%Rh Versus Pt-6\%Rh Thermocouples: An emf-Temperature Reference Function for the Temperature Range 0 \(^{\circ}\)C to 1769 \(^{\circ}\)C}, journal = {International Journal of Thermophysics}, year = {2021}, month = {8}, volume = {42}, number = {11}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {1-13}, keywords = {Noble metal thermocouples, Reference function, Thermoelectric stability and homogeneity}, web_url = {https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf.}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-021-02895-w}, stag_bib_extends_levelofaccess = {NA}, author = {Edler, F. and Bojkovski, J. and Garcia Izquerdo, C. and Jose Martin, M. and Tucker, D. and Arifovic, N. and Andersen, S.L. and Šindel{\'a}rov{\'a}, L. and Žužek, V.} } @Article { SousaBDFPRM2021, subid = {2153}, title = {Uncertainty calculation methodologies in microflow measurements: Comparison of GUM, GUM-S1 and Bayesian approach}, journal = {Measurement}, year = {2021}, month = {8}, volume = {181}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, pages = {109589}, keywords = {Uncertainty evaluation; Accuracy; Microflow measurement; Syringe pump; Gravimetric method; Bayesian approach}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2021.109589}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Batista, E. and Demeyer, S. and Fischer, N. and Pellegrino, O. and Ribeiro, A.S. and Martins, L.L.} } @Proceedings { deGrootCSCL2021_2, subid = {2433}, title = {Fourier optics modelling of coherence scanning interferometers}, journal = {Applied Optical Metrology IV - Proc. of SPIE}, year = {2021}, month = {8}, volume = {11817}, number2 = {20IND07: TracOptic: Traceable industrial 3D roughness and dimensional measurement using optical 3D microscopy and optical distance sensors}, pages = {118170M}, keywords = {Interferometry, interferometer, metrology, topography, CSI, Fourier optics}, web_url = {https://repository.lboro.ac.uk/articles/conference_contribution/Fourier_optics_modelling_of_coherence_scanning_interferometers/16948690}, misc2 = {EMPIR 2020: Industry}, event_place = {San Diego, California}, event_name = {SPIE Optical Engineering + Applications}, event_date = {01-08-2021 to 05-08-2021}, language = {30}, DOI = {10.1117/12.2595668}, stag_bib_extends_levelofaccess = {NA}, author = {de Groot, P. and Colonna de Lega, X. and Su, R. and Coupland, J. and Leach, R.} } @Article { BarrattRCSKE2021, subid = {2167}, title = {Asymmetric arms maximize visibility in hot-electron interferometers}, journal = {Physical Review B}, year = {2021}, month = {7}, day = {30}, volume = {104}, number = {3}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {035436}, keywords = {single electrons, electron interferometry, quantum transport, electron quantum optics}, web_url = {https://arxiv.org/abs/2104.01653}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.104.035436}, stag_bib_extends_levelofaccess = {NA}, author = {Barratt, C.J. and Ryu, S. and Clark, L.A. and Sim, H.-S. and Kataoka, M. and Emary, C.} } @Article { FogliettaPGBPDTSC2021, subid = {2264}, title = {Sonodynamic Treatment Induces Selective Killing of Cancer Cells in an In Vitro Co-Culture Model}, journal = {Cancers}, year = {2021}, month = {7}, day = {30}, volume = {13}, number = {15}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {3852}, keywords = {ultrasound; sonodynamic therapy; cancer cells; membrane fluidity}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-6694}, DOI = {10.3390/cancers13153852}, stag_bib_extends_levelofaccess = {NA}, author = {Foglietta, F. and Pinnelli, V. and Giuntini, F. and Barbero, N. and Panzanelli, P. and Durando, G. and Terreno, E. and Serpe, L. and Canaparo, R.} } @Article { RadtkeCKLSDAHNVRQLDBUL2021, subid = {2285}, title = {A unified pH scale for all solvents: part I – intention and reasoning (IUPAC Technical Report)}, journal = {Pure and Applied Chemistry}, year = {2021}, month = {7}, day = {30}, volume = {93}, number = {9}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1049-1060}, keywords = {Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {0033-4545, 1365-3075}, DOI = {10.1515/pac-2019-0504}, stag_bib_extends_levelofaccess = {NA}, author = {Radtke, V. and Cam{\~o}es, F. and Krossing, I. and Leito, I. and Stoica, D. and Deleebeeck, L. and Anes, B. and Heering, A. and N{\"a}ykki, T. and Veltz{\'e}, S. and Rozikov{\'a}, M. and Quendera, R. and Liv, L. and D{\'a}niel, N. and Bastkowski, F. and Uysal, E. and Lawrence, N.} } @Article { SilvaniKTC2021, subid = {2426}, title = {Impact of the interfacial Dzyaloshinskii-Moriya interaction on the band structure of one-dimensional artificial magnonic crystals: a micromagnetic study}, journal = {Journal of Magnetism and magnetic Materials}, year = {2021}, month = {7}, day = {27}, volume = {539}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {168342}, keywords = {Magnonic Crystals, spin waves, DMI}, web_url = {https://doi.org/10.1016/j.jmmm.2021.168342}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier}, language = {30}, ISSN = {0304-8853}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2112.05360}, author = {Silvani, R. and Kuepferling, M. and Tacchi, S. and Carlotti, G.} } @Article { RibeiroACSMLBSS2021, subid = {2198}, title = {Role of measurement uncertainty in the comparison of average areal rainfall methods}, journal = {Metrologia}, year = {2021}, month = {7}, day = {23}, volume = {58}, number = {4}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, pages = {044001}, keywords = {measurement uncertainty, rainfall, precipitation, estimating, arithmetic mean method, Thiessen polygon method, isohyetal method}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IOP Publishing}, address = {Bristol, United Kingdom}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac0d49}, stag_bib_extends_levelofaccess = {NA}, author = {Ribeiro, A.S. and Almeida, M.C. and Cox, M.G. and Sousa, J.A. and Martins, L. and Loureiro, D. and Brito, R. and Silva, M. and Soares, A.C.} } @Article { TranGiaDFRCFFFGHJKLMSSGTWBBBBCCCCDDGHKKLMMSSSSVWL2021, subid = {2260}, title = {A multicentre and multi-national evaluation of the accuracy of quantitative Lu-177 SPECT/CT imaging performed within the MRTDosimetry project}, journal = {EJNMMI Physics}, year = {2021}, month = {7}, day = {23}, volume = {8}, number = {1}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, keywords = {Quantitative SPECT/CT, 177Lu SPECT/CT imaging, Standardization ofSPECT/CT imaging, Harmonization of SPECT/CT imaging, International multicentercomparison exercise, Traceability of SPECT/CT imaging, Molecular radiotherapy(MRT), 3D printing, Phantom}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2197-7364}, DOI = {10.1186/s40658-021-00397-0}, stag_bib_extends_levelofaccess = {NA}, author = {Tran-Gia, J. and Denis-Bacelar, A.M. and Ferreira, K.M. and Robinson, A.P. and Calvert, N. and Fenwick, A.J. and Finocchiaro, D. and Fioroni, F. and Grassi, E. and Heetun, W. and Jewitt, S.J. and Kotzassarlidou, M. and Ljungberg, M. and McGowan, D.R. and Scott, N. and Scuffham, J. and Gleisner, K.S. and Tipping, J. and Wevrett, J. and Bardi{\`e}s, M. and Berenato, S. and Bilas, I. and Bobin, C. and Capogni, M. and Chauvin, M. and COLLINS, S. and Cox, M. and Dabin, J. and D’Arienzo, M. and Gustafsson, J. and Hallam, A. and Kalathas, T. and Kayal, G. and Lorusso, G. and Maringer, F-J. and Morgan, D. and Smyth, V. and Solc, J. and Štemberkov{\'a}, L. and Struelens, L. and Vergara-Gil, A. and Wiedner, H. and Lassmann, M.} } @Article { ChinchellaCSL2021, subid = {2393}, title = {Investigation of the Wind-Induced Airflow Pattern Near the Thies LPM Precipitation Gauge}, journal = {Sensors}, year = {2021}, month = {7}, day = {17}, volume = {21}, number = {14}, number2 = {18NRM03: INCIPIT: Calibration and accuracy of non-catching instruments to measure liquid/solid atmospheric precipitation}, pages = {4880}, keywords = {precipitation, measurement, non-catching gauges, wind induced bias, computational fluid dynamics, wind tunnel, disdrometer}, web_url = {https://www.mdpi.com/1424-8220/21/14/4880}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {MDPI}, language = {30}, ISSN = {14248220}, DOI = {10.3390/s21144880}, stag_bib_extends_levelofaccess = {NA}, author = {Chinchella, E. and Cauteruccio, A. and Stagnaro, M. and Lanza, L.G.} } @Article { tenHaveAHPMSL2021, subid = {2120}, title = {Estimation of Static Energy Meter Interference in Waveforms Obtained in On-Site Scenarios}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2021}, month = {7}, day = {12}, volume = {1}, number = {1}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {1-8}, keywords = {Electromagnetic interference (EMI), nonlinear waveforms, on-site survey, static energy meters, time domain.}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2021.3089877}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Azpurua, M.A. and Hartman, T. and Pous, M. and Moonen, N. and Silva, F. and Leferink, F.} } @Article { CrouzierDDASH2021, subid = {2045}, title = {Influence of electron landing energy on the measurement of the dimensional properties of nanoparticle populations imaged by SEM}, journal = {Ultramicroscopy}, year = {2021}, month = {7}, volume = {226}, number = {July}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {113300}, keywords = {SEMElectron landing energyNanoparticlesDimensional propertiesMetrology}, web_url = {https://reader.elsevier.com/reader/sd/pii/S0304399121000875?token=909C79CE3C3F38B3A66DB9C19F03753326F07A8C27AA6D2752B29C970B6044F466C12F79E394D396CE7598E6F1497E2E\&originRegion=eu-west-1\&originCreation=20210517160957}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2021.113300}, stag_bib_extends_levelofaccess = {NA}, author = {Crouzier, L. and Delvall{\'e}e, A. and Devoille, L. and Artous, S. and Saint-Antonin, F. and Feltin, N.} } @Article { SilanderFZZA2021, subid = {2110}, title = {Optical realization of the pascal—Characterization of two gas modulated refractometers}, journal = {Journal of Vacuum Science \& Technology B}, year = {2021}, month = {7}, volume = {39}, number = {4}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {044201}, keywords = {Refractomtery, Fabry-Perot cavity, GAMOR, Accuracy}, web_url = {https://avs.scitation.org/doi/10.1116/6.0001042}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/6.0001042}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Article { VargasCMRPLNSL2021, subid = {2114}, title = {Comparison of airborne radiation detectors carried by rotary-wing unmanned aerial systems}, journal = {Radiation Measurements}, year = {2021}, month = {7}, volume = {145}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106595}, keywords = {Airborne radiological detectorUnmanned aerial systemEnvironmental radioactivity mappingSource localization}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106595}, stag_bib_extends_levelofaccess = {NA}, author = {Vargas, A. and Costa, D. and Macias, M. and Royo, P. and Pastor, E. and Luchkov, M. and Neumaier, S. and St{\"o}hlker, U. and Luff, R.} } @Article { KruskopfBPCPREPPGS2021, subid = {2113}, title = {Graphene Quantum Hall Effect Devices for AC and DC Electrical Metrology}, journal = {IEEE Transactions on Electron Devices}, year = {2021}, month = {7}, volume = {68}, number = {7}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {3672-3677}, keywords = {Alternating current, dissipation factor,double-shield, epitaxial graphene, magnetocapacitance,magnetotransport, precision measurements, quantized Hallresistance (QHR) standards, quantum Hall effect (QHE),superconducting contacts}, web_url = {https://ieeexplore.ieee.org/document/9446081}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9383, 1557-9646}, DOI = {10.1109/TED.2021.3082809}, stag_bib_extends_levelofaccess = {NA}, author = {Kruskopf, M. and Bauer, S. and Pimsut, Y. and Chatterjee, A. and Patel, D.K. and Rigosi, A.F. and Elmquist, R.E. and Pierz, K. and Pesel, E. and G{\"o}tz, M. and Schurr, J.} } @Article { AxnerFSZZ2021, subid = {2135}, title = {Ability of gas modulation to reduce the pickup of drifts in refractometry}, journal = {Journal of the Optical Society of America B}, year = {2021}, month = {7}, volume = {38}, number = {8}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {2419-2436}, keywords = {Refractometry, Pascal, Pressure, Fabry-Perot cavity, Gas modulation, GAMOR, drifts,}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society of America}, language = {30}, ISSN = {0740-3224, 1520-8540}, DOI = {10.1364/JOSAB.420982}, stag_bib_extends_levelofaccess = {NA}, author = {Axner, O. and Forss{\'e}n, C. and Silander, I. and Zakrisson, J. and Zelan, M.} } @Article { PanSZGPIGMGP2021, subid = {2715}, title = {Acoustic measurement of the triple point of neon T Ne and thermodynamic calibration of a transfer standard for accurate cryogenic thermometry}, journal = {Metrologia}, year = {2021}, month = {7}, volume = {58}, number = {4}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {045006}, keywords = {Acoustic measurement, triple point of neon}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/ac0711}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac0711}, stag_bib_extends_levelofaccess = {NA}, author = {Pan, C. and Sparasci, F. and Zhang, H. and Gambette, P. and Plimmer, M. and Imbraguglio, D. and Gavioso, R.M. and Moldover, M.R. and Gao, B. and Pitre, L.} } @Article { MarzanoTDSEOPKC2021, subid = {2115}, title = {Design and development of a coaxial cryogenic probe for precision measurements of the quantum Hall effect in the AC regime}, journal = {ACTA IMEKO}, year = {2021}, month = {6}, day = {29}, volume = {10}, number = {2}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {24}, keywords = {Quantum Hall effect, Metrology, Impedance, Graphene, Cryogenic probe}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-10\%20\%282021\%29-02-05}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v10i2.925}, stag_bib_extends_levelofaccess = {NA}, author = {Marzano, M. and Tran, N.T.M. and D'Elia, V. and Serazio, D. and Enrico, E. and Ortolano, M. and Pierz, K. and Kucera, J. and Callegaro, L.} } @Article { SaccoPGR2021, subid = {2618}, title = {Graphene edge method for three‐dimensional probing of Raman microscopes focal volumes}, journal = {Journal of Raman Spectroscopy}, year = {2021}, month = {6}, day = {23}, volume = {52}, number = {10}, number2 = {19NRM04: ISO-G-SCoPe: Standardisation of structural and chemical properties of graphene}, pages = {1671-1684}, keywords = {Raman spectroscopy, Metrology, graphene, graphene edge, confocal volume, focal volume, Raman quantification}, web_url = {https://analyticalsciencejournals.onlinelibrary.wiley.com/doi/10.1002/jrs.6187}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Wiley}, language = {30}, ISSN = {0377-0486, 1097-4555}, DOI = {10.1002/jrs.6187}, stag_bib_extends_levelofaccess = {NA}, author = {Sacco, A. and Portesi, C. and Giovannozzi, A.M. and Rossi, A.M.} } @Article { GajjelaHDSSKBMBK2021, subid = {2614}, title = {Structural and compositional analysis of (InGa)(AsSb)/GaAs/GaP Stranski–Krastanov quantum dots}, journal = {Light: Science \& Applications}, year = {2021}, month = {6}, day = {15}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {125}, keywords = {Ga)(AsSb)/GaAs/GaP, Stranski–Krastanov, quantum dots}, web_url = {https://www.nature.com/articles/s41377-021-00564-z}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/s41377-021-00564-z}, stag_bib_extends_levelofaccess = {NA}, author = {Gajjela, R.S.R. and Hendriks, A.L. and Douglas, J.O. and Sala, E.M. and Steindl, P. and Klenovsk{\'y}, P. and Bagot, P.A.J. and Moody, M.P. and Bimberg, D. and Koenraad, P.M.} } @Article { SetionoFDFSSWP2021, subid = {2363}, title = {Performance of an Electrothermal MEMS Cantilever Resonator with Fano-Resonance Annoyance under Cigarette Smoke Exposure}, journal = {Sensors}, year = {2021}, month = {6}, day = {14}, volume = {21}, number = {12}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {4088}, keywords = {electrothermal piezoresistive cantilever sensors, parasitic feedthrough subtraction, particle mass concentration measurement, cigarette smoke exposure}, web_url = {https://www.mdpi.com/1424-8220/21/12/4088}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21124088}, stag_bib_extends_levelofaccess = {NA}, author = {Setiono, A. and Fahrbach, M. and Deutschinger, A. and Fantner, E.J. and Schwalb, C.H. and Syamsu, I. and Wasisto, H.S. and Peiner, E.} } @Proceedings { ThompsonRSEHL2021, subid = {2410}, title = {Calibration of X-ray computed tomography for surface topography measurement using metrological characteristics}, journal = {Proceedings 21st euspen International Conference and Exhibition}, year = {2021}, month = {6}, day = {10}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {Metrology, surface topography, metrological characteristics, X-ray computed tomography}, misc2 = {EMPIR 2017: Industry}, event_place = {Online Conference}, event_name = {21st euspen International Conference and Exhibition}, event_date = {07-06-2021 to 10-06-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE21165.pdf}, author = {Thompson, A. and Rodr{\'i}guez-S{\'a}nchez, {\'A}. and Senin, N. and Eifler, M. and Hering, J. and Leach, R.} } @Article { euchaHSHOiL2021, subid = {1981}, title = {Compact differential plane interferometer with in-axis mirror tilt detection}, journal = {Optics and Lasers in Engineering}, year = {2021}, month = {6}, volume = {141}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, pages = {106568}, keywords = {Laser interferometryOptical metrologyDimensional measurementCommon path interferometerDifferential interferometerTilt compensationLarge volume metrology}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0143-8166}, DOI = {10.1016/j.optlaseng.2021.106568}, stag_bib_extends_levelofaccess = {NA}, author = {Rerucha, S. and Hola, M. and Sarbort, M. and Hrabina, J. and Oulehla, J. and Č{\'i}p, O. and Lazar, J.} } @Article { SmalesP2021, subid = {2105}, title = {The MOUSE project: a meticulous approach for obtaining traceable, wide-range X-ray scattering information}, journal = {Journal of Instrumentation}, year = {2021}, month = {6}, volume = {16}, number = {06}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {P06034}, keywords = {Inspection with x-rays; Analysis and statistical methods; Data processing methods;Software architectures (event data models, frameworks and databases)}, web_url = {https://iopscience.iop.org/article/10.1088/1748-0221/16/06/P06034}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/16/06/P06034}, stag_bib_extends_levelofaccess = {NA}, author = {Smales, G.J. and Pauw, B.R.} } @Proceedings { SchodelKMTHWSPP2021, subid = {2106}, title = {Design and manufacture of a reference interferometer for long-range distance metrology}, journal = {Proceedings of the euspen 21st International Conference \& Exhibition}, year = {2021}, month = {6}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {511-512}, keywords = {Geodetic length instrumentation, closed-frame design, thermal and long-term stability, manual positioning system, precision assembly}, misc2 = {EMPIR 2018: SI Broader Scope}, event_place = {Copenhagen, DK}, event_name = {euspen 21st International Conference \& Exhibition}, event_date = {07-06-2021 to 11-06-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base/ICE21222.pdf}, author = {Sch{\"o}del, R. and K{\"o}chert, P. and Meyer, T. and Truong, D. and Huismann, J. and Weinrich, S. and Schmaljohann, F. and Pilarski, F. and Pollinger, F.} } @Article { DorosinskiySHL2021, subid = {2121}, title = {Effect of the in-plane field component on the response of the magneto optical indicator film sensors}, journal = {Journal of Magnetism and Magnetic Materials}, year = {2021}, month = {6}, volume = {527}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {167725}, keywords = {Magneto-opticsLocal magnetic field measurementsMetrology}, web_url = {https://www.sciencedirect.com/science/article/pii/S0304885321000019}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-8853}, DOI = {10.1016/j.jmmm.2021.167725}, stag_bib_extends_levelofaccess = {NA}, author = {Dorosinskiy, L. and Sievers, S. and Hu, X. and Lindner, M.} } @Article { KusterYGKS2021, subid = {2191}, title = {Radiofrequency‐induced heating of broken and abandoned implant leads during magnetic resonance examinations}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {6}, volume = {86}, number = {4}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {2156-2164}, keywords = {magnetic resonance imaging, MR safety, implant safety, abandoned leads}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28836}, stag_bib_extends_levelofaccess = {NA}, author = {Kuster, N. and Yao, A. and Goren, T. and Kainz, W. and Samaras, T.} } @Article { DeleebeeckSNSRVHBLQCS2021, subid = {2183}, title = {Unified pH Measurements of Ethanol, Methanol, and Acetonitrile, and Their Mixtures with Water}, journal = {Sensors}, year = {2021}, month = {6}, volume = {21}, number = {11}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {3935}, keywords = {pHabs; ionic liquid salt bridge; commercial glass electrodes; water–alcohol mixture;non-aqueous pH}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21113935}, stag_bib_extends_levelofaccess = {NA}, author = {Deleebeeck, L. and Snedden, A. and Nagy, D. and Szil{\'a}gyi Nagyn{\'e}, Z. and Rozikov{\'a}, M. and Vičarov{\'a}, M. and Heering, A. and Bastkowski, F. and Leito, I. and Quendera, R. and Cabral, V. and Stoica, D.} } @Article { PicolloBBSORR2021, subid = {2266}, title = {Creation of pure non-crystalline diamond nanostructures via room-temperature ion irradiation and subsequent thermal annealing}, journal = {Nanoscale Advances}, year = {2021}, month = {6}, volume = {3}, number = {14}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {4156-4165}, keywords = {Diamond, Irradiation, Carbon, Imaging}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2021/NA/D1NA00136A}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2516-0230}, DOI = {10.1039/d1na00136a}, stag_bib_extends_levelofaccess = {NA}, author = {Picollo, F. and Battiato, A. and Bosia, F. and Scaffidi Muta, F. and Olivero, P. and Rigato, V. and Rubanov, S.} } @Article { KnotekBCKHUKS2021, subid = {2369}, title = {Measurements of water consumption for the development of new test regimes for domestic water meters}, journal = {Flow Measurement and Instrumentation}, year = {2021}, month = {6}, volume = {79}, number = {-}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, pages = {101963}, keywords = {water consumption, consumption measurement, water meters, dynamic loads, billing}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2021.101963}, stag_bib_extends_levelofaccess = {NA}, author = {Knotek, S. and Benkova, M. and Christophersen, N. and Kondrup, J.B. and Haack, S. and Unsal, B. and Kroner, C. and Schumann, D.} } @Article { OzturkSOGFSS2021, subid = {2483}, title = {A Ti/Pt/Co Multilayer Stack for Transfer Function Based Magnetic Force Microscopy Calibrations}, journal = {Magnetochemistry}, year = {2021}, month = {6}, volume = {7}, number = {6}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {78}, keywords = {magnetic force microscopy; calibration; reference samples; micromagnetism; metrology for magnetism; magnetic multilayers}, web_url = {https://arxiv.org/abs/2201.09763}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2312-7481}, DOI = {10.3390/magnetochemistry7060078}, stag_bib_extends_levelofaccess = {NA}, author = {{\"O}zt{\"u}rk, O. and Schumacher, H.W. and {\"O}ztoprak, İ. and Garcia-Sanchez, F. and Fern{\'a}ndez Scarioni, A. and Sievers, S. and Sakar, B.} } @Article { PicolloBBSORR20210, subid = {2266}, title = {Creation of pure non-crystalline diamond nanostructures via room-temperature ion irradiation and subsequent thermal annealing}, journal = {Nanoscale Advances}, year = {2021}, month = {6}, volume = {3}, number = {14}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4156-4165}, keywords = {Diamond, Irradiation, Carbon, Imaging}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2021/NA/D1NA00136A}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2516-0230}, DOI = {10.1039/d1na00136a}, stag_bib_extends_levelofaccess = {NA}, author = {Picollo, F. and Battiato, A. and Bosia, F. and Scaffidi Muta, F. and Olivero, P. and Rigato, V. and Rubanov, S.} } @Proceedings { ArsovicMS2021, subid = {2610}, title = {An approach to improve accuracy and productivity of industrial CMM measurements at high scanning speed}, journal = {euspen’s 21st International Conference \& Exhibition, Copenhagen, DK, June 2021}, year = {2021}, month = {6}, number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry}, keywords = {Coordinate measuring machine, measurement uncertainty, contact scanning probing mode}, web_url = {https://www.euspen.eu/knowledge-base/ICE21150.pdf}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Virtual Conference - Copenhagen, Denmark}, event_name = {euspen’s 21st International Conference \& Exhibition}, event_date = {07-06-2021 to 10-06-2021}, language = {30}, DOI = {10.5281/zenodo.6323538}, stag_bib_extends_levelofaccess = {NA}, author = {Arsovic, A. and Menoncin, M. and Savio, E.} } @Proceedings { ZaniniSC2021, subid = {2611}, title = {Uncertainty determination of X-ray computed tomography dimensional measurements of additively manufactured metal lattice structures}, journal = {euspen’s 21st International Conference \& Exhibition, Copenhagen, DK, June 2021}, year = {2021}, month = {6}, number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry}, keywords = {X-ray computed tomography, Additive manufacturing, Lattice structures, Dimensional metrology, uncertainty}, web_url = {https://www.euspen.eu/knowledge-base/ICE21306.pdf}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Virtual Conference - Copenhagen, Denmark}, event_name = {euspen’s 21st International Conference \& Exhibition}, event_date = {07-06-2021 to 10-06-2021}, language = {30}, DOI = {10.5281/zenodo.6323598}, stag_bib_extends_levelofaccess = {NA}, author = {Zanini, F. and Savio, E. and Carmignato, S.} } @Article { LoweSSMP2021, subid = {2076}, title = {Design, construction and traceable calibration of a phosphor-based fibre-optic thermometer from 0 \(^{\circ}\)C to 650 \(^{\circ}\)C}, journal = {Measurement Science and Technology}, year = {2021}, month = {5}, day = {28}, volume = {32}, number = {9}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {094004}, keywords = {Phosphor thermometry, temperature, temperature measurement, traceability, harsh environments, EMPRESS 2}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abee53}, stag_bib_extends_levelofaccess = {NA}, author = {Lowe, D. and Sutton, G. and Sposito, A. and Machin, G. and Pearce, J.} } @Article { LanzaMCCSDGNKRCMBP2021, subid = {2392}, title = {Calibration of non-catching precipitation measurement instruments: A review}, journal = {Meteorological Applications}, year = {2021}, month = {5}, day = {25}, volume = {28}, number = {3}, number2 = {18NRM03: INCIPIT: Calibration and accuracy of non-catching instruments to measure liquid/solid atmospheric precipitation}, pages = {e2002}, keywords = {calibration, hydro-meteorology, meteomet, non-catching gauges, precipitation, precipitation measurement and analysis, uncertainty analysis, verification}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/met.2002}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {RMets}, language = {30}, ISSN = {14698080}, DOI = {10.1002/met.2002}, stag_bib_extends_levelofaccess = {NA}, author = {Lanza, L.G. and Merlone, A. and Cauteruccio, A. and Chinchella, E. and Stagnaro, M. and Dobre, M. and Garcia Izquierdo, M.C. and Nielsen, J. and Kjeldsen, H. and Roulet, Y.A. and Coppa, G. and Musacchio, C. and Bordianu, C. and Parrondo, M.} } @Article { RebufelloPASGDCVDG2021, subid = {2446}, title = {Anomalous weak values via a single photon detection}, journal = {Light: Science \& Applications}, year = {2021}, month = {5}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Quantum Measurement, Weak Values, Single Photons, Quantum Metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/s41377-021-00539-0}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and Avella, A. and Souza, M.A. de and Gramegna, M. and Dziewior, J. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { PetryDSCCD2021, subid = {2072}, title = {Uncertainty evaluation in atomic force microscopy measurement of nanoparticles based on statistical mixed model in a Bayesian framework}, journal = {Measurement Science and Technology}, year = {2021}, month = {5}, day = {19}, volume = {32}, number = {8}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, pages = {085008}, keywords = {AFM,mixed model,uncertainty calculation,Bayesian statistics,design of experiment}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abe47f}, stag_bib_extends_levelofaccess = {NA}, author = {P{\'e}try, J. and De Boeck, B. and Seba{\"i}hi, N. and Coenegrachts, M. and Caebergs, T. and Dobre, M.} } @Article { AxnerSFZZ2021, subid = {1990}, title = {Assessment of gas molar density by gas modulation refractometry: A review of its basic operating principles and extraordinary performance}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2021}, month = {5}, volume = {179}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {106121}, keywords = {Gas modulation refractometry (GAMOR)Fabry-Perot cavityPrecisionAccuracyGas molar (or number) density}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2021.106121}, stag_bib_extends_levelofaccess = {NA}, author = {Axner, O. and Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Zelan, M.} } @Article { KazemipourHWHRSAGZ2021, subid = {2048}, title = {Standard Load Method: A New Calibration Technique for Material Characterization at Terahertz Frequencies}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, month = {5}, volume = {70}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1007310}, keywords = {Material characterization, measurement uncertainty, parameter extraction, standard load, vector network analyzer (VNA) time gating}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2021.3077660}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Hudlicka, M. and R{\"u}fenacht, J. and Stalder, D. and Allal, D. and G{\"a}umann, G. and Zeier, M.} } @Article { SiekkinenKKSFSTISTT2021, subid = {2109}, title = {Assessment of a digital and an analog PET/CT system for accurate myocardial perfusion imaging with a flow phantom}, journal = {Journal of Nuclear Cardiology}, year = {2021}, month = {5}, volume = {n/a}, number = {n/a}, number2 = {19SIP04: TracPETperf: Software for evaluating PET cardiac perfusion imaging uncertainties for more accurate diagnosis}, pages = {n/a}, keywords = {digital and analog PET/CT system, myocardial perfusion imaging, flow phantom}, misc2 = {EMPIR 2019: Support for Impact}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1071-3581, 1532-6551}, DOI = {10.1007/s12350-021-02631-9}, stag_bib_extends_levelofaccess = {NA}, author = {Siekkinen, R. and Kirjavainen, A.K. and Koskensalo, K. and Smith, N.A.S. and FENWICK, A. and Saunavaara, V. and Tolvanen, T. and Iida, H. and Saraste, A. and Ter{\"a}s, M. and Teuho, J.} } @Article { KlapetekGNVSN2021, subid = {2318}, title = {GSvit — An open source FDTD solver for realistic nanoscale optics simulations}, journal = {Computer Physics Communications}, year = {2021}, month = {5}, volume = {265}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {108025}, keywords = {FDTD, Plasmonics, Optics, Roughness}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0010-4655}, DOI = {10.1016/j.cpc.2021.108025}, stag_bib_extends_levelofaccess = {NA}, author = {Klapetek, P. and Grolich, P. and Nezval, D. and Valtr, M. and Šlesinger, R. and Nečas, D.} } @Proceedings { NeyezhmakovPPSS2021, subid = {2402}, title = {Towards the assessment of the accuracy of measuring the integral characteristics of physical quantities using the sensors of discrete values of these quantities}, journal = {SMSI 2021 - System of Units and Metreological Infrastructure}, year = {2021}, month = {5}, volume = {C9 Advance}, number = {2021}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {C9.2, 310-311}, keywords = {sensor, integral, discrete values, quadrature formula, accuracy}, web_url = {https://doi.org/10.5162/SMSI2021/C9.2}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {AMA}, event_place = {Online Conference}, event_name = {SMSI 2021 Conference – Sensor and Measurement Science International}, event_date = {03-05-2021 to 06-05-2021}, language = {30}, ISBN = {978-3-9819376-4-0}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ama-science.org/proceedings/details/4069}, author = {Neyezhmakov, P. and Panasenko, T and Prokopov, A. and Skliarov, V. and Shloma, A.} } @Article { RussellS2021, subid = {2024}, title = {mmSIM: An open toolbox for accessible structured illumination microscopy}, journal = {Philosophical Transactions of the Royal Society A}, year = {2021}, month = {4}, day = {26}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, keywords = {Structured illumination microscopy, SIM hardware control, image acquisition, Micro-Manager microscope control package}, web_url = {https://www.biorxiv.org/content/10.1101/2021.01.18.427184v1}, misc2 = {EMPIR 2018: Health}, language = {30}, DOI = {10.1101/2021.01.18.427184}, stag_bib_extends_levelofaccess = {NA}, author = {Russell, C.T. and Shaw, M.} } @Article { FleischerHSPZH2021, subid = {2431}, title = {Absolute ¹³C/¹²C isotope amount ratio for Vienna PeeDee Belemnite from infrared absorption spectroscopy}, journal = {Nature Physics}, year = {2021}, month = {4}, day = {26}, volume = {17}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {889-893}, keywords = {Characterization and analytical techniques, Near-infrared spectroscopy}, web_url = {https://discovery.ucl.ac.uk/id/eprint/10131639/}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2481}, DOI = {10.1038/s41567-021-01226-y}, stag_bib_extends_levelofaccess = {NA}, author = {Fleischer, A.J. and Hongming, Y. and Srivastava, A. and Polyansky, O. and Zobov, N.F. and Hodges, J.T.} } @Article { NagelLASDL2021, subid = {2440}, title = {Non-Invasive and Quantitative Estimation of Left Atrial Fibrosis Based on P Waves of the 12-Lead ECG—A Large-Scale Computational Study Covering Anatomical Variability}, journal = {Journal of Clinical Medicine}, year = {2021}, month = {4}, day = {20}, volume = {10}, number = {8}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, keywords = {electrophysiological simulation, atrial cohort modeling, 12-lead ECG, P wave, atrial fibrosis, atrial fibrillation}, web_url = {https://www.mdpi.com/2077-0383/10/8/1797/htm}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI}, language = {30}, DOI = {10.3390/jcm10081797}, stag_bib_extends_levelofaccess = {NA}, author = {Nagel, C. and Luongo, G. and Azzolin, L. and Schuler, S. and D{\"o}ssel, O. and Loewe, A.} } @Article { PeikSSPWT2021, subid = {2228}, title = {Nuclear clocks for testing fundamental physics}, journal = {Quantum Science and Technology}, year = {2021}, month = {4}, day = {15}, volume = {6}, number = {3}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {034002}, keywords = {nuclear clock, fundamental physics, thorium-229 isomer, dark matter searches}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2058-9565}, DOI = {10.1088/2058-9565/abe9c2}, stag_bib_extends_levelofaccess = {NA}, author = {Peik, E. and Schumm, T. and Safronova, M.S. and P{\'a}lffy, A. and Weitenberg, J. and Thirolf, P.G.} } @Article { MoroshRNKiKPIMSBIKS2021, subid = {2017}, title = {Investigation into the performance of dose rate measurement instruments used in non-governmental networks}, journal = {Radiation Measurements}, year = {2021}, month = {4}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106580}, keywords = {Dosimetry networks.Dose rate meters.Environmental Radiation.Geiger counter.Metrological evaluation}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106580}, stag_bib_extends_levelofaccess = {NA}, author = {Morosh, V. and R{\"o}ttger, A. and Neumaier, S. and Krasniqi, F. and Živanović, M. and Kržanović, N. and Pantelić, G. and Iurlaro, G. and Mariotti, F. and Sperandio, L. and Bell, S. and Ioannidis, S. and Kelly, M. and Sangiorgi, M.} } @Article { JoBAFSWTDRGKPR2021, subid = {2125}, title = {Quantum Hall Valley Splitters and a Tunable Mach-Zehnder Interferometer in Graphene}, journal = {Physical Review Letters}, year = {2021}, month = {4}, volume = {126}, number = {14}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {146803}, keywords = {Graphene, electron interferometer, Mach-Zehnder, Quantum Hall Valley Beam Splitter}, web_url = {https://arxiv.org/abs/2011.04958}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.146803}, stag_bib_extends_levelofaccess = {NA}, author = {Jo, M. and Brasseur, P. and Assouline, A. and Fleury, G. and Sim, H-S. and Watanabe, K. and Taniguchi, T. and Dumnernpanich, W. and Roche, P. and Glattli, D.C. and Kumada, N. and Parmentier, F.D. and Roulleau, P.} } @Article { RobertsonSPJ2021, subid = {2728}, title = {ARC 3.0: An expanded Python toolbox for atomic physics calculations}, journal = {Computer Physics Communications}, year = {2021}, month = {4}, volume = {261}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {107814}, keywords = {Alkaline earth atomsDivalent atomsAlkali atomsRydberg statesAtom–surface van der Waals interactionQuantum technologiesNeutral-atom quantum computingAtom-based sensors}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {0010-4655}, DOI = {10.1016/j.cpc.2020.107814}, stag_bib_extends_levelofaccess = {NA}, author = {Robertson, E.J. and Šibalić, N. and Potvliege, R.M. and Jones, M.P.A. } } @Article { GruberBALBPCPDTCFSQ2021, subid = {2028}, title = {Comparison of radon mapping methods for the delineation of radon priority areas – an exercise}, journal = {Journal of the European Radon Association}, year = {2021}, month = {3}, day = {31}, volume = {2}, number = {2021}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {1-14}, keywords = {radon, mapping, prediction, interpolation, radon priority areas, risk, hazard}, web_url = {https://radonjournal.net/index.php/radon/article/view/5755}, misc2 = {EMPIR 2016: Environment}, publisher = {European Radon Association}, language = {30}, ISSN = {2736-2272}, DOI = {10.35815/radon.v2.5755}, stag_bib_extends_levelofaccess = {NA}, author = {Gruber, V. and Baumann, S. and Alber, O. and Laubichler, C. and Bossew, P. and Petermann, E. and Ciotoli, G. and Pereira , A. and Domingos, F. and Tondeur, F. and Cinelli, G. and Fernandez , A. and Sainz, C. and Quindos-Poncela, L.} } @Article { BukerSLWPM2021, subid = {2188}, title = {A unique test facility for calibration of domestic flow meters under dynamic flow conditions}, journal = {Flow Measurement and Instrumentation}, year = {2021}, month = {3}, day = {29}, volume = {79}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {Test facility, Dynamic flow measurement, Domestic water meters, Calibration, Flow meter accuracy}, misc2 = {EMPIR 2017: Industry}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2021.101934}, stag_bib_extends_levelofaccess = {NA}, author = {B{\"u}ker, O. and Stolt, K. and Lindstr{\"o}m, K. and Wennergren, P. and Penttinen, O. and Mattiasson, K.} } @Article { SilvaniATC2021, subid = {2021}, title = {Effect of the Interfacial Dzyaloshinskii–Moriya Interaction on the Spin Waves Eigenmodes of Isolated Stripes and Dots Magnetized In-Plane: A Micromagnetic Study}, journal = {Applied Sciences}, year = {2021}, month = {3}, day = {25}, volume = {11}, number = {7}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {2929}, keywords = {Micromagnetism, DMI, Magnetic dots}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11072929}, stag_bib_extends_levelofaccess = {NA}, author = {Silvani, R. and Alunni, M. and Tacchi, S. and Carlotti, G.} } @Article { SchmidtGNBvZMBSHWR2021, subid = {2616}, title = {Bimodal behavior of microlasers investigated with a two-channel photon-number-resolving transition-edge sensor system}, journal = {Physical Review Research}, year = {2021}, month = {3}, day = {19}, volume = {3}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {013263}, keywords = {microlaser, transition-edge sensor, photon statistics, photon counting, nanophotonics}, web_url = {https://journals.aps.org/prresearch/abstract/10.1103/PhysRevResearch.3.013263}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.3.013263}, stag_bib_extends_levelofaccess = {NA}, author = {Schmidt, M. and Grothe, I.H. and Neumeier, S. and Bremer, L. and von Helversen, M. and Zent, W. and Melcher, B. and Beyer, J. and Schneider, C. and H{\"o}fling, S. and Wiersig, J. and Reitzenstein, S.} } @Article { WuRSM2021, subid = {1999}, title = {Assessing the Impact of Data Filtering Techniques on Material Characterization at Millimeter-Wave Frequencies}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, month = {3}, day = {18}, volume = {70}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {6005904}, keywords = {Data filtering, dielectric constant, loss tangent, millimeter-wave measurements, time-domain gating, vector network analyzer (VNA)}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, language = {30}, ISSN = {1557-9662}, DOI = {10.1109/TIM.2021.3067224}, stag_bib_extends_levelofaccess = {NA}, author = {Wu, W. and Ridler, N. and Shang, X. and Ma, D.} } @Article { CliffordMFHHKPRSP2021, subid = {2013}, title = {The importance of international standards for the graphene community}, journal = {Nature Reviews Physics}, year = {2021}, month = {3}, day = {15}, volume = {3}, number = {4}, number2 = {19NRM04: ISO-G-SCoPe: Standardisation of structural and chemical properties of graphene}, pages = {233-235}, keywords = {graphene, standards, ISO, IEC, 2D materials, standardisation}, web_url = {https://www.nature.com/articles/s42254-021-00278-6.epdf?sharing_token=_RIs5V6Xm7w_YnHU36ykhtRgN0jAjWel9jnR3ZoTv0NPpzni0dDHfaSDxkLVCOVw58FsyO6wELZUo5O32Eh0l-PBSDtirSTDnDrgEzBq40IQw69h7pcwLtLVCw2MuYIUVmHN0-WNNYkKy_jgkRmTZPKe2I2wUTrJd-QYBiq-ZrQ\%3D}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2522-5820}, DOI = {dx.doi.org/10.1038/s42254-021-00278-6}, stag_bib_extends_levelofaccess = {NA}, author = {Clifford, C.A. and Martins Ferreira, E.H. and Fujimoto, T. and Herrmann, J. and Hight Walker, A.R. and Koltsov, D. and Punckt, C. and Ren, L. and Smallwood, G.J. and Pollard, A.J.} } @Article { EichstadtGVSBK2021, subid = {2301}, title = {Toward Smart Traceability for Digital Sensors and the Industrial Internet of Things}, journal = {Sensors}, year = {2021}, month = {3}, day = {12}, volume = {21}, number = {6}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, pages = {2019}, keywords = {Internet of Things, calibration, measurement uncertainty, traceability, semantics, ontology, sensor network, digital sensors, redundancy}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21062019}, stag_bib_extends_levelofaccess = {NA}, author = {Eichst{\"a}dt, S. and Gruber, M. and Vedurmudi, A.P. and Seeger, B. and Bruns, T. and Kok, G.} } @Article { KenbarS2021, subid = {1774}, title = {Influence of flow disturbances on the performance of industry-standard LNG flow meters}, journal = {Flow Measurement and Instrumentation}, year = {2021}, month = {3}, volume = {77}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {101871}, keywords = {LNG Liquid nitrogen Calibration Cryogenic Flow meter Flow disturbance Custody transfer}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101871}, stag_bib_extends_levelofaccess = {NA}, author = {Kenbar, A. and Schakel, M.} } @Article { IurlaroBCBFKMMMNNSVWi2021, subid = {2018}, title = {Study on the uncertainty of passive area dosimetry systems for environmental radiation monitoring in the framework of the EMPIR “Preparedness” project}, journal = {Radiation Measurements}, year = {2021}, month = {3}, volume = {142}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {106543}, keywords = {Passive dosimetry systems, Uncertainty budget, Decision threshold, Detection limitEnvironmental radiation monitoring, Emergency preparedness}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {1350-4487}, DOI = {10.1016/j.radmeas.2021.106543}, stag_bib_extends_levelofaccess = {NA}, author = {Iurlaro, G. and Baranowska, Z. and Campani, L. and Bjelac, O.C. and Ferrari, P. and Knežević, Ž. and Majer, M. and Mariotti, F. and Morelli, B. and Neumaier, S. and Nodilo, M. and Sperandio, L. and Vittoria, F.A. and Wołoszczuk, K. and Živanović, M.} } @Article { RipaIGSGFBLDG2021, subid = {2645}, title = {Refractive index gas thermometry between 13.8 K and 161.4 K}, journal = {Metrologia}, year = {2021}, month = {3}, volume = {58}, number = {2}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {025008}, keywords = {refractive index gas thermometry, thermodynamic temperature, ITS-90,microwave resonator}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abe249}, stag_bib_extends_levelofaccess = {NA}, author = {Ripa, D.M. and Imbraguglio, D. and Gaiser, C. and Steur, P.P.M. and Giraudi, D. and Fogliati, M. and Bertinetti, M. and Lopardo, G. and Dematteis, R. and Gavioso, R.M.} } @Article { DiCapuaMSDVCFFV2021, subid = {1927}, title = {Analysis of Dynamic Wireless Power Transfer Systems Based on Behavioral Modeling of Mutual Inductance}, journal = {Sustainability}, year = {2021}, month = {2}, day = {26}, volume = {13}, number = {5}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {2556}, keywords = {behavioral modeling; inductive coupling; mutual inductance; wireless power transfer}, web_url = {https://www.mdpi.com/2071-1050/13/5/2556}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2071-1050}, DOI = {10.3390/su13052556}, stag_bib_extends_levelofaccess = {NA}, author = {Di Capua, G. and Maffucci, A. and Stoyka, K. and Di Mambro, G. and Ventre, S. and Cirimele, V. and Freschi, F. and Femia, N. and Villone, F.} } @Article { JobbagyMS2021, subid = {1920}, title = {Preparation of multi-purpose radon emanation sources}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2021}, month = {2}, day = {25}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, keywords = {radon emanation, chemisorption, drop deposition, radon-in-water}, misc2 = {EMPIR 2016: Environment}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0236-5731, 1588-2780}, DOI = {10.1007/s10967-021-07630-1}, stag_bib_extends_levelofaccess = {NA}, author = {Jobb{\'a}gy, V. and Marouli, M. and Stroh, H.} } @Article { OkhapkinTSSBP2021, subid = {2227}, title = {The thorium-229 low-energy isomer and the nuclear clock}, journal = {Nature Reviews Physics}, year = {2021}, month = {2}, day = {25}, volume = {3}, number = {4}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {238-248}, keywords = {Atomic and molecular interactions with photonsExperimental nuclear physics}, web_url = {https://oar.ptb.de/resources/show/10.7795/120.20211006}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2522-5820}, DOI = {10.1038/s42254-021-00286-6}, stag_bib_extends_levelofaccess = {NA}, author = {Okhapkin, M.V. and Thielking, J. and Schumm, T. and Sikorsky, T. and Beeks, K. and Peik, E.} } @Article { ZuccaCBSLCTFP2021, subid = {1918}, title = {Assessment of the Overall Efficiency in WPT Stations for Electric Vehicles}, journal = {Sustainability}, year = {2021}, month = {2}, day = {24}, volume = {13}, number = {5}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {2436}, keywords = {electric vehicles; inductive charging; measurement uncertainty; power system measurements}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2071-1050}, DOI = {10.3390/su13052436}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Cirimele, V. and Bruna, J. and Signorino, D. and Laporta, E. and Colussi, J. and Tejedor, M.A.A. and Fissore, F. and Pogliano, U.} } @Article { SeegerOCGSSOALGFGKB2021, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SeegerOCGSSOALGFGKB20210, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SeegerOCGSSOALGFGKB20211, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SassiKL2012, subid = {2000}, title = {Reproducibility of the Quantification of Reversible Wall Interactions in VOC Sampling Lines}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {20}, volume = {12}, number = {2}, number2 = {19ENV06: MetClimVOC: Metrology for climate relevant volatile organic compounds}, pages = {280}, keywords = {VOC measurements, surface interaction, gas sampling, acetone, Sulfinert®, equilibrium, uncertainty}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {2073-4433}, DOI = {10.3390/atmos12020280}, stag_bib_extends_levelofaccess = {NA}, author = {Sassi, G. and Khan, B.A. and Lecuna, M.} } @Article { PanSPRDRGP2021, subid = {2056}, title = {Direct comparison of ITS-90 and PLTS-2000 from 0.65 K to 1 K at LNE-CNAM}, journal = {Metrologia}, year = {2021}, month = {2}, day = {19}, volume = {58}, number = {2}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {025005}, keywords = {temperature range between 0.65 K and 1 K, uncertainty component, resistance thermometer}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/abd845/pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abd845}, stag_bib_extends_levelofaccess = {NA}, author = {Pan, C. and Sparasci, F. and Plimmer, M. and Risegari, L. and Daugas, J-M. and Rouille, G. and Gao, B. and Pitre, L.} } @Article { WundrackMDSPMSSSSB2021, subid = {2491}, title = {Liquid metal intercalation of epitaxial graphene: Large-area gallenene layer fabrication through gallium self-propagation at ambient conditions}, journal = {Physical Review Materials}, year = {2021}, month = {2}, day = {19}, volume = {5}, number = {2}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {graphene, epitaxy, intercalation, 2-dimensional systems, condensed matter}, web_url = {https://arxiv.org/abs/1905.12438}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2475-9953}, DOI = {10.1103/PhysRevMaterials.5.024006}, stag_bib_extends_levelofaccess = {NA}, author = {Wundrack, S. and Momeni, D. and Dempwolf, W. and Schmidt, N. and Pierz, K. and Michaliszyn, L. and Spende, H. and Schmidt, A. and Schumacher, H.W. and Stosch, R. and Bakin, A.} } @Article { MariscottiGSDG2021, subid = {1995}, title = {How Pantograph Electric Arcs affect Energy Efficiency in DC Railway Vehicles}, journal = {2020 IEEE Vehicle Power and Propulsion Conference}, year = {2021}, month = {2}, day = {18}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Electric arc, Energy consumption, Power Quality, Power supply transient, Power system transients, Rail transportation, Rolling Stock}, misc2 = {EMPIR 2016: Energy}, language = {30}, DOI = {10.5281/zenodo.4646848}, stag_bib_extends_levelofaccess = {NA}, author = {Mariscotti, A. and Giordano, D. and Signorino, D. and Delle Femine, A. and Gallo, D.} } @Article { HorenderAQSNDSWAKGV2021, subid = {1901}, title = {Facility for production of ambient-like model aerosols (PALMA) in the laboratory: application in the intercomparison of automated PM monitors with the reference gravimetric method}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {2}, day = {16}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, keywords = {ambient-like aerosols, particulate matter, calibration , PM monitors}, web_url = {https://amt.copernicus.org/articles/14/1225/2021/amt-14-1225-2021.html}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.5194/amt-14-1225-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Horender, S. and Auderset, K. and Quincey, P. and Seeger, S. and Nielsen Skov, S. and Dirscherl, K. and Smith, T.O.M. and Williams, K. and Aegerter, C.C. and Kalbermatter, D.M. and Gaie-Levrel, F. and Vasilatou, K.} } @Article { FernandezScarioniBCSHALRCKS2021, subid = {2055}, title = {Thermoelectric Signature of Individual Skyrmions}, journal = {Physical Review Letters}, year = {2021}, month = {2}, day = {16}, volume = {126}, number = {7}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {1-6/077202}, keywords = {Magnetism, Nernst effect, Skyrmions, Thermomagnetic effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.077202}, stag_bib_extends_levelofaccess = {NA}, author = {Fern{\'a}ndez Scarioni, A. and Barton, C. and Corte-Le{\'o}n, H. and Sievers, S. and Hu, X. and Ajejas, F. and Legrand, W. and Reyren, N. and Cros, V. and Kazakova, O. and Schumacher, H.W.} } @Article { KuttTSLKSL2021, subid = {2184}, title = {Strengths of Acids in Acetonitrile}, journal = {European Journal of Organic Chemistry}, year = {2021}, month = {2}, day = {16}, volume = {2021}, number = {9}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1407-1419}, keywords = {acidity;acetonitrile pKa scale}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {1434-193X, 1099-0690}, DOI = {10.1002/ejoc.202001649}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"u}tt, A. and Tshepelevitsh, S. and Saame, J. and L{\~o}kov, M. and Kaljurand, I. and Selberg, S. and Leito, I.} } @Article { BuonincontriKKMGCDCCMFMGSRZ2021, subid = {1697}, title = {Three dimensional MRF obtains highly repeatable and reproducible multi-parametric estimations in the healthy human brain at 1.5T and 3T}, journal = {NeuroImage}, year = {2021}, month = {2}, volume = {226}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, pages = {117573}, keywords = {MRI, Quantitation, Relaxometry, Brain, MR fingerprinting, Three dimensional, 3D}, web_url = {https://www.sciencedirect.com/science/article/pii/S1053811920310582?via\%3Dihub}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2020.117573}, stag_bib_extends_levelofaccess = {NA}, author = {Buonincontri, G. and Kurzawski, J.W. and Kaggie, J.D. and Matys, T. and Gallagher, F.A. and Cencini, M. and Donatelli, G. and Cecchi, P. and Cosottini, M. and Martini, N. and Frijia, F. and Montanaro, D. and G{\'o}mez, P.A. and Schulte, R.F. and Retico, A. and Zilberti, L.} } @Article { LauchtHUFRSSSKDYYKBPHSOMVLKTCGMMJB2021, subid = {2093}, title = {Roadmap on quantum nanotechnologies}, journal = {Nanotechnology}, year = {2021}, month = {2}, volume = {32}, number = {16}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {162003}, keywords = {Nanotechnology, metrology, sensing, single-electrons, low-dimensional systems, roadmap}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/abb333}, stag_bib_extends_levelofaccess = {NA}, author = {Laucht, A. and Hohls, F. and Ubbelohde, N. and Fernando Gonzalez-Zalba, M. and Reilly, D.J. and Stobbe, S. and Schr{\"o}der, T. and Scarlino, P. and Koski, J.V. and Dzurak, A. and Yang, C-H. and Yoneda, J. and Kuemmeth, F. and Bluhm, H. and Pla, J. and Hill, C. and Salfi, J. and Oiwa, A. and Muhonen, J.T. and Verhagen, E. and LaHaye, M.D. and Kim, H.H. and Tsen, A.W. and Culcer, D. and Geresdi, A. and Mol, J.A. and Mohan, V. and Jain, P.K. and Baugh, J.} } @Article { ChenSDOLHCC2021, subid = {2425}, title = {Quantitative Assessment of Carrier Density by Cathodoluminescence. I. GaAs thin films and modeling}, journal = {Phys. Rev. Applied}, year = {2021}, month = {2}, volume = {15}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {024006}, keywords = {GaAs, thin films, CL, doping, nanostructures}, misc2 = {EMPIR 2019: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1909.05598}, author = {Chen, H.-L. and Scaccabarozzi, A. and De L{\'e}pinau, R. and Oehler, F. and Lemaıtre, A. and Harmand, J.-C. and Cattoni, A. and Collin, S.} } @Article { ChenDSOHCC2021, subid = {2475}, title = {Quantitative Assessment of Carrier Density by Cathodoluminescence. II. GaAs nanowires}, journal = {Phys. Rev. Applied}, year = {2021}, month = {2}, volume = {15}, number2 = {19ENG05: NanoWires: High throughput metrology for nanowire energy harvesting devices}, pages = {024007}, keywords = {GaAs nanowires, high-resolution cathodoluminescence (CL) mapping}, web_url = {https://journals.aps.org/prapplied/pdf/10.1103/PhysRevApplied.15.024007}, misc2 = {EMPIR 2019: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1909.05602}, author = {Chen, H.-L. and De L{\'e}pinau, R. and Scaccabarozzi, A. and Oehler, F. and Harmand, J.-C. and Cattoni, A. and Collin, S.} } @Article { SobanskiTSLKIPHE2021, subid = {1916}, title = {Advances in High-Precision NO2 Measurement by Quantum Cascade Laser Absorption Spectroscopy}, journal = {Applied Sciences}, year = {2021}, month = {1}, day = {29}, volume = {11}, number = {3}, number2 = {16ENV05: MetNO2: Metrology for nitrogen dioxide}, pages = {1222}, keywords = {air pollution; trace gas; nitrogen dioxide; laser spectroscopy; mid-infrared; quantum cascade laser; selective detection}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11031222}, stag_bib_extends_levelofaccess = {NA}, author = {Sobanski, N. and Tuzson, B. and Scheidegger, P. and Looser, H. and Kupferschmid, A. and Iturrate, M. and Pascale, C. and H{\"u}glin, C. and Emmenegger, L.} } @Article { ShalmZBSSMAAMAFOMNK2021, subid = {2736}, title = {Device-independent randomness expansion with entangled photons}, journal = {Nature Physics}, year = {2021}, month = {1}, day = {28}, volume = {17}, number = {4}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {452-456}, keywords = {Bell inequality test, Entangled photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1912.11158}, author = {Shalm, L.K. and Zhang, Y. and Bienfang, J.C. and Schlager, C. and Stevens, M.J. and Mazurek, M.D. and Abell{\'a}n, C. and Amaya, W. and Mitchell, M.W. and Alhejji, M.A. and Fu, H. and Ornstein, J. and Mirin, R.P. and Nam, S.W. and Knill, E.} } @Article { SmithHEPNMWP2021, subid = {1900}, title = {Traceability of the Sentinel-3 SLSTR Level-1 Infrared Radiometric Processing}, journal = {Remote Sensing}, year = {2021}, month = {1}, day = {22}, volume = {13}, number = {3}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {374}, keywords = {calibration, uncertainty, traceability, SLSTR, Sentinel-3, temperature, blackbody, radiometer, data processing, Earth observation, metrology}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs13030374}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, D. and Hunt, S.E. and Etxaluze, M. and Peters, D. and Nightingale, T. and Mittaz, J. and Woolliams, E.R. and Polehampton, E.} } @Proceedings { SimonotHSCLO2021, subid = {2396}, title = {Study and simulations of speckle effects on BRDF measurements at very high angular resolution}, journal = {Electronic Imaging}, year = {2021}, month = {1}, day = {18}, volume = {2021}, number = {140-1-140-}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {1-6}, keywords = {BRDF MeasurementsSpeckleBRDF SimulationsMetrology of appearanceGloss}, web_url = {https://www.ingentaconnect.com/content/ist/ei/2021/00002021/00000005/art00006}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Society for Imaging Science and Technology}, event_place = {Electronic Imaging 2021}, event_name = {Electronic Imaging 2021}, event_date = {16-01-2021 to 29-01-2021}, language = {30}, ISSN = {2470-1173}, stag_bib_extends_levelofaccess = {NA}, author = {Simonot, L. and Hebert, M. and Sortais, Y. and Chavel, P. and Labardens, T. and Obein, G.} } @Article { SeferiBMS2021, subid = {1934}, title = {A Novel Arc Detection Method for DC Railway Systems}, journal = {Energies}, year = {2021}, month = {1}, day = {15}, volume = {14}, number = {2}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {444}, keywords = {pantograph-catenary system; current collection quality; arc detection; predictive maintenance; railway electrical networks; Hilbert transform; rail transportation; power quality disturbance}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1996-1073}, DOI = {10.3390/en14020444}, stag_bib_extends_levelofaccess = {NA}, author = {Seferi, Y. and Blair, S.M. and Mester, C. and Stewart, B.G.} } @Article { LohvitheeSCS2021, subid = {2409}, title = {Ant Colony-Based Hyperparameter Optimisation in Total Variation Reconstruction in X-ray Computed Tomography}, journal = {Sensors}, year = {2021}, month = {1}, day = {15}, volume = {21}, number = {591}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, keywords = {hyperparameter tuning, total variation (TV) regularization, iterative reconstruction, ant colony optimization, limited data X-ray CT, computer-aided hyperparameter selection, X-ray computed tomography, image reconstruction}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI}, language = {30}, DOI = {10.3390/s21020591}, stag_bib_extends_levelofaccess = {NA}, author = {Lohvithee, M. and Sun, W. and Chretien, S. and Soleimani, M.} } @Article { SteierDBTOCC2021, subid = {1871}, title = {Insights from Transient Absorption Spectroscopy into Electron Dynamics Along the Ga‐Gradient in Cu(In,Ga)Se2 Solar Cells}, journal = {Advanced Energy Materials}, year = {2021}, month = {1}, day = {14}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {2003446}, keywords = {CIGS, transient absorption spectroscopy}, misc2 = {EMPIR 2016: Energy}, publisher = {Wiley}, language = {30}, ISSN = {1614-6832, 1614-6840}, DOI = {10.1002/aenm.202003446}, stag_bib_extends_levelofaccess = {NA}, author = {Steier, L. and Durrant, J.R. and Bozal‐Ginesta, C. and Tiwari, A.N. and Ochoa, M. and Carron, R. and Chang, Y‐H.} } @Manual { ShangRDG2021, subid = {2128}, title = {Introductory guide to making Planar S-parameter measurements at millimetre-wave frequencies}, year = {2021}, month = {1}, day = {13}, number2 = {19SIP02: PlanarMeT: Knowledge transfer of planar calibration and measurement techniques at millimetre-wave frequencies}, keywords = {Calibration, on-wafer measurement, planar measurement, S-parameters, millimetre-wave, probes, traceability, vector network analyzer (VNA)}, misc2 = {EMPIR 2019: Support for Impact}, publisher = {National Physical Laboratory}, language = {30}, DOI = {10.47120/npl.9001}, stag_bib_extends_levelofaccess = {NA}, author = {Shang, X. and Ridler, N.M. and Ding, J. and Geen, M.} } @Article { JenningerABBDGISJKRSSSTTW2021, subid = {1775}, title = {Development of a design for an ionisation vacuum gauge suitable as a reference standard}, journal = {Vacuum}, year = {2021}, month = {1}, volume = {183}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {109884}, keywords = {Ionisation gauge, Hot cathode, Sensitivity, Simulation, Reference standard}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109884}, stag_bib_extends_levelofaccess = {NA}, author = {Jenninger, B. and Anderson, J. and Bernien, M. and Bundaleski, N. and Dimitrova, H. and Granovskij, M. and Illgen, C. and Šetina, J. and Jousten, K. and Kucharski, P. and Reinhardt, C. and Scuderi, F. and Silva, R.A.S. and St{\"o}ltzel, A. and Teodoro, O.M.N.D. and Trzpil-Jurgielewicz, B. and W{\"u}est, M.} } @Article { DorscherHSLBLSPL2021, subid = {1846}, title = {Optical frequency ratio of a 171Yb+ single-ion clock and a 87Sr lattice clock}, journal = {Metrologia}, year = {2021}, month = {1}, volume = {58}, number = {1}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {015005}, keywords = {optical clock, ion clock, ytterbium, optical lattice clock, strontium, optical clock comparison, frequency ratio}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abc86f}, stag_bib_extends_levelofaccess = {NA}, author = {D{\"o}rscher, S. and Huntemann, N. and Schwarz, R. and Lange, R. and Benkler, E. and Lipphardt, B. and Sterr, U. and Peik, E. and Lisdat, C.} } @Article { LangeHRSSLTWP2021, subid = {1854}, title = {Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons}, journal = {Physical Review Letters}, year = {2021}, month = {1}, volume = {126}, number = {1}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {011102}, keywords = {Optical clocks, Tests of fundamental principles, Time \& frequency standards, Quantum metrology}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.011102}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Rahm, J.M. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Weyers, S. and Peik, E.} } @Article { LangeHRSSLTWP20210, subid = {1854}, title = {Improved Limits for Violations of Local Position Invariance from Atomic Clock Comparisons}, journal = {Physical Review Letters}, year = {2021}, month = {1}, volume = {126}, number = {1}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {011102}, keywords = {Optical clocks, Tests of fundamental principles, Time \& frequency standards, Quantum metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.011102}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Rahm, J.M. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Weyers, S. and Peik, E.} } @Article { PoppeLHWSKP2021, subid = {1843}, title = {Ion collection efficiency of ionization chambers in ultra‐high dose‐per‐pulse electron beams}, journal = {Medical Physics}, year = {2021}, month = {1}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, FLASH radiation therapy, ionization chambers, ion collection efficiency}, misc2 = {EMPIR 2018: Health}, publisher = {Wiley}, language = {30}, ISSN = {0094-2405, 2473-4209}, DOI = {10.1002/mp.14620}, stag_bib_extends_levelofaccess = {NA}, author = {Poppe, B. and Looe, H.K. and Hackel, T. and Weidner, J. and Sch{\"u}ller, A. and Kranzer, R. and Poppinga, D.} } @Inbook { BELLGAABSIDPSVRIWPNKSD2021, subid = {2552}, title = {A NEW EUROPEAN RADIATION PROTECTION NETWORK DEVELOPED BY THE SUPPORT BSS JOINT NETWORK PROJECT}, year = {2021}, month = {1}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {radiation protection, metrology, national regulation, European regulation, supportBSS, ENM for Radiation Protection}, web_url = {https://vinar.vin.bg.ac.rs/bitstream/handle/123456789/10125/309-314.pdf}, misc2 = {EMPIR 2019: Support for Networks}, booktitle = {RADIATION PROTECTION SOCIETY OF SERBIA AND MONTENEGRO, PROCEEDINGS, XXXI SYMPOSIUM RPSSM, 2021}, language = {30}, ISBN = {78-86-7306-161-0}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {78-86-7306-161-0}, author = {Bell, S. and Glavič-Cindro, D. and ALVES, J. and Adam-Guillermin, C. and Bernat, R. and Sabeta, A. and Ioan, M-R. and DERLACINSKI, M. and Pinto, M. and Sochor, V. and Veres, A. and R{\"O}TTGER, .A. and Živanović, M. and Wens, B. and Persson, L. and Nylund, R. and Kržanović, N. and STANKOVIĆ, S. and DIMOVIĆ, S.} } @Article { KrehlikSBSK2021, subid = {1850}, title = {Optical multiplexing of metrological time and frequency signals in a single 100 GHz-grid optical channel}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2021}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, keywords = {Time and frequency transfer, fiber optics, optical interleavers, wavelength multiplexing, Optical fibers, Optical filters, Optical variables control, Optical fiber networks, Ultrafast optics, Optical reflection, Time-frequency analysis}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010, 1525-8955}, DOI = {10.1109/TUFFC.2021.3053430}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Buczek, L. and Schnatz, H. and Kronj{\"a}ger, J.} } @Article { BehrEBGHKKLPPS2020, subid = {1857}, title = {A four-terminal-pair Josephson impedance bridge combined with a graphene quantized Hall resistance}, journal = {Measurement Science and Technology}, year = {2021}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, keywords = {impedance measurement,quantized Hall resistor,coaxial impedance bridge,graphene,Josephson arbitrary waveform synthesizer}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/abcff3/pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abcff3}, stag_bib_extends_levelofaccess = {NA}, author = {Bauer, S. and Elmquist, R. and Behr, R. and Goetz, M. and Herick, J. and Kieler, O.F. and Kruskopf, M. and Lee, J. and Palafox, L. and Pimsut, Y. and Schurr, J.} } @Article { FanWSS2021, subid = {1938}, title = {Pantograph Arc Location Estimation using Resonant Frequencies in DC Railway Power Systems}, journal = {IEEE Transactions on Transportation Electrification}, year = {2021}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {1-1}, keywords = {DC traction power supply system, overhead line, pantograph arc location estimation, resonant frequency}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2332-7782, 2372-2088}, DOI = {10.1109/TTE.2021.3062229}, stag_bib_extends_levelofaccess = {NA}, author = {Fan, F. and Wank, A. and Seferi, Y. and Stewart, B.G.} } @Article { CelepS2021, subid = {2095}, title = {Characterization of a Thermal Isolation Section of a Waveguide Microcalorimeter}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, volume = {70}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1008007}, keywords = {Calibration, measurement uncertainty, microcalorimeter, microwave power measurement, thermal isolation section (TIS)}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2021.3084306}, stag_bib_extends_levelofaccess = {NA}, author = {Celep, M. and Stokes, D.} } @Article { HaveAHPMSL2021, subid = {2088}, title = {Waveform Model to Characterize Time-Domain Pulses Resulting in EMI on Static Energy Meters}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2021}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {1-8}, keywords = {Electromagnetic interference (EMI), metering errors, nonlinear, static energy meters, time-domain, waveformmodel}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2021.3062948}, stag_bib_extends_levelofaccess = {NA}, author = {Have, B.t. and Azpurua, M.A. and Hartman, T. and Pous, M. and Moonen, N. and Silva, F. and Leferink, F.} } @Article { MagniBSSMKSLGKLO2021, subid = {2136}, title = {Spin Hall magnetoresistance and spin orbit torque efficiency in Pt/FeCoB bilayers}, journal = {IEEE Transactions on Magnetics}, year = {2021}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {1-1}, keywords = {spin Hall magnetoresistance, spin Hall effect, spin orbit torque, FeCoB, Pt}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9464, 1941-0069}, DOI = {10.1109/TMAG.2021.3084866}, stag_bib_extends_levelofaccess = {NA}, author = {Magni, A. and Basso, V. and Sola, A. and Soares, G. and Meggiato, N. and Kuepferling, M. and Skowronski, W. and Lazarski, S. and Grochot, K. and Khanjani, M.V. and Langer, J. and Ocker, B.} } @Article { GeislerNSTR2021, subid = {2177}, title = {Analyzing the surface of functional nanomaterials – how to quantify the total and derivatizable number of functional groups and ligands}, journal = {Microchimica Acta}, year = {2021}, volume = {188}, number = {10}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {321}, keywords = {Functional group quantification, Surface ligand, Nanomaterial, Nanoparticle, Bead, Dye-based assay, Opticaldetection, Electrochemical titration, Instrumental analysis, Nanosafety, Safe-by-design}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Nature}, language = {30}, DOI = {10.1007/s00604-021-04960-5}, stag_bib_extends_levelofaccess = {NA}, author = {Gei{\ss}ler, D. and Nirmalananthan-Budau, N. and Scholtz, L. and Tavernaro, I. and Resch-Genger, U.} } @Article { GeislerNSTR20210, subid = {2177}, title = {Analyzing the surface of functional nanomaterials – how to quantify the total and derivatizable number of functional groups and ligands}, journal = {Microchimica Acta}, year = {2021}, volume = {188}, number = {10}, number2 = {18HLT02: AeroTox: Measurements for mitigating adverse health effects from atmospheric particulate pollutants}, pages = {321}, keywords = {Functional group quantification, Surface ligand, Nanomaterial, Nanoparticle, Bead, Dye-based assay, Opticaldetection, Electrochemical titration, Instrumental analysis, Nanosafety, Safe-by-design}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Nature}, language = {30}, DOI = {10.1007/s00604-021-04960-5}, stag_bib_extends_levelofaccess = {NA}, author = {Gei{\ss}ler, D. and Nirmalananthan-Budau, N. and Scholtz, L. and Tavernaro, I. and Resch-Genger, U.} } @Article { VentonHSSA2021, subid = {2249}, title = {Robustness of convolutional neural networks to physiological electrocardiogram noise}, journal = {Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences}, year = {2021}, volume = {379}, number = {2212}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {-}, keywords = {electrocardiogram, physiological noise, robustness, deep learning, convolutional neural network, symmetric projection attractor reconstruction}, web_url = {https://royalsocietypublishing.org/doi/10.1098/rsta.2020.0262}, misc2 = {EMPIR 2018: Health}, publisher = {Royal Society Publishing}, language = {30}, ISSN = {-}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1098/rsta.2020.0262}, author = {Venton, J. and Harris, P.M. and Sundar, A. and Smith, N.A.S. and Aston, P.J. } } @Article { DorstSSE2021, subid = {2302}, title = {GUM2ALA – Uncertainty Propagation Algorithm for the Adaptive Linear Approximation According to the GUM}, journal = {SMSI 2021 - System of Units and Metreological Infrastructure}, year = {2021}, volume = {D1 Future}, number = {2021}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, pages = {314 - 315}, keywords = {machine learning, automation, sensor network, uncertainty}, misc2 = {EMPIR 2017: Industry}, publisher = {AMA Service GmbH, Von-M{\"u}nchhausen-Str. 49, 31515 Wunstorf, Germany}, language = {30}, DOI = {10.5162/SMSI2021/D1.1}, stag_bib_extends_levelofaccess = {NA}, author = {Dorst, T. and Schneider, T. and Sch{\"u}tze, A. and Eichst{\"a}dt, S.} } @Article { RehbehnRBBSKMGMSC2021, subid = {2408}, title = {Sensitivity to new physics of isotope-shift studies using the coronal lines of highly charged calcium ions}, journal = {Physical Review A}, year = {2021}, volume = {103}, number = {4}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {L040801}, keywords = {research areas, dark matter, electronic transitions, particle interactions, techniques, spectroscopy, nuclear physics, atomic, molecular and optical}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {ISSN 2469-9934 (online), 2469-}, DOI = {10.1103/PhysRevA.103.L040801}, stag_bib_extends_levelofaccess = {NA}, author = {Rehbehn, N-H. and Rosner, M.K. and Bekker, H. and Berengut, J.C. and Schmidt, P.O. and King, S.A. and Micke, P. and Gu, M.F. and M{\"u}ller, R. and Surzhykov, A. and Crespo L{\'o}pez-Urrutia, J.R.} } @Article { StarkWBCDKRGNOSSLSKLMSPC2021, subid = {2407}, title = {An ultralow-noise superconducting radio-frequency ion trap for frequency metrology with highly charged ions}, journal = {AIP Review of Scientific Instruments}, year = {2021}, volume = {92}, number = {8}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {083203}, keywords = {Radio frequency cavities, radio-frequency quadrupole}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1063/5.0046569}, stag_bib_extends_levelofaccess = {NA}, author = {Stark, J. and Warnecke, C. and Bogen, S. and Chen, S. and Dijck, E.A. and K{\"u}hn, S. and Rosner, M. K. and Graf, A. and Nauta, J. and Oelmann, J-H. and Schm{\"o}ger, L. and Schwarz, M. and Liebert, D. and Spie{\ss}, L.J. and King, S.A. and Leopold, T. and Micke, P. and Schmidt, P.O. and Pfeifer, T. and Crespo L{\'o}pez-Urrutia, J.R.} } @Proceedings { JiangPSHHMDOMPG2021, subid = {2553}, title = {Prequalification of Capacitors for High-Precision Voltage Dividers}, journal = {ISH 2021}, year = {2021}, number2 = {19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes}, keywords = {Voltage Divider, RCR Divider, Capacitor}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {ISH 2021}, event_place = {online}, event_name = {22nd International Symposium on High Voltage Engineering}, event_date = {21-11-2021 to 25-11-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6073729}, author = {Jiang, H. and Pischler, O. and Schichler, U. and Havunen, J. and H{\"a}llstr{\"o}m, J. and Merev, A. and Dedeoğlu, S. and {\"O}zer, S. and Meisner, J. and Passon, S. and Gerdinand, F.} } @Article { VicarJJIBJBBST2021, subid = {2647}, title = {Electrons on a straight path: A novel ionisation vacuum gauge suitable as reference standard}, journal = {VACUUM}, year = {2021}, volume = {189}, number = {2021}, number2 = {20SIP01: ISO Gauge: Developing an ISO Technical Specification ''Characteristics for a stable ionisation vacuum gauge''}, pages = {110239}, keywords = {Ionisation vacuum gaugeHot cathodeSensitivitySecondary electronsIon induced secondary electron yield}, web_url = {https://arxiv.org/abs/2103.03566}, misc2 = {EMPIR 2020: Support for Impact}, publisher = {Elsevier Ltd}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2021.110239}, stag_bib_extends_levelofaccess = {NA}, author = {Vicar, M. and J{\"o}nnson, G. and Jenninger, B. and Illgen, C. and Bundaleski, N. and Jousten, K. and Boineau, F. and Bernien, M. and Šetina, J. and Teodoro, O.} } @Proceedings { SinghTNMKGBBWZ2021, subid = {2732}, title = {Towards a Continuous Active Optical Atomic Clock With Cold Strontium Atoms}, journal = {2021 JOINT CONFERENCE OF THE EUROPEAN FREQUENCY AND TIME FORUM AND IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM (IEEE EFTF-IFCS 2021)}, year = {2021}, volume = {1}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Contiunous clock,}, web_url = {https://www.eftf.org/fileadmin/documents/eftf/documents/Proceedings/EFTF-IFCS-2021-Proceedings.zip}, misc2 = {EMPIR 2017: Fundamental}, event_place = {on line}, event_name = {Joint Conference of the European-Frequency-and-Time-Forum / IEEE International Frequency Control Symposium (EFTF/IFCS)}, event_date = {09-07-2021 to 14-07-2021}, language = {30}, ISBN = {978-1-6654-3935-0}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {2327-1914}, author = {Singh, V. and Tonoyan, A. and Naroznik, M. and Morzyński, P. and Kovacic, D. and Gogyan, A. and Bilicki, S. and Bober, M. and Witkowski, M. and Zawada, M.} } @Article { SilanderFZZA2020_2, subid = {1785}, title = {An Invar-based Fabry-Perot cavity refractometer with a gallium fixed-point cell for assessment of pressure}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {293-298}, keywords = {Refractometry, Fabry-Perot cavity, Temperature, Gallium, Gas Modulation}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-60}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.987}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Article { ZelanSFZA2020, subid = {1784}, title = {Recent advances in Fabry-Perot-based refractometry utilizing gas modulation for assessment of pressure}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {299-304}, keywords = {Refractometry, Gas Modulation, GAMOR, Pressure}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-61}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.988}, stag_bib_extends_levelofaccess = {NA}, author = {Zelan, M. and Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Axner, O.} } @Article { ForssenSSJBHAZ2020, subid = {1786}, title = {A transportable refractometer for assessment of pressure in the kPa range with ppm level precision}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {287-292}, keywords = {Refractometry; Pressure; Gas Modulation, GAMOR; Transportable}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-59}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.986}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Szabo, D. and J{\"o}nsson, G. and Bjerling, M. and Hausmaninger, T. and Axner, O. and Zelan, M.} } @Article { ZakrissonSFSMPKARA2020, subid = {1787}, title = {Simulation of pressure-induced cavity deformation – the 18SIB04 Quantumpascal EMPIR project}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {281-286}, keywords = {EMPIR; QuantumPascal; FEM; Pressure; Refractometry; Deformation.}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-58}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.985}, stag_bib_extends_levelofaccess = {NA}, author = {Zakrisson, J. and Silander, I. and Forss{\'e}n, C. and Silvestri, Z. and Mari, D. and Pasqualin, S. and Kussicke, A. and Asbahr, P. and Rubin, T. and Axner, O.} } @Article { SilvestriBOW2020, subid = {1831}, title = {Towards an improved helium-based refractometer for pressure measurements}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {305}, keywords = {refractometry, Fabry-Perot, pressure measurement, quantum pascal}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-62}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.989}, stag_bib_extends_levelofaccess = {NA}, author = {Silvestri, Z. and Bentouati, D. and Otal, P. and Wallerand, J-P.} } @Proceedings { FurtadoPQSLMAARLBCLA2020, subid = {1898}, title = {First density comparison on viscoelastic samples by oscillation-type densimetry}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements}, pages = {79}, keywords = {EMPIR rhoLiq Project; oscillation-type density meter; viscoelasticity; comparison}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IMEKO International Measurement Confederation}, event_place = {-}, event_name = {IMEKO TC3, TC5, TC16 and TC2}, event_date = {16-11-2020 to 18-11-2020}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.943}, stag_bib_extends_levelofaccess = {NA}, author = {Furtado, A. and Pereira, J. and Quendera, R. and Schiebl, M. and Lenard, E. and Malejczyk, E. and Alic, A. and Alisic, S. and Rauch, J. and Lorenz, F. and Bescupschii, A. and Ciubara, A. and Laky, B. and Ams{\"u}ss, R.} } @Article { ZelenkaASHKPPDZCM2020, subid = {2108}, title = {Improvement of the realisation of the mass scale}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {19RPT02: RealMass: Improvement of the realisation of the mass scale}, pages = {4}, keywords = {Mass realisation, kilogram, multiplies and sub-multiplies, subdivision and multiplication, OIML R111}, web_url = {https://acta.imeko.org/index.php/acta-imeko/index}, misc2 = {EMPIR 2019: Research Potential}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.928}, stag_bib_extends_levelofaccess = {NA}, author = {Zelenka, Z. and Alisic, S. and Stoilkovska, B. and Hanrahan, R. and Kolozinsky, I. and Popa, G. and Pantic, D. and Dikov, V. and Zůda, J. and Coenegrachts, M. and Malengo, A.} } @Article { ChouhanJHBGSBH2020, subid = {2033}, title = {Emerging tri‐s‐triazine‐based graphitic carbon nitride: A potential signal‐transducing nanostructured material for sensor applications}, journal = {Nano Select}, year = {2020}, month = {12}, day = {30}, volume = {2}, number = {4}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {712-743}, keywords = {sorbent traps, tri‐s‐triazine‐based graphitic carbon nitride, nanostructured material, sonsors, mercury}, misc2 = {EMPIR 2016: Environment}, publisher = {Wiley}, language = {30}, ISSN = {2688-4011, 2688-4011}, DOI = {10.1002/nano.202000228}, stag_bib_extends_levelofaccess = {NA}, author = {Chouhan, R.S. and Jerman, I. and Heath, D. and Bohm, S. and Gandhi, S. and Sadhu, V. and Baker, S. and Horvat, M.} } @Article { NaccaratoTMMMZPAPNMWSMMSBPSW2020, subid = {2035}, title = {A field intercomparison of three passive air samplers for gaseous mercury in ambient air}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {12}, day = {29}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {atmnospheric gaseous mercury, passive samplers, intercomparison}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, DOI = {10.5194/amt-2020-455}, stag_bib_extends_levelofaccess = {NA}, author = {Naccarato, A. and Tassone, A. and Martino, M. and Moretti, S. and Macagnano, A. and Zampetti, E. and Papa, P. and Avossa, J. and Pirrone, N. and Nerentorp, M. and Munthe, J. and W{\"a}ngberg, I. and Stupple, G.W. and Mitchell, C.P.J. and Martin, A.R. and Steffen, A. and Babi, D. and Prestbo, E.M. and Sprovieri, F. and Wania, F.} } @Article { YrjanaSIKLB2020, subid = {2182}, title = {Potentiometric Carboxylate Sensors Based on Carbazole-Derived Acyclic and Macrocyclic Ionophores}, journal = {Chemosensors}, year = {2020}, month = {12}, day = {24}, volume = {9}, number = {1}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {4}, keywords = {ion-selective electrodesanion receptorsionophorescarboxylateelectrode shell material}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-9040}, DOI = {10.3390/chemosensors9010004}, stag_bib_extends_levelofaccess = {NA}, author = {Yrj{\"a}n{\"a}, V. and Saar, I. and Ilisson, M. and Kadam, S.A. and Leito, I. and Bobacka, J.} } @Article { SeresSSS2020, subid = {2270}, title = {High harmonic generation in AlN due to out-of-surface electron orbitals}, journal = {OSA Continuum}, year = {2020}, month = {12}, day = {24}, volume = {4}, number = {1}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {47}, keywords = {VUV frequency comb}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {2578-7519}, DOI = {10.1364/OSAC.404942}, stag_bib_extends_levelofaccess = {NA}, author = {Seres, J. and Seres, E. and Serrat, C. and Schumm, T.} } @Article { ZuccaSP2020, subid = {1795}, title = {A measurement system for the characterization of wireless charging stations for electric vehicles}, journal = {IEEE Transactions on Instrumentation and measurement}, year = {2020}, month = {12}, day = {23}, volume = {Early Acce}, number = {ea}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {pp. 1-10}, keywords = {Measurement, Measurement uncertainty, Inductive charging, Electric vehicles.}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=9305232}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, language = {30}, ISSN = {1557-9662}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://ieeexplore.ieee.org/document/9191828}, author = {Zucca, M. and Squillari, P. and Pogliano, U.} } @Article { VisserRSDMW2020, subid = {2009}, title = {A single-beam photothermal interferometer for in situ measurements of aerosol light absorption}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {12}, day = {23}, volume = {13}, number = {12}, number2 = {16ENV02: Black Carbon: Metrology for light absorption by atmospheric aerosols}, pages = {7097-7111}, keywords = {single-beam photothermal interferometer; measurement; aerosol light absorption; standard dual-beam photothermal interferometers; light-absorbing gases; NO2; black carbon; concentration; detection limits}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-13-7097-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Visser, B. and R{\"o}hrbein, J. and Steigmeier, P. and Drinovec, L. and Močnik, G. and Weingartner, E.} } @Article { FerreroFSSSCH2020, subid = {1778}, title = {Fundamental scattering quantities for the determination of reflectance and transmittance}, journal = {Optics Express}, year = {2020}, month = {12}, day = {22}, volume = {29}, number = {1}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, pages = {219}, keywords = {BRDF, BSSRDF, reflectance, transmittance}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.410225}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Frisvad, J.R. and Simonot, L. and Santaf{\'e}, P. and Schirmacher, A. and Campos, J. and Hebert, M.} } @Article { ChenMSd2020, subid = {2065}, title = {Precise Amplitude and Phase Determination Using Resampling Algorithms for Calibrating Sampled Value Instruments}, journal = {Sensors}, year = {2020}, month = {12}, day = {21}, volume = {20}, number = {24}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {7345}, keywords = {resampling algorithm; sampled values; SV-based instrumentation; SV-based calibration; phase synchronisation; sinc interpolation}, web_url = {https://www.mdpi.com/1424-8220/20/24/7345}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20247345}, stag_bib_extends_levelofaccess = {NA}, author = {Chen, Y. and Mohns, E. and Seckelmann, M. and de Rose, S.} } @Proceedings { SpositoLS2020, subid = {1975}, title = {Towards an Ultra-High-Speed Combustion Pyrometer}, journal = {International Journal of Turbomachinery, Propulsion and Power}, year = {2020}, month = {12}, day = {15}, volume = {5}, number = {4}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {31}, keywords = {combustion, temperature, pyrometer, optical sensor}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, event_place = {Graz, Austria}, event_name = {9th EVI-GTI International Gas Turbine Instrumentation Conference}, event_date = {20-11-2019 to 21-11-2019}, language = {30}, ISSN = {2504-186X}, DOI = {10.3390/ijtpp5040031}, stag_bib_extends_levelofaccess = {NA}, author = {Sposito, A. and Lowe, D. and Sutton, G.} } @Article { BowdenVHSH2020, subid = {2729}, title = {Improving the Q Factor of an Optical Atomic Clock Using Quantum Nondemolition Measurement}, journal = {Physical Review X}, year = {2020}, month = {12}, day = {15}, volume = {10}, number = {4}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Atomic and Molecular Physics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2160-3308}, DOI = {10.1103/PhysRevX.10.041052}, stag_bib_extends_levelofaccess = {NA}, author = {Bowden, W. and Vianello, A. and Hill, I.R. and Schioppo, M. and Hobson, R.} } @Article { RidlerSSSSW2020, subid = {1833}, title = {Establishing waveguide lines as primary standards for scattering parameter measurements at submillimetre wavelengths}, journal = {Metrologia}, year = {2020}, month = {12}, day = {14}, volume = {58}, number = {1}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1-13}, keywords = {metrological traceability, vector network analyser, calibration, waveguide, sub-millimetre-wave measurements, scattering parameters}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abd371}, stag_bib_extends_levelofaccess = {NA}, author = {Ridler, N. and Susan Johny, A. and Salter, M. and Shang, X. and Sun, W. and Wilson, A.} } @Article { OlbrichSBSOS2020, subid = {1677}, title = {Identification of coherent structures in horizontal slug flow}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {12}, volume = {76}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {101814}, keywords = {Slug flow, Coherent structures, Snapshot POD}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101814}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and Schmeyer, E. and B{\"a}r, M. and Sieber, M. and Oberleithner, K. and Schmetler, S.} } @Article { DitaliaTchernijLCSPTBCPPDMAOSMGF2020, subid = {1730}, title = {Fluorine-based color centers in diamond}, journal = {Scientific Reports}, year = {2020}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {21537}, keywords = {Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-78436-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Corte, E. and Sardi, F. and Picollo, F. and Traina, P. and Brajković, M. and Crnjac, A. and Pezzagna, S. and Pastuović, Ž. and Degiovanni, I.P. and Moreva, E. and Apr{\`a}, P. and Olivero, P. and Siketić, Z. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { SchmelterKOFB2020, subid = {1764}, title = {On the influence of inlet perturbations on slug dynamics in horizontal multiphase flow – a computational study}, journal = {Metrologia}, year = {2020}, month = {12}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, keywords = {multiphase flow, two-phase flow, gas-liquid flow, slug flow, computational fluid dynamics (CFD), inlet perturbation, random perturbation}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abd1c9}, stag_bib_extends_levelofaccess = {NA}, author = {Schmelter, S. and Knotek, S. and Olbrich, M. and Fiebach, A. and Baer, M.} } @Article { DitaliaTchernijLCSPTBCPPDMAOSMGF2020_2, subid = {1806}, title = {Fluorine-based color centers in diamond}, journal = {Scientific Reports}, year = {2020}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-78436-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Corte, E. and Sardi, F. and Picollo, F. and Traina, P. and Brajković, M. and Crnjac, A. and Pezzagna, S. and Pastuović, Ž. and Degiovanni, I.P. and Moreva, E. and Apr{\`a}, P. and Olivero, P. and Siketić, Z. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { BukerSdMM2020, subid = {1822}, title = {Investigations on pressure dependence of Coriolis Mass Flow Meters used at Hydrogen Refueling Stations}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {12}, volume = {76}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {101815}, keywords = {Hydrogen, Coriolis Mass Flow Meter, Flow metering, High pressure, Hydrogen Refueling Station}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101815}, stag_bib_extends_levelofaccess = {NA}, author = {B{\"u}ker, O. and Stolt, K. and de Huu, M. and MacDonald, M. and Maury, R.} } @Article { SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020, subid = {1841}, title = {The European Joint Research Project UHDpulse – Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, journal = {Physica Medica}, year = {2020}, month = {12}, volume = {80}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {134-150}, keywords = {Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2020.09.020}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}ller, A. and Heinrich, S. and Fouillade, C. and Subiel, A. and De Marzi, L. and Romano, F. and Peier, P. and Trachsel, M. and Fleta, C. and Kranzer, R. and Caresana, M. and Salvador, S. and Busold, S. and Sch{\"o}nfeld, A. and McEwen, M. and Gomez, F. and Solc, J. and Bailat, C. and Linhart, V. and Jakubek, J. and Pawelke, J. and Borghesi, M. and Kapsch, R-P. and Knyziak, A. and Boso, A. and Olsovcova, V. and Kottler, C. and Poppinga, D. and Ambrozova, I. and Schmitzer, C-S. and Rossomme, S. and Vozenin, M-C.} } @Article { GiordanoSGvS2020, subid = {1931}, title = {Methodology for the Accurate Measurement of the Power Dissipated by Braking Rheostats}, journal = {Sensors}, year = {2020}, month = {12}, volume = {20}, number = {23}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {6935}, keywords = {power measurement; braking rheostat; regenerative braking; current transducer; frequency characterization; chopped current; railway system; DC locomotive}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20236935}, stag_bib_extends_levelofaccess = {NA}, author = {Giordano, D. and Signorino, D. and Gallo, D. and van den Brom, H.E. and Š{\'i}ra, M.} } @Article { MeddingsHOLRNSHRGP2020, subid = {1986}, title = {Application of electrochemical impedance spectroscopy to commercial Li-ion cells: A review}, journal = {Journal of Power Sources}, year = {2020}, month = {12}, volume = {480}, number2 = {17IND10: LiBforSecUse: Quality assessment of electric vehicle Li-ion batteries for second use applications}, pages = {228742}, keywords = {Lithium-ion batteryEISInterpretationValidationMetrologyDegradation}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0378-7753}, DOI = {10.1016/j.jpowsour.2020.228742}, stag_bib_extends_levelofaccess = {NA}, author = {Meddings, N. and Heinrich, M. and Overney, F. and Lee, J-S. and Ruiz, V. and Napolitano, E. and Seitz, S. and Hinds, G. and Raccichini, R. and Gaberšček, M. and Park, J.} } @Proceedings { ElgGAMMHHLMPMSV2020, subid = {2062}, title = {Research Project EMPIR 19ENG02 Future Energy}, journal = {VDE High Voltage Technology 2020; ETG-Symposium}, year = {2020}, month = {12}, volume = {N/A}, number = {N/A}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {N/A}, keywords = {UHVDC, traceability, Lightning Impulse, linearity, voltage dependence, HVAC, DC partial discharge, GIS Partial discharge}, web_url = {https://ieeexplore.ieee.org/servlet/opac?punumber=9275417}, misc2 = {EMPIR 2019: Energy}, publisher = {VDE}, event_place = {Berlin, Germany}, event_name = {VDE High Voltage Technology 2020; ETG-Symposium}, event_date = {09-11-2020 to 11-11-2020}, language = {30}, ISBN = {978-3-8007-5353-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4769653}, author = {Elg, A-P. and Garnacho, F. and Agazar, M. and Meisner, J. and Merev, A. and Houtzager, E. and H{\"a}llstr{\"o}m, J. and Lahti, K. and Mier Escurra, C. and Platinero, C. and Micand, T. and Steiner, T. and Voss, A.} } @Article { ImbraguglioSS2020, subid = {2073}, title = {Comparison of ITS-90 realizations from 13 K to 273 K between LNE-CNAM and INRIM}, journal = {Measurement}, year = {2020}, month = {12}, volume = {166}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {108225}, keywords = {Fixed points, ITS-90, CSPRT, Comparison, Cryogenics}, web_url = {https://arxiv.org/abs/2007.11340}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2020.108225}, stag_bib_extends_levelofaccess = {NA}, author = {Imbraguglio, D. and Steur, P.P.M. and Sparasci, F.} } @Article { PiliaSRGDKCL2020, subid = {2455}, title = {Quantification and classification of potassium and calcium disorders with the electrocardiogram: What do clinical studies, modeling, and reconstruction tell us?}, journal = {APL Bioengineering}, year = {2020}, month = {12}, volume = {4}, number = {4}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {041501}, keywords = {Electrolytes, Medical diagnosis, Computational models, Wearable technology, Medical tests, Artificial neural networks, Artificial intelligence, Machine learning, Dialysis}, misc2 = {EMPIR 2018: Health}, publisher = {AIP Publishing}, language = {30}, ISSN = {2473-2877}, DOI = {10.1063/5.0018504}, stag_bib_extends_levelofaccess = {NA}, author = {Pilia, N. and Severi, S. and Raimann, J.G. and Genovesi, S. and D{\"o}ssel, O. and Kotanko, P. and Corsi, C. and Loewe, A.} } @Article { ShakelWGK2020, subid = {1873}, title = {Narrow stack emissions: Errors in flow rate measurement due to disturbances and swirl}, journal = {Journal of the Air \& Waste Management Association}, year = {2020}, month = {11}, day = {30}, volume = {71}, number = {1}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, pages = {46-59}, keywords = {international standards, methods to measure emissions, industrial stacks, small emission limit values, data, flow disturbances, narrow stacks, policy-makers.}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1096-2247, 2162-2906}, DOI = {10.1080/10962247.2020.1832621}, stag_bib_extends_levelofaccess = {NA}, author = {Shakel, D. and Workamp, M. and Gersl, J. and Knotek, S.} } @Article { KrauseBNLS2020, subid = {2733}, title = {Simple and compact diode laser system stabilized to Doppler-broadened iodine lines at 633  nm}, journal = {Applied Optics}, year = {2020}, month = {11}, day = {30}, volume = {59}, number = {34}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {10808}, keywords = {Iodine cell, laser system}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1559-128X, 2155-3165}, DOI = {10.1364/AO.409308}, stag_bib_extends_levelofaccess = {NA}, author = {Krause, F. and Benkler, E. and N{\"o}lleke, C. and Leisching, P. and Sterr, U.} } @Article { LopezMPSGBSCDK2020, subid = {1731}, title = {A study to develop a robust method for measuring the detection efficiency of free-running InGaAs/InP single-photon detectors}, journal = {EPJ Quantum Technology}, year = {2020}, month = {11}, day = {25}, volume = {7}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {14}, keywords = {Quantum technologyQuantum radiometryDetection efficiencySingle-photon detectorsSingle-photon sourcesMetrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2662-4400, 2196-0763}, DOI = {10.1140/epjqt/s40507-020-00089-1}, stag_bib_extends_levelofaccess = {NA}, author = {L{\'o}pez, M. and Meda, A. and Porrovecchio, G. and Starkwood, R.A. and Genovese, M. and Brida, G. and Smid, M. and Chunnilall, C.J. and Degiovanni, I.P. and K{\"u}ck, S.} } @Article { LopezMPSGBSCDK2020_2, subid = {1805}, title = {A study to develop a robust method for measuring the detection efficiency of free-running InGaAs/InP single-photon detectors}, journal = {EPJ Quantum Technology}, year = {2020}, month = {11}, day = {25}, volume = {7}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Quantum technologyQuantum radiometryDetection efficiencySingle-photon detectorsSingle-photon sourcesMetrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2662-4400, 2196-0763}, DOI = {10.1140/epjqt/s40507-020-00089-1}, stag_bib_extends_levelofaccess = {NA}, author = {L{\'o}pez, M. and Meda, A. and Porrovecchio, G. and Starkwood, R.A. and Genovese, M. and Brida, G. and Smid, M. and Chunnilall, C.J. and Degiovanni, I.P. and K{\"u}ck, S.} } @Article { BuarMSPSi2020, subid = {1830}, title = {Statistics of a Sharp GP2Y Low-Cost Aerosol PM Sensor Output Signals}, journal = {Sensors}, year = {2020}, month = {11}, day = {24}, volume = {20}, number = {23}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {6707}, keywords = {low-cost sensors; aerosol sensors; air quality sensors}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20236707}, stag_bib_extends_levelofaccess = {NA}, author = {Bučar, K. and Malet, J. and Stabile, L. and Pražnikar, J. and Seeger, S. and Žitnik, M.} } @Article { BuarMSPSi20200, subid = {1830}, title = {Statistics of a Sharp GP2Y Low-Cost Aerosol PM Sensor Output Signals}, journal = {Sensors}, year = {2020}, month = {11}, day = {24}, volume = {20}, number = {23}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {6707}, keywords = {low-cost sensors; aerosol sensors; air quality sensors}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20236707}, stag_bib_extends_levelofaccess = {NA}, author = {Bučar, K. and Malet, J. and Stabile, L. and Pražnikar, J. and Seeger, S. and Žitnik, M.} } @Article { BarreQSDBTESdA2020, subid = {2036}, title = {Comparison of the Isotopic Composition of Hg and Pb in Two Atmospheric Bioaccumulators in a Pyrenean Beech Forest (Iraty Forest, Western Pyrenees, France/Spain)}, journal = {Frontiers in Environmental Chemistry}, year = {2020}, month = {11}, day = {23}, volume = {1}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {isotopic composition, mercury, biomonitoring}, misc2 = {EMPIR 2016: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-4486}, DOI = {10.3389/fenvc.2020.582001}, stag_bib_extends_levelofaccess = {NA}, author = {Barre, J.P.G. and Queipo-Abad, S. and Sola-Larra{\~n}aga, C. and Deletraz, G. and B{\'e}rail, S. and Tessier, E. and Elustondo Valencia, D. and Santamar{\'i}a, J.M. and de Diego, A. and Amouroux, D.} } @Article { SachsePVSRBBHKSKH2020, subid = {1704}, title = {Assessing Optical and Electrical Properties of Highly Active IrOx Catalysts for the Electrochemical Oxygen Evolution Reaction via Spectroscopic Ellipsometry}, journal = {ACS Catalysis}, year = {2020}, month = {11}, day = {20}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {14210-14223}, keywords = {spectroscopic ellipsometry, electrocatalysis, oxygen evolution reaction, mesoporous iridium oxidefilms, non-destructive ambient analysis, intrinsic OER activity, complementary methodology and metrology}, misc2 = {EMPIR 2016: Energy}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2155-5435, 2155-5435}, DOI = {10.1021/acscatal.0c03800}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Pfl{\"u}ger, M. and Velasco-V{\'e}lez, J-J. and Sahre, M. and Radnik, J. and Bernicke, M. and Bernsmeier, D. and Hodoroaba, V-D. and Krumrey, M. and Strasser, P. and Kraehnert, R. and Hertwig, A.} } @Article { PezzeS2020, subid = {1811}, title = {Heisenberg-Limited Noisy Atomic Clock Using a Hybrid Coherent and Squeezed State Protocol}, journal = {Physical Review Letters}, year = {2020}, month = {11}, day = {19}, volume = {125}, number = {21}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {spin squeezing, Heisenberg limit}, web_url = {https://arxiv.org/abs/2003.10943}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.210503}, stag_bib_extends_levelofaccess = {NA}, author = {Pezz{\`e}, L. and Smerzi, A.} } @Article { AqeelSTMMBBGPB2020, subid = {2388}, title = {Microwave Spectroscopy of the Low-Temperature Skyrmion State in Cu2OSeO3}, journal = {Physical Review Letters}, year = {2020}, month = {11}, day = {17}, volume = {126}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {017202-1 - 017202-7}, keywords = {Lattice dynamics, Magnetic order, Magnetism, Magnetization dynamics, Skyrmions, Spin waves}, web_url = {https://arxiv.org/abs/2011.07826}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.126.017202}, stag_bib_extends_levelofaccess = {NA}, author = {Aqeel, A. and Sahliger, J. and Taniguchi, T. and M{\"a}ndl, S. and Mettus, D. and Berger, H. and Bauer, A. and Garst, M. and Pfleiderer, C. and Back, C.H.} } @Article { KokurewiczSBSKHMKJ2020, subid = {1842}, title = {Dosimetry for New Radiation Therapy Approaches Using High Energy Electron Accelerators}, journal = {Frontiers in Physics}, year = {2020}, month = {11}, day = {13}, volume = {8}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {Dosimetry, FLASH beams, Absorbed dose, ultra-high pulse dose rates, High Energy Electron Accelerators}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2020.568302}, stag_bib_extends_levelofaccess = {NA}, author = {Kokurewicz, K. and Sch{\"u}ller, A. and Brunetti, E. and Subiel, A. and Kranzer, R. and Hackel, T. and Meier, M. and Kapsch, R-P. and Jaroszynsk, D.A.} } @Article { HeeringBS2020, subid = {1699}, title = {Glass electrode half-cells for measuring unified pH in ethanol–water mixtures}, journal = {Journal of Sensors and Sensor Systems}, year = {2020}, month = {11}, day = {11}, volume = {9}, number = {2}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {383-389}, keywords = {unified pH, pHabs, water-ethanol mixtures, glass electrode half-cells, ionic liquid, [N2225][NTf2]}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-9-383-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, A. and Bastkowski, F. and Seitz, S.} } @Article { FerreroBCPPPSSVM2020, subid = {1740}, title = {An insight into the present capabilities of national metrology institutes for measuring sparkle}, journal = {Metrologia}, year = {2020}, month = {11}, day = {11}, volume = {57}, number = {6}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {065029}, keywords = {sparkle, texture, reflectance, contrast threshold, gonio-spectrophotometry}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abb0a3}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, A. and Basic, N. and Campos, J. and Pastuschek, M. and Perales, E. and Porrovecchio, G. and Smid, M. and Schirmacher, A. and Vel{\'a}zquez, J.L. and Mart{\'i}nez-Verd{\'u}, F.} } @Proceedings { MeisnerGSHSEGRMLBOGS2020, subid = {1922}, title = {Support for standardisation of high voltage testing with composite and combined wave shapes}, journal = {VDE High Voltage Technology 2020, ETG-Symposium}, year = {2020}, month = {11}, day = {11}, number2 = {19NRM07: HV-com²: Support for standardisation of high voltage testing with composite and combined wave shapes}, keywords = {Electricity grids, high voltage testing, traceability, combined wave shapes, composite wave shapes, universal dividers, calibration}, web_url = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {VDE}, event_place = {online}, event_name = {VDE High Voltage Technology 2020}, event_date = {09-11-2020 to 11-11-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.19NRM07.CA.20210215}, author = {Meisner, J. and Gockenbach, E. and Saadeddine, H. and Havunen, J. and Schichler, U. and Elg, A-P. and Garnacho, F. and Roccato, P.E. and Merev, A. and Lahti, K. and Backhaus, K. and Orrea, A. and Gamlin, M. and Steiner, T.} } @Article { HeeringBS2020_2, subid = {2181}, title = {Glass electrode half-cells for measuring unified pH in ethanol–water mixtures}, journal = {Journal of Sensors and Sensor Systems}, year = {2020}, month = {11}, day = {11}, volume = {9}, number = {2}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {383-389}, keywords = {Glass electrode half-cells unified pHethanol–water mixtures}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-9-383-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, A. and Bastkowski, F. and Seitz, S.} } @Article { Sarraf2020, subid = {1972}, title = {A method for assessing the uncertainty of a secondary dynamic pressure standard using shock tube}, journal = {Measurement Science and Technology}, year = {2020}, month = {11}, day = {10}, volume = {32}, number = {1}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {015013}, keywords = {dynamic pressure, Shock tube, calibration, secondary standard, uncertainty}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aba56a}, stag_bib_extends_levelofaccess = {NA}, author = {Sarraf, C.} } @Article { PellegrinoIPSROMHM2020, subid = {1658}, title = {Machine learning approach for elucidating and predicting the role of synthesis parameters on the shape and size of TiO2 nanoparticles}, journal = {Scientific Reports}, year = {2020}, month = {11}, volume = {10}, number = {1}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {18910-1-11}, keywords = {nanoparticles, titanium dioxide, size, shape, machine learning, synthesis}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-75967-w}, stag_bib_extends_levelofaccess = {NA}, author = {Pellegrino, F. and Isopescu, R. and Pelluti{\`e}, L. and Sordello, F. and Rossi, A.M. and Ortel, E. and Martra, G. and Hodoroaba, V-D. and Maurino, V.} } @Article { MitevCPGDMS2020, subid = {1836}, title = {Methods for the experimental study of 220Rn homogeneity in calibration chambers}, journal = {Applied Radiation and Isotopes}, year = {2020}, month = {11}, volume = {165}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {109259}, keywords = {Thoron (220Rn), Thoron calibration, Thoron homogeneity, LSC, Nuclear track detectors}, web_url = {https://zenodo.org/record/4160815}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2020.109259}, stag_bib_extends_levelofaccess = {NA}, author = {Mitev, K. and Cassette, P. and Pressyanov, D. and Georgiev, S. and Dutsov, C. and Michielsen, N. and Sabot, B.} } @Article { IstrateKSRFSSG2020, subid = {1960}, title = {Laboratory Calibration of Energy Measurement Systems (EMS) under AC Distorted Waveforms}, journal = {Sensors}, year = {2020}, month = {11}, volume = {20}, number = {21}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {6301}, keywords = {energy measurement; railway system; calibration setup; fictive power source; distorted regime; harmonic waveform; calibration procedure; energy measuring system}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20216301}, stag_bib_extends_levelofaccess = {NA}, author = {Istrate, D. and Khamlichi, A. and Soccalingame, S. and Rovira, J. and Fortune, D. and Š{\'i}ra, M. and Simon, P. and Garnacho, F.} } @Article { IstrateKSRFSS2020, subid = {1930}, title = {Laboratory Calibration of Energy Measurement Systems (EMS) under AC Distorted Waveforms}, journal = {Sensors}, year = {2020}, month = {11}, volume = {20}, number = {21}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {6301}, keywords = {energy measurement; railway system; calibration setup; fictive power source; distorted regime; harmonic waveform; calibration procedure; energy measuring system}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20216301}, stag_bib_extends_levelofaccess = {NA}, author = {Istrate, D. and Khamlichi, A. and Soccalingame, S. and Rovira, J. and Fortune, D. and Š{\'i}ra, M. and Simon, P.} } @Article { BlakesleyKDHTMSA2020, subid = {1949}, title = {Effective Spectral Albedo from Satellite Data for Bifacial Gain Calculations of PV Systems}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {1292 - 1297}, keywords = {Albedo, Bificial PV Module}, web_url = {https://zenodo.org/record/4055920}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {3-936338-73-6}, author = {Blakesley, J.C. and Koutsourakis, G. and Douglas, S. and Holder, J.K.L. and Torry, J. and Mukadam, F. and Schmid, A. and Abrams, R.S.J.} } @Article { BourgouinSHKPKM2020, subid = {1840}, title = {Calorimeter for Real-Time Dosimetry of Pulsed Ultra-High Dose Rate Electron Beams}, journal = {Frontiers in Physics}, year = {2020}, month = {10}, day = {30}, volume = {8}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, FLASH radiation therapy, calorimetry}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2020.567340}, stag_bib_extends_levelofaccess = {NA}, author = {Bourgouin, A. and Sch{\"u}ller, A. and Hackel, T. and Kranzer, R. and Poppinga, D. and Kapsch, R-P. and McEwen, M. } } @Article { HuggettBBGHKKMMNPSSVVWZ2020, subid = {1862}, title = {Cautionary Note on Contamination of Reagents Used for Molecular Detection of SARS-CoV-2}, journal = {Clinical Chemistry}, year = {2020}, month = {10}, day = {30}, volume = {66}, number = {11}, number2 = {18HLT03: SEPTIMET: Metrology to enable rapid and accurate clinical measurements in acute management of sepsis}, pages = {1369-1372}, keywords = {SARS-CoV-2, RT-qPCR, contamination, false positive, molecular diagnosis}, web_url = {https://academic.oup.com/clinchem/article/66/11/1369/5902447}, misc2 = {EMPIR 2018: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0009-9147, 1530-8561}, DOI = {10.1093/clinchem/hvaa214}, stag_bib_extends_levelofaccess = {NA}, author = {Huggett, J.F. and Benes, V. and Bustin, S.A. and Garson, J.A. and Harris, K. and Kammel, M. and Kubista, M. and McHugh, T.D. and Moran-Gilad, J. and Nolan, T. and Pfaffl, M.W. and Salit, M. and Shipley, G. and Vallone, P.M. and Vandesompele, J. and Wittwer, C. and Zeichhardt, H.} } @Article { SeferiBMS2020, subid = {1933}, title = {Power Quality Measurement and Active Harmonic Power in 25 kV 50 Hz AC Railway Systems}, journal = {Energies}, year = {2020}, month = {10}, day = {30}, volume = {13}, number = {21}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {5698}, keywords = {railway electrical networks; traction converter; power quality analysis; active power; harmonic power; electric energy meters}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1996-1073}, DOI = {10.3390/en13215698}, stag_bib_extends_levelofaccess = {NA}, author = {Seferi, Y. and Blair, S.M. and Mester, C. and Stewart, B.G.} } @Article { FavalliS2020, subid = {2727}, title = {Time Observables in a Timeless Universe}, journal = {Quantum}, year = {2020}, month = {10}, day = {29}, volume = {4}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {354}, keywords = {time, quantum mechanics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Verein zur Forderung des Open Access Publizierens in den Quantenwissenschaften}, address = {Zurich, Switzerland}, language = {30}, ISSN = {2521-327X}, DOI = {10.22331/q-2020-10-29-354}, stag_bib_extends_levelofaccess = {NA}, author = {Favalli, Tommaso and Smerzi, Augusto} } @Article { HuntRSK2020, subid = {1692}, title = {High-speed density measurement for LNG and other cryogenic fluids using electrical capacitance tomography}, journal = {Cryogenics}, year = {2020}, month = {10}, day = {24}, volume = {113}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {103207}, keywords = {Liquefied natural gasLNGElectrical capacitance tomographyECTDensity measurement}, tags = {EnG}, web_url = {https://doi.org/10.1016/j.cryogenics.2020.103207}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0011-2275}, DOI = {10.1016/j.cryogenics.2020.103207}, stag_bib_extends_levelofaccess = {NA}, author = {Hunt, A. and Rusli, I. and Schakel, M. and Kenbar, A.} } @Article { DorscherABSHSL2020, subid = {1719}, title = {Dynamical decoupling of laser phase noise in compound atomic clocks}, journal = {Communications Physics}, year = {2020}, month = {10}, day = {20}, volume = {3}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {1-8}, keywords = {optical atomic clocks,dynamic decoupling,coherence time,decoherence}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-020-00452-9}, stag_bib_extends_levelofaccess = {NA}, author = {D{\"o}rscher, S. and Al-Masoudi, A. and Bober, M. and Schwarz, R. and Hobson, R. and Sterr, U. and Lisdat, C.} } @Article { HanZGPCSLHKSPLP2020, subid = {1868}, title = {Measurement of thermodynamic temperature between 5 K and 24.5 K with single-pressure refractive-index gas thermometry}, journal = {Metrologia}, year = {2020}, month = {10}, day = {19}, volume = {57}, number = {6}, number2 = {18SIB02: Real-K: Realising the redefined kelvin}, pages = {065006}, keywords = {SPRIGT, Cryostat, Resonator.thermodynamic temperature,}, tags = {SEG}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/ab84ca/pdf}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab84ca}, stag_bib_extends_levelofaccess = {NA}, author = {Han, D. and Zhang, H. and Gao, B. and Pan, C. and Chen, H. and Song, Y. and Liu, W. and Hu, J. and Kong, X. and Sparasci, F. and Plimmer, M. and Luo, E. and Pitre, L.} } @Article { MantouvalouJSMKWHWGBGD2020, subid = {1689}, title = {Laboratory grazing-incidence X-ray fluorescence spectroscopy as an analytical tool for the investigation of sub-nanometer CrSc multilayer water window optics}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {10}, day = {10}, volume = {174}, number2 = {17SIP07: Adlab-XMet: Advancing laboratory based X-ray metrology techniques}, pages = {105995}, keywords = {GIXRFMultilayer characterization}, web_url = {https://arxiv.org/abs/2006.12198}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.105995}, stag_bib_extends_levelofaccess = {NA}, author = {Mantouvalou, I. and Jonnard, P. and Szwedowski-Rammert, V. and Meltchakov, E. and Kanngie{\ss}er, B. and Wu, M. and Honicke, P. and Waldschl{\"a}ger, U. and Gross, A. and Baumann, J. and Goetzke, G. and Delmotte, F.} } @Article { BremerWFTSKRHSPMGR2020, subid = {1803}, title = {Quantum dot single-photon emission coupled into single-mode fibers with 3D printed micro-objectives}, journal = {APL Photonics}, year = {2020}, month = {10}, volume = {5}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {106101}, keywords = {Quantum dot single-photon emission}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {2378-0967}, DOI = {10.1063/5.0014921}, stag_bib_extends_levelofaccess = {NA}, author = {Bremer, L. and Weber, K. and Fischbach, S. and Thiele, S. and Schmidt, M. and Kaganskiy, A. and Rodt, S. and Herkommer, A. and Sartison, M. and Portalupi, S.L. and Michler, P. and Giessen, H. and Reitzenstein, S.} } @Article { RomanoSMLPTMMBMAFGS2020, subid = {1839}, title = {Challenges in dosimetry of particle beams with ultra-high pulse dose rates}, journal = {Journal of Physics: Conference Series}, year = {2020}, month = {10}, volume = {1662}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {012028}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, electrons}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1662/1/012028}, stag_bib_extends_levelofaccess = {NA}, author = {Romano, F. and Subiel, A. and McManus, M. and Lee, N. D. and Palmans, H. and Thomas, R. and McCallum, S. and Milluzzo, G. and Borghesi, M. and McIlvenny, A. and Ahmed, H. and Farabolini, W. and Gilardi, A. and Sch{\"u}ller, A.} } @Thesis { Santafe2020, subid = {1877}, title = {Medida y transferencia de la unidad de BSSRDF}, year = {2020}, month = {10}, number2 = {18SIB03: BxDiff: New quantities for the measurement of appearance}, keywords = {BSSRDF, spectrophotometry, reflectance, transmittance, translucency, scattering}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Universidad Complutense de Madrid}, address = {Madrid}, school = {Universidad Complutense de Madrid}, language = {112}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://digital.csic.es/handle/10261/226200}, author = {Santaf{\'e}, P.} } @Article { SlaninaQDHW2020, subid = {1973}, title = {Comparing the adiabatic and isothermal pressure dependence of the index of refraction in a drop-weight apparatus}, journal = {Applied Physics B}, year = {2020}, month = {10}, volume = {126}, number = {11}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, keywords = {drop-weight, dynamic pressure, adiabatic compression, isothermal compression, liquids, index of refraction, calibration}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-020-07519-z}, stag_bib_extends_levelofaccess = {NA}, author = {Slanina, O. and Quabis, S. and Derksen, S. and Herbst, J. and Wynands, R.} } @Article { SekidoTUHNTKKINOTKCBBMCCLMRBNRZRLPPCPI2020, subid = {1664}, title = {Intercontinental comparison of optical atomic clocks through very long baseline interferometry}, journal = {Nature Physics}, year = {2020}, month = {10}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {Astronomy and astrophysicsAtomic and molecular physicsFibre optics and optical communicationsOptical metrology}, web_url = {http://hdl.handle.net/11696/64130}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-020-01038-6}, stag_bib_extends_levelofaccess = {NA}, author = {Sekido, M. and Takefuji, K. and Ujihara, H. and Hachisu, H. and Nemitz, N. and Tsutsumi, M. and Kondo, T. and Kawai, E. and Ichikawa, R. and Namba, K. and Okamoto, Y. and Takahashi, R. and Komuro, J. and Clivati, C. and Bregolin, F. and Barbieri, P. and Mura, A. and Cantoni, E. and Cerretto, G. and Levi, F. and Maccaferri, G. and Roma, M. and Bortolotti, C. and Negusini, M. and Ricci, R. and Zacchiroli, G. and Roda, J. and Leute, J. and Petit, G. and Perini, F. and Calonico, D. and Pizzocaro, M. and Ido, T.} } @Article { SikorskyGHKGEMRDWBRSKSF2020, subid = {1642}, title = {Measurement of the Th229 Isomer Energy with a Magnetic Microcalorimeter}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {Th229 Isomer Energy, Magnetic Microcalorimeter}, web_url = {https://arxiv.org/abs/2005.13340}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.142503}, stag_bib_extends_levelofaccess = {NA}, author = {Sikorsky, T. and Geist, J. and Hengstler, D. and Kempf, S. and Gastaldo, L. and Enss, C. and Mokry, C. and Runke, J. and D{\"u}llmann, C.E. and Wobrauschek, P. and Beeks, K. and Rosecker, V. and Sterba, J.H. and Kazakov, G. and Schumm, T. and Fleischmann, A.} } @Article { LangeHSSLTP2020, subid = {1671}, title = {Coherent Suppression of Tensor Frequency Shifts through Magnetic Field Rotation}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {second-rank tensor frequency shifts, atomic clocks}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.125.143201}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.143201}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Peik, E.} } @Article { JandaGOPUHRSMRNCHWEACDMORONJKZ2020, subid = {1683}, title = {Magneto-Seebeck microscopy of domain switching in collinear antiferromagnet CuMnAs}, journal = {Physical Review Materials}, year = {2020}, month = {9}, day = {28}, volume = {4}, number = {9}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {094413-1 to 094413-9}, keywords = {-}, web_url = {https://arxiv.org/abs/2004.05460}, misc2 = {EMPIR 2016: Energy}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2475-9953}, DOI = {10.1103/PhysRevMaterials.4.094413}, stag_bib_extends_levelofaccess = {NA}, author = {Janda, T. and Godinho, J. and Ostatnicky, T. and Pfitzner, E. and Ulrich, G. and Hoehl, A. and Reimers, S. and Šob{\'a}ň, Z. and Metzger, T. and Reichlov{\'a}, H. and Nov{\'a}k, V. and Campion, R. P. and Heberle, J. and Wadley, P. and Edmonds, K. W. and Amin, O. J. and Chauhan, J. S. and Dhesi, S. S. and Maccherozzi, F. and Otxoa, R. M. and Roy, P. E. and Olejn{\'i}k, K. and Němec, P. and Jungwirth, T. and Kaestner, B. and Ziade, Francois} } @Article { LangeHSSLTP20200, subid = {1671}, title = {Coherent Suppression of Tensor Frequency Shifts through Magnetic Field Rotation}, journal = {Physical Review Letters}, year = {2020}, month = {9}, day = {28}, volume = {125}, number = {14}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {second-rank tensor frequency shifts, atomic clocks}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.125.143201}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.125.143201}, stag_bib_extends_levelofaccess = {NA}, author = {Lange, R. and Huntemann, N. and Sanner, C. and Shao, H. and Lipphardt, B. and Tamm, Chr. and Peik, E.} } @Proceedings { tenHaveAPSL2020, subid = {2085}, title = {On-Site Waveform Survey in LV Distribution Network using a Photovoltaic Installation}, journal = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2020}, month = {9}, day = {23}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Conducted electromagnetic interference, Distribution network, Non-linear, Photovoltaic installation, Static energy meter}, web_url = {https://research.utwente.nl/en/publications/on-site-waveform-survey-in-lv-distribution-network-using-a-photov}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Barcelona}, event_name = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {23-09-2020 to 25-09-2020}, language = {30}, DOI = {10.1109/EMCEUROPE48519.2020.9245831}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Azpurua, M.A. and Pous, M. and Silva, F. and Leferink, F.} } @Article { DixonDLWMS2020, subid = {1722}, title = {Capturing Complex Behavior in Josephson Traveling-Wave Parametric Amplifiers}, journal = {Physical Review Applied}, year = {2020}, month = {9}, day = {22}, volume = {14}, number = {3}, number2 = {17FUN10: ParaWave: Josephson travelling wave parametric amplifier and its application for metrology}, pages = {1-16}, keywords = {Josephson junctions, SQUID, superconducting devices, Josephson traveling-wave parametric amplifier, coupled mode equations}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.14.034058}, stag_bib_extends_levelofaccess = {NA}, author = {Dixon, T. and Dunstan, J.W. and Long, G.B. and Williams, J.M. and Meeson, P.J. and Shelly, C.D.} } @Article { PellegrinoSMPMH2020, subid = {1609}, title = {Polyethylene Glycol as Shape and Size Controller for the Hydrothermal Synthesis of SrTiO3 Cubes and Polyhedra}, journal = {Nanomaterials}, year = {2020}, month = {9}, day = {21}, volume = {10}, number = {9}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {1892}, keywords = {polyethylene glycol, strontium titanate, controlled morphology, photoelectrochemistry}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano10091892}, stag_bib_extends_levelofaccess = {NA}, author = {Pellegrino, F. and Sordello, F. and Mino, L. and Prozzi, M. and Mansfeld, U. and Hodoroaba, V-D.} } @Article { MomeniPakdehiSNZWNSPSTP2020, subid = {1696}, title = {Silicon Carbide Stacking‐Order‐Induced Doping Variation in Epitaxial Graphene}, journal = {Advanced Functional Materials}, year = {2020}, month = {9}, day = {11}, volume = {30}, number = {45}, number2 = {18SIB07: GIQS: Graphene impedance quantum standard}, pages = {2004695}, keywords = {epitaxial graphenes, hexagonal silicon carbides, SiC spontaneous polarization, surface-dependent polarization doping}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/adfm.202004695}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Wiley}, language = {30}, ISSN = {1616-301X, 1616-3028}, DOI = {10.1002/adfm.202004695}, stag_bib_extends_levelofaccess = {NA}, author = {Momeni Pakdehi, D. and Sch{\"a}dlich, P. and Nguyen, T.T.N. and Zakharov, A.A. and Wundrack, S. and Najafidehaghani, E. and Speck, F. and Pierz, K. and Seyller, T. and Tegenkamp, C. and Pierz, K.} } @Article { WinterSVMRPKHLHDBBBBBBKSR2020, subid = {1950}, title = {Results of the Bifacial PV Cells and PV Modules Power Measurement Round Robin Activity of the PV-Enerate Project}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {9}, day = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {877 - 882}, keywords = {Testing, PV Module, Bifacial PV}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4055707}, author = {Winter, S. and Str{\"a}ter, H. and Vegas, A. and Molinero, R.R. and Riechelmann, S. and Pavanello, D. and Kenny, R. and Herrmann, W. and Lopez-Garcia, J. and Hinken, D. and Dittmann, S. and Bonilla, J. and Bliss, M. and Bothe, K. and Blakesley, J.C. and Betts, T.R. and Bellenda, G. and Koutsourakis, G. and Schmid, A. and Rauer, M.} } @Proceedings { MubarakMTRS2020, subid = {1723}, title = {Automated Contacting of On-Wafer Devices for RF Testing}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {9}, day = {10}, volume = {N/A}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1-2}, keywords = {On-wafer probing, on-wafer contacting, microwave measurements, measurement techniques, measurement uncertainty, precision measurements, uncertainty}, web_url = {https://zenodo.org/record/4276095}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Denver (Aurora), CO, USA, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5899-0}, ISSN = {2160-0171}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1109/CPEM49742.2020.9191800}, author = {Mubarak, F. and Martino, C.D. and Toskovic, R. and Rietveld, G. and Spirito, M.} } @Proceedings { CrottiDGGLLS2020, subid = {1962}, title = {Calibration System for DC Power/Energy Measurement chain in Railway applications}, journal = {IEEE}, year = {2020}, month = {9}, day = {10}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Voltage measurement, Uncertainty, Current measurement, Transducers, Phantoms, Calibration, Rail transportation, Combined Transducers, Power Measurement, Phantom Power, DC Railway, Energy Meter}, web_url = {https://zenodo.org/record/4569831}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Denver, CO, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5898-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM49742.2020.9191718}, stag_bib_extends_levelofaccess = {NA}, author = {Crotti, G. and Delle Femine, A. and Gallo, D. and Giordano, D. and Luiso, M. and Landi, C. and Signorino, D.} } @Article { WilsonSSJR2020, subid = {1581}, title = {Comparing Standardized and Manufacturers’ Interfaces for Waveguides Used at Submillimeter Wavelengths}, journal = {IEEE Transactions on Terahertz Science and Technology}, year = {2020}, month = {9}, volume = {10}, number = {5}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {453-459}, keywords = {Rectangular waveguide, submillimeter-waves, terahertz, waveguide flanges, waveguide interfaces, waveguidestandards}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-342X, 2156-3446}, DOI = {10.1109/TTHZ.2020.3010122}, stag_bib_extends_levelofaccess = {NA}, author = {Wilson, Alan and Sun, Wenjuan and Shang, Xiaobang and Johny, Susan and Ridler, Nick M.} } @Article { WangSRNDHW2020, subid = {1582}, title = {Material Measurements Using VNA-Based Material Characterization Kits Subject to Thru-Reflect-Line Calibration}, journal = {IEEE Transactions on Terahertz Science and Technology}, year = {2020}, month = {9}, volume = {10}, number = {5}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {466-473}, keywords = {Loss tangent, millimeter-wave measurements, relative permittivity, terahertz measurements, time-domain spectrometer (TDS), thru-reflect-line (TRL) calibration, vector network analyzer (VNA)}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-342X, 2156-3446}, DOI = {10.1109/TTHZ.2020.2999631}, stag_bib_extends_levelofaccess = {NA}, author = {Wang, Yi and Shang, Xiaobang and Ridler, Nick M. and Naftaly, Mira and Dimitriadis, Alexandros I. and Huang, Tongde and Wu, Wen} } @Proceedings { RiechelmannSW2020, subid = {1606}, title = {DETERMINATION OF A PV MODULE POWER MATRIX WITH AN LED SOLAR SIMULATOR}, journal = {EUPVSEC-proceedings}, year = {2020}, month = {9}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Energy Rating, Characterization, Electrical Properties, Qualification and Testing, Photovoltaic}, web_url = {https://zenodo.org/record/4049818}, misc2 = {EMPIR 2016: Energy}, event_place = {online conference}, event_name = {EUPVSEC 2020}, event_date = {07-09-2020 to 07-09-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4049818}, author = {Riechelmann, S. and Straeter, H. and Winter, S.} } @Article { OlbrichBOS2020, subid = {1628}, title = {Statistical Characterization of Horizontal Slug Flow Using Snapshot Proper Orthogonal Decomposition}, journal = {International Journal of Multiphase Flow}, year = {2020}, month = {9}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {103453}, keywords = {slug flowcharacterizationproper orthogonal decomposition}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0301-9322}, DOI = {10.1016/j.ijmultiphaseflow.2020.103453}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and B{\"a}r, M. and Oberleithner, K. and Schmelter, S.} } @Article { ZakrissonSFZA2020, subid = {1678}, title = {Procedure for robust assessment of cavity deformation in Fabry–P{\'e}rot based refractometers}, journal = {Journal of Vacuum Science \& Technology B}, year = {2020}, month = {9}, volume = {38}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {054202}, keywords = {Cavity Deformation, Fabry-Perot, refractomtery, Gas Modulation refractomtery (GAMOR)}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/6.0000375}, stag_bib_extends_levelofaccess = {NA}, author = {Zakrisson, J. and Silander, I. and Forss{\'e}n, C. and Zelan, M. and Axner, O.} } @Article { GeorgievaLHCRSKHRRK2020, subid = {1881}, title = {Radiometric characterization of a triggered narrow-bandwidth single-photon source and its use for the calibration of silicon single-photon avalanche detectors}, journal = {Metrologia}, year = {2020}, month = {9}, volume = {57}, number = {5}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {055001}, keywords = {quantum radiometry, quantum metrology, single-photon source, single-photondetector, quantum dot}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab9db6}, stag_bib_extends_levelofaccess = {NA}, author = {Georgieva, H. and L{\'o}pez, M. and Hofer, H. and Christinck, J. and Rodiek, B. and Schnauber, P. and Kaganskiy, A. and Heindel, T. and Rodt, S. and Reitzenstein, S. and K{\"u}ck, S.} } @Proceedings { CascettaCDGGS2020, subid = {1940}, title = {Measuring the impact of reversible substations on energy efficiency in rail transport}, journal = {IMEKO TC-4 2020 PROCEEDINGS}, year = {2020}, month = {9}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Railway braking energy, reversible substation, energy efficiency, voltage-current measurements}, web_url = {https://www.imeko.org/publications/tc4-2020/IMEKO-TC4-2020-24.pdf}, misc2 = {EMPIR 2016: Energy}, event_place = {Palermo, Italy}, event_name = {24th IMEKO TC4 International Symposium 22nd International Workshop on ADC and DAC Modelling and Testing}, event_date = {14-09-2020 to 16-09-2020}, language = {30}, ISBN = {978-92-990084-7-8}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {978-92-990084-7-8}, author = {Cascetta, F. and Cipolletta, G. and Delle Femine, A. and Gallo, D. and Giordano, D. and Signorino, D.} } @Article { HuntMSPYWD2020, subid = {2218}, title = {Comparison of the Sentinel-3A and B SLSTR Tandem Phase Data Using Metrological Principles}, journal = {Remote Sensing}, year = {2020}, month = {9}, volume = {12}, number = {18}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {2893}, keywords = {Sentinel-3A, Copernicus, Tandem-phase data, Earth Observation}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs12182893}, stag_bib_extends_levelofaccess = {NA}, author = {Hunt, S.E. and Mittaz, J.P.D. and Smith, D. and Polehampton, E. and Yemelyanova, R. and Woolliams, E.R. and Donlon, C.} } @Article { CrottivMTLSACMMA2020, subid = {2130}, title = {Measurement Methods and Procedures for Assessing Accuracy of Instrument Transformers for Power Quality Measurements}, journal = {Conference on Precision Electromagnetic Measurements CPEM 2020 Proceedings}, year = {2020}, month = {8}, day = {24}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, keywords = {Instrument transformers, calibration, measurement standards, measurement techniques, measurementuncertainty, precision measurements}, misc2 = {EMPIR 2019: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.5136547}, stag_bib_extends_levelofaccess = {NA}, author = {Crotti, G. and van den Brom, H.E. and Mohns, E. and Tinarelli, R. and Luiso, M. and Styblikova, R. and Agazar, M. and \c{C}aycı, H. and Mazza, P. and Meyer, J. and Almutairi, M. } } @Article { PfitznerUHLZSSHKMW2020, subid = {1800}, title = {Thermoelectric nanospectroscopy for the imaging of molecular fingerprints}, journal = {Nanophotonics}, year = {2020}, month = {8}, day = {21}, volume = {9}, number = {14}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {4347-4354}, keywords = {nanospectroscopy; photothermoelectric effect; s-SNOM}, web_url = {https://www.degruyter.com/view/journals/nanoph/ahead-of-print/article-10.1515-nanoph-2020-0316/article-10.1515-nanoph-2020-0316.xml?tab_body=fullHtml-79543}, misc2 = {EMPIR 2018: Health}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2192-8614, 2192-8606}, DOI = {10.1515/nanoph-2020-0316}, stag_bib_extends_levelofaccess = {NA}, author = {Pfitzner, E. and Ulrich, G. and Hoehl, A. and Liao, J-W. and Zadvorna, O. and Sirringhaus, H. and Schweicher, G. and Heberle, J. and K{\"a}stner, B. and Minutoli, D. and Wunderlich, J.} } @Article { CainSTLWKBLF2020, subid = {1615}, title = {In Situ Electric-Field Study of Surface Effects in Domain Engineered Pb(In1/2Nb1/2)O3-Pb(Mg1/3Nb2/3)O3-PbTiO3 Relaxor Crystals by Grazing Incidence Diffraction}, journal = {Crystals}, year = {2020}, month = {8}, day = {20}, volume = {10}, number = {9}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {728}, keywords = {-}, web_url = {https://electrosciences.co.uk/2020/08/27/grazing_incidence/}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4352}, DOI = {10.3390/cryst10090728}, stag_bib_extends_levelofaccess = {NA}, author = {Cain, M.G. and Staruch, M. and Thompson, P. and Lucas, C. and Wermeille, D. and Kayser, Y. and Beckhoff, B. and Lofland, S.E. and Finkel, P.} } @Article { ClivatiABBDDMMMNLPRRSSSTC2020, subid = {1773}, title = {Common-clock very long baseline interferometry using a coherent optical fiber link}, journal = {Optica}, year = {2020}, month = {8}, day = {20}, volume = {7}, number = {8}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {1031}, keywords = {fiber links, coherent phase transfer, frequency dissemination with fibers, VLBI}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.393356}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Aiello, R. and Bianco, G. and Bortolotti, C. and De Natale, P. and Di Sarno, V. and Maddaloni, P. and Maccaferri, G. and Mura, A. and Negusini, M. and Levi, F. and Perini, F. and Ricci, R. and Roma, M. and Santamaria Amato, L. and Siciliani de Cumis, M. and Stagni, M. and Tuozzi, A. and Clivati, C.} } @Article { MullerSUT2020, subid = {1616}, title = {Determining nonuniformities of core‐shell nanoparticle coatings by analysis of the inelastic background of X‐ray photoelectron spectroscopy survey spectra}, journal = {Surface and Interface Analysis}, year = {2020}, month = {8}, day = {18}, volume = {1}, number = {1}, number2 = {17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses}, pages = {1-1}, keywords = {XPS, core-shell nanoparticles}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421, 1096-9918}, DOI = {10.1002/sia.6865}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, A. and Sparnacci, K. and Unger, W.E.S. and Tougaard, S.} } @Article { SchinkePHWBKNW2020_2, subid = {1604}, title = {Calibrating spectrometers for measurements of the spectral irradiance caused by solar radiation}, journal = {Metrologia}, year = {2020}, month = {8}, day = {17}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {spectral irradiance, solar radiation, measurement uncertainty analysis, spectrometer, spectroradiometer, calibration, solar simulator}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/abafc5}, stag_bib_extends_levelofaccess = {NA}, author = {Schinke, C. and Pollex, H. and Hinken, D. and Wolf, M. and Bothe, K. and Kroeger, I. and Nevas, S. and Winter, S.} } @Article { GomezCGSPHFPTMB2020, subid = {1698}, title = {Rapid three-dimensional multiparametric MRI with quantitative transient-state imaging}, journal = {Scientific Reports}, year = {2020}, month = {8}, day = {13}, volume = {10}, number = {1}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, keywords = {Magnetic Resonance Imaging (MRI)Quantitative MRIMagnetic Resonance Fingerprinting}, web_url = {https://www.nature.com/articles/s41598-020-70789-2}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-70789-2}, stag_bib_extends_levelofaccess = {NA}, author = {G{\'o}mez, P.A. and Cencini, M. and Golbabaee, M. and Schulte, R.F. and Pirkl, C. and Horvath, I. and Fallo, G. and Peretti, L. and Tosetti, M. and Menze, B.H. and Buonincontri, G.} } @Article { KrehlikSB2020, subid = {1738}, title = {Electrical regeneration for long-haul fiber-optic time and frequency distribution systems}, journal = {Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2020}, month = {8}, day = {13}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, keywords = {Time and frequency transfer, fiber optics, optical-electrical-optical regeneration}, web_url = {https://ieeexplore.ieee.org/document/9166557}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TUFFC.2020.3016610}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, Ł. and Buczek, Ł.} } @Article { SchwarzDABLSWRLL2020, subid = {1570}, title = {Long term measurement of the 87Sr clock frequency at the limit of primary Cs clocks}, journal = {Physical Review Research}, year = {2020}, month = {8}, day = {11}, volume = {2}, number = {3}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {033242}, keywords = {Atomic spectra, optical clocks, gravitation}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {Ricklinger Stadtweg 4c}, language = {30}, DOI = {10.1103/PhysRevResearch.2.033242}, stag_bib_extends_levelofaccess = {NA}, author = {Schwarz, R and D{\"o}rscher, S and Al-Masoud, A and Benkler, E and Legero, T and Sterr, U and Weyers, S and Rahm, J and Lipphardt, B and Lisdat, C} } @Proceedings { KazemipourHWAHRSZ2020, subid = {1663}, title = {VNA-Based Material Characterization in THz Domain without Classic Calibration and Time-Gating}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, volume = {N/A}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1-2}, keywords = {Material characterization, parameter extraction, VNA time-gating, RF metrology, measurement uncertainty}, web_url = {https://doi.org/10.5281/zenodo.4243044}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Denver, CO, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5898-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM49742.2020.9191818}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Allal, D. and Hudlicka, M. and Ruefenacht, J. and Stalder, D. and Zeier, M.} } @Article { WeimerSMT2020, subid = {1687}, title = {Energy localization in an atomic chain with a topological soliton}, journal = {Physical Review Research}, year = {2020}, month = {8}, volume = {2}, number = {3}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {cold atoms, ion trapping, soliton, localization}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.2.033198}, stag_bib_extends_levelofaccess = {NA}, author = {Weimer, H. and Santos, L. and Mehlst{\"a}ubler, T. E. and Timm, L.} } @Article { SignorinoGMGFBQDB2020, subid = {1935}, title = {Dataset of measured and commented pantograph electric arcs in DC railways}, journal = {Data in Brief}, year = {2020}, month = {8}, volume = {31}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {105978}, keywords = {Electric arcMeasurement of electrical quantitiesPantographPower qualityRailwaysRolling stock}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {2352-3409}, DOI = {10.1016/j.dib.2020.105978}, stag_bib_extends_levelofaccess = {NA}, author = {Signorino, D. and Giordano, D. and Mariscotti, A. and Gallo, D. and Femine, A.D. and Balic, F. and Quintana, J. and Donadio, L. and Biancucci, A.} } @Proceedings { vanVeghelSvHRvMK2020, subid = {2103}, title = {Towards improved standardization of electricity meter testing}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Energy measurement,electromagnetic compatibility,measurement errors,electricity meters}, web_url = {https://www.techrxiv.org/articles/preprint/Towards_improved_standardization_of_electricity_meter_testing/13469622/1}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Bolder}, event_name = {Conference of Precession Electromagnetic MeasurementsPEM}, event_date = {01-08-2020 to 07-08-2020}, language = {30}, DOI = {10.1109/CPEM49742.2020.9191719}, stag_bib_extends_levelofaccess = {NA}, author = {van Veghel, M.G.A. and Sharma, S. and van den Brom, H.E. and Hoogenboom, D. and Rietveld, G. and van Leeuwen, R. and Marais, Z. and Kok, G.J.P.} } @Article { RuutelYKSIDHHTBL2020, subid = {2185}, title = {Design, synthesis and application of carbazole macrocycles in anion sensors}, journal = {Beilstein Journal of Organic Chemistry}, year = {2020}, month = {8}, volume = {16}, number = {2020}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1901-1914}, keywords = {anion sensors; carboxylates;ionophores; acrocycles; sensor prototype}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Beilstein Institut}, language = {30}, ISSN = {1860-5397}, DOI = {10.3762/bjoc.16.157}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"u}{\"u}tel, A. and Yrj{\"a}n{\"a}, V. and Kadam, S.A. and Saar, I. and Ilisson, M. and Darnell, A. and Haav, K. and Haljasorg, T. and Toom, L. and Bobacka, J. and Leito, I.} } @Miscellaneous { PennecchiRSEv, subid = {1553}, title = {EMUE-D3-2-Low Mass BaP Evaluation}, year = {2020}, month = {7}, day = {31}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Uncertainty evaluation; Monte Carlo method; GUM uncertainty framework;Benzo[a]pyrene; Polycyclic Aromatic Hydrocarbons}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3968940}, stag_bib_extends_levelofaccess = {NA}, author = {Pennecchi, F. and Rolle, F. and Sega, M. and Ellison, S.L.R. and van der Veen, A.M.H.} } @Article { ShuVZAF2020, subid = {1544}, title = {Experimental and Modeling Studies on the Correlation Between Auto-Ignition Delays and the Methane Number of Liquefied Natural Gas (LNG) and Liquefied Biogas (LBG)}, journal = {Frontiers in Mechanical Engineering}, year = {2020}, month = {7}, day = {24}, volume = {6}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, keywords = {liquefied natural gas, liquefied biogas, rapid compression machine, auto-ignition delays, chemical kinetics, modeling, shock tube}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2297-3079}, DOI = {10.3389/fmech.2020.00047}, stag_bib_extends_levelofaccess = {NA}, author = {Shu, B. and Vallabhuni, S.K. and Zheng, J. and Agarwal, S. and Fernandes, R.X.} } @Article { KazemipourWHHYRSGZ2020, subid = {1603}, title = {Analytical Uncertainty Evaluation of Material Parameter Measurements at THz Frequencies}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2020}, month = {7}, day = {24}, volume = {41}, number = {10}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1199 - 1217}, keywords = {Material characterization, Extraction method, THz domain, Sensitivity coefficient, Measurement uncertainty, RF metrology}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1866-6892, 1866-6906}, DOI = {10.1007/s10762-020-00723-0}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Wollensack, M. and Hoffmann, J. and Hudlicka, M. and Yee, S-K. and R{\"u}fenacht, J. and Stalder, D. and G{\"a}umann, G. and Zeier, M.} } @Article { MayerBTOPAGMIMSK2020, subid = {1600}, title = {Flexible numerical simulation framework for dynamic PET-MR data}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {7}, day = {21}, volume = {65}, number = {14}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, pages = {145003}, keywords = {PET-MR,motion correction,simulation,image registration,open source}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab7eee}, stag_bib_extends_levelofaccess = {NA}, author = {Mayer, J. and Brown, R. and Thielemans, K. and Ovtchinnikov, E. and Pasca, E. and Atkinson, D. and Gillman, A. and Marsden, P. and Ippoliti, M. and Makowski, M. and Schaeffter, T. and Kolbitsch, C.} } @Article { BodermannBZMKSDHDK2020, subid = {1559}, title = {Quasi-bound states in the continuum for deep subwavelength structural information retrieval for DUV nano-optical polarizers}, journal = {Optics Express}, year = {2020}, month = {7}, day = {20}, volume = {28}, number = {16}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {23122}, keywords = {quasi-bound states}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.396044}, stag_bib_extends_levelofaccess = {NA}, author = {Bodermann, B. and Burger, S. and Zeitner, U. and Meyer, J. and K{\"a}seberg, T. and Siefke, T. and Dickmann, W. and Hurtado, C.B.R. and Dickmann, J. and Kroker, S.} } @Miscellaneous { CoxS, subid = {1538}, title = {EMUE-D1-4-Key Comparison Gauge Blocks}, year = {2020}, month = {7}, day = {16}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Key comparison, calibration and measurement capability (CMC), measurement uncertainty, Bayesian estimation}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3948342}, stag_bib_extends_levelofaccess = {NA}, author = {Cox, M. and Shirono, K.} } @Article { FretwellLBKDLMPRSF2020, subid = {1539}, title = {Direct Measurement of the 7Be L/K Capture Ratio in Ta-Based Superconducting Tunnel Junctions}, journal = {Physical Review Letters}, year = {2020}, month = {7}, day = {14}, volume = {125}, number = {3}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {032701}, keywords = {7Be, Electron captures, Cryogenic detectors, Theoretical calculations}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2003.04921}, author = {Fretwell, S. and Leach, K.G. and Bray, C. and Kim, G.B. and Dilling, J. and Lennarz, A. and Mougeot, X. and Ponce, F. and Ruiz, C. and Stackhouse, J. and Friedrich, S.} } @Article { WuHRSW2020, subid = {1516}, title = {Characterization of Dielectric Materials at WR-15 Band (50–75 GHz) Using VNA-Based Technique}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2020}, month = {7}, volume = {69}, number = {7}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {4930-4939}, keywords = {Dielectric constant, dielectric measurements, free-space measurement, loss tangent, millimeter-wave measurements, vector network analyzer (VNA)}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2019.2954010}, stag_bib_extends_levelofaccess = {NA}, author = {Wang, Y. and Shang, X. and Ridler, N.M. and Huang, T. and Wu, W.} } @Article { IttermannSHPPSW2020, subid = {1535}, title = {Parallel transmission medical implant safety testbed: Real‐time mitigation of RF induced tip heating using time‐domain E‐field sensors}, journal = {Magnetic Resonance in Medicine}, year = {2020}, month = {7}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {implant safety, MR safety, interventional MRI, open source Hardware, orthogonal projection, parallel transmission}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28379}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, L. and Silemek, B. and Petzold, J. and Pfeiffer, H. and Hoffmann, W. and Seifert, F. and Ittermann, B.} } @Manual { SchonhalsHMHYS2020, subid = {1536}, title = {Good practice guides SmartCom validation}, year = {2020}, month = {7}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {D-SI validation, DCC validation, SmartCom, TraCIM system, online validation, data exchange format, metrology data}, web_url = {https://zenodo.org/record/3816696}, misc2 = {EMPIR 2017: Industry}, publisher = {SmartCom}, language = {30}, DOI = {10.5281/zenodo.3816696}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"o}nhals, S. and Hutzschenreuther, D. and Muller, B. and Heindorf, L. and Yuhui, L. and Smith, I.} } @Article { HeeringSCANNQRBBNSLLURVSDRKL2020, subid = {1554}, title = {Symmetric Potentiometric Cells for the Measurement of Unified pH Values}, journal = {Symmetry}, year = {2020}, month = {7}, volume = {12}, number = {7}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1150}, keywords = {unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-8994}, DOI = {10.3390/sym12071150}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, Agnes and Stoica, Daniela and Cam{\~o}es, Filomena and Anes, B{\'a}rbara and Nagy, D{\'a}niel and Nagyn{\'e} Szil{\'a}gyi, Zs{\'o}fia and Quendera, Raquel and Ribeiro, Luis and Bastkowski, Frank and Born, Rasmus and Nerut, Jaak and Saame, Jaan and Lainela, Silvie and Liv, Lokman and Uysal, Emrah and Rozikov{\'a}, Matilda and Vičarov{\'a}, Martina and Snedden, Alan and Deleebeeck, Lisa and Radtke, Valentin and Krossing, Ingo and Leito, Ivo} } @Article { SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020, subid = {1522}, title = {Determination of consensus kQ values for megavoltage photon beams for the update of IAEA TRS-398}, journal = {Physics in Medicine and Biology}, year = {2020}, month = {6}, day = {22}, volume = {65}, number = {9}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {095011}, keywords = {TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Institute of Physics}, address = {London}, language = {30}, DOI = {10.5281/zenodo.3903294}, stag_bib_extends_levelofaccess = {NA}, author = {Seuntjens, J. and de Prez, L.A. and Pinto, M. and Pimpinella, M. and Oliver, C.P. and Ojala, J. and Muir, B. and Mirzakhanian, L. and Hanlon, M.D. and Francescon, P. and Delaunay, F. and Borbinha, J. and Ballester, F. and Andersen, C.E. and Vatnitsky, S. and McEwen, M. and Kapsch, R.P. and Burns, D.T. and Andreo, P. and Sommier, L. and Teles, P. and Tikkanen, J. and Vijande, J. and Zink, K.} } @Article { SixOMLLJHBBLHYTYM2020, subid = {1577}, title = {What can we learn from N2O isotope data? - Analytics, processes and modelling}, journal = {Rapid Communications in Mass Spectrometry}, year = {2020}, month = {6}, day = {16}, volume = {34}, number = {20}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {14/e8858}, keywords = {nitrous oxide, isotopic composition, isotope ratio mass spectrometry, laser spectroscopy}, web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa:22957}, misc2 = {EMPIR 2016: Environment}, publisher = {John Wiley \& Sons}, language = {30}, DOI = {10.1002/rcm.8858}, stag_bib_extends_levelofaccess = {NA}, author = {Yu, Longfei and Harris, Eliza and Lewicka‐Szczebak, Dominika and Barthel, Matti and Blomberg, Margareta and Harris, Stephen J. and Johnson, Matthew S. and Lehmann, Moritz F. and Liisberg, Jesper and M{\"u}ller, Christoph and Ostrom, Nathaniel E. and Six, Johan and Toyoda, Sakae and Yoshida, Naohiro and Mohn, Joachim} } @Article { BloklandSRB2020, subid = {1517}, title = {Capacitive and Infrared Gas Sensors for the Assessment of the Methane Number of LNG Fuels}, journal = {Sensors}, year = {2020}, month = {6}, day = {12}, volume = {20}, number = {12}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {3345}, keywords = {energy transition; Methane Number; gas composition sensor; capacitive sensor array; interdigitated electrodes; responsive coatings; tunable filter infrared spectrometer; LNG; biogas}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20123345}, stag_bib_extends_levelofaccess = {NA}, author = {Sweelssen, J. and Blokland, H. and Rajamaki, T. and Boersma, A.} } @Article { SalminenSHH2020, subid = {1976}, title = {Advances in traceable calibration of cylinder pressure transducers}, journal = {Metrologia}, year = {2020}, month = {6}, day = {12}, volume = {57}, number = {4}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {045006}, keywords = {dynamic pressure, cylinder pressure, dynamic reference, pressure reference, pressurecalibration, dynamic calibration}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab8fb9}, stag_bib_extends_levelofaccess = {NA}, author = {Salminen, J. and Saxholm, S. and H{\"a}m{\"a}l{\"a}inen, J. and H{\"o}gstr{\"o}m, R.} } @Article { SetinaTIBBJVW2020, subid = {1519}, title = {A review on hot cathode ionisation gauges with focus on a suitable design for measurement accuracy and stability}, journal = {Vacuum}, year = {2020}, month = {6}, day = {10}, volume = {179}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, keywords = {Ionisation gauge, Hot cathode, Sensitivity, Secondary electrons, Electron stimulated desorption}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier}, address = {Munich}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109545}, stag_bib_extends_levelofaccess = {NA}, author = {Jousten, K. and Boineau, F. and Bundaleski, N. and Illgen, C. and Šetina, J. and Teodoro, O.M.N.D. and Vicar, M. and W{\"u}est, M.} } @Miscellaneous { SegaRPSdv, subid = {1509}, title = {EMUE-D3-3-Calibration Gas Mixtures}, year = {2020}, month = {6}, day = {3}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Gas mixtures; Nitrogen oxides; Dynamic dilution; Mass flow controllers; Chemiluminescence analyser; Calibration; Uncertainty and covariance evaluation; Weighted Total Least-Squares}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3875469}, stag_bib_extends_levelofaccess = {NA}, author = {Sega, M. and Rolle, F. and Pennecchi, F. and Spazzini, P. and de Krom, I. and van der Veen, A.M.H.} } @Article { RoyleGFLRMPS2020, subid = {1510}, title = {The challenge of ionisation chamber dosimetry in ultra-short pulsed high dose-rate Very High Energy Electron beams}, journal = {Scientific Reports}, year = {2020}, month = {6}, volume = {10}, number = {1}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {dosimetry, VHEE, uhigh dose-per-pulse, ion recombination}, web_url = {https://www.nature.com/articles/s41598-020-65819-y}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-65819-y}, stag_bib_extends_levelofaccess = {NA}, author = {McManus, M. and Romano, F. and Lee, N.D. and Farabolini, W. and Gilardi, A. and Royle, G. and Palmans, H. and Subiel, A.} } @Article { SamantarayRB2020, subid = {1596}, title = {Single-phase and correlated-phase estimation with multiphoton annihilated squeezed vacuum states: An energy-balancing scenario}, journal = {Physical Review A}, year = {2020}, month = {6}, volume = {101}, number = {6}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {063810}, keywords = {quantum optics, quantum metrology, non-gaussian states}, web_url = {https://arxiv.org/abs/1809.10706}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.101.063810}, stag_bib_extends_levelofaccess = {NA}, author = {Samantaray, N. and Ruo-Berchera, I. and Berchera, I.} } @Article { SchmelterOSB2020, subid = {1627}, title = {Numerical simulation, validation, and analysis of two-phase slug flow in large horizontal pipes}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {6}, volume = {73}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {101722}, keywords = {Multiphase flow, slug flow, CFD, frequency analysis}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101722}, stag_bib_extends_levelofaccess = {NA}, author = {Schmelter, S. and Olbrich, M. and Schmeyer, E. and B{\"a}r, M.} } @Article { LucasCTDABLYSMPF2020, subid = {1611}, title = {Dynamic piezoelectric response of relaxor single crystal under electrically driven inter-ferroelectric phase transformations}, journal = {Applied Physics Letters}, year = {2020}, month = {6}, volume = {116}, number = {22}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {222903}, keywords = {-}, web_url = {https://livrepository.liverpool.ac.uk/3091334/}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0007820}, stag_bib_extends_levelofaccess = {NA}, author = {Lucas, C.A. and Cain, M.G. and Thompson, P.B.J. and Damjanovic, D. and Antonelli, L. and Blackmon, F. and Lofland, S.E. and Young, S. and Staruch, M. and Matis, B.R. and Patterson, E.A. and Finkel, P.} } @Article { deHuuTBSBMMNPR2020, subid = {1819}, title = {Design of gravimetric primary standards for field-testing of hydrogen refuelling stations}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {6}, volume = {73}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {101747}, keywords = {Hydrogen calibration, Hydrogen dispenser, Gravimetric method}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101747}, stag_bib_extends_levelofaccess = {NA}, author = {de Huu, M. and Tschannen, M. and Bissig, H. and Stadelmann, P. and B{\"u}ker, O. and MacDonald, M. and Maury, R. and Neuvonen, P.T. and Petter, H.T. and RASMUSSEN, K.} } @Proceedings { FanS2020, subid = {1937}, title = {Power Flow Simulation of DC Railway Power Supply Systems with Regenerative Braking}, journal = {2020 IEEE 20th Mediterranean Electrotechnical Conference ( MELECON)}, year = {2020}, month = {6}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {DC railway power supply system, power exchange, power flow simulation, regenerative braking, reversible substation}, web_url = {https://strathprints.strath.ac.uk/71741/1/Fan_Stewart_MELECON_2020_Power_flow_simulation_of_DC_railway_power.pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Palermo, Italy}, event_name = {2020 IEEE 20th Mediterranean Electrotechnical Conference (MELECON) - Palermo, Italy}, event_date = {16-06-2020 to 18-06-2020}, language = {30}, DOI = {10.1109/MELECON48756.2020.9140462}, stag_bib_extends_levelofaccess = {NA}, author = {Fan, F. and Stewart, B.G.} } @Article { HarrisLXWZYBWKCBSM2020, subid = {1578}, title = {N2O isotopocule measurements using laser spectroscopy: analyzer characterization and intercomparison}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {5}, day = {28}, volume = {13}, number = {-}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {2797–2831}, keywords = {nitrous oxide, isotopic composition, laser spectroscopy, spectral interference, matrix effect}, web_url = {https://www.dora.lib4ri.ch/empa/islandora/object/empa\%3A22186}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus Gesellschaft mbH}, address = {G{\"o}ttingen}, language = {30}, DOI = {10.5194/amt-13-2797-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Harris, Stephen J. and Liisberg, Jesper and Xia, Longlong and Wei, Jing and Zeyer, Kerstin and Yu, Longfei and Barthel, Matti and Wolf, Benjamin and Kelly, Bryce F. J. and Cend{\'o}n, Dioni I. and Blunier, Thomas and Six, Johan and Mohn, Joachim} } @Article { RuoBercheraMLASG2020, subid = {1576}, title = {Improving resolution-sensitivity trade off in sub-shot noise quantum imaging}, journal = {Applied Physics Letters}, year = {2020}, month = {5}, day = {26}, volume = {116}, number = {21}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {214001}, keywords = {Optical metrology, Quantum correlations, Signal processing, Quantum efficiency, Quantum limit, Charge coupled devices}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0009538}, stag_bib_extends_levelofaccess = {NA}, author = {Ruo-Berchera, I. and Meda, A. and Losero, E. and Avella, A. and Samantaray, N. and Genovese, M.} } @Article { WinterSZMI2020, subid = {1694}, title = {MRI‐Related Heating of Implants and Devices: A Review}, journal = {Journal of Magnetic Resonance Imaging}, year = {2020}, month = {5}, day = {26}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {magnetic resonance imaging, implant safety, MR safety, parallel transmission}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {1053-1807, 1522-2586}, DOI = {10.1002/jmri.27194}, stag_bib_extends_levelofaccess = {NA}, author = {Winter, L. and Seifert, F. and Zilberti, L. and Murbach, M. and Ittermann, B.} } @Article { WagnerSBKLSS2020, subid = {1968}, title = {PTB-XL, a large publicly available electrocardiography dataset}, journal = {Scientific Data}, year = {2020}, month = {5}, day = {25}, volume = {7}, number = {1}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, keywords = {electrocardiography, cardiovascular system, 12 lead electrocardiography, presence of co-occurring diseases}, misc2 = {EMPIR 2018: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2052-4463}, DOI = {10.1038/s41597-020-0495-6}, stag_bib_extends_levelofaccess = {NA}, author = {Wagner, P. and Strodthoff, N. and Bousseljot, R-D. and Kreiseler, D. and Lunze, F.I. and Samek, W. and Schaeffter, T.} } @Article { MorevaBTSTFPBPDOG2020, subid = {1710}, title = {Practical Applications of Quantum Sensing: A Simple Method to Enhance the Sensitivity of Nitrogen-Vacancy-Based Temperature Sensors}, journal = {Physical Review Applied}, year = {2020}, month = {5}, day = {22}, volume = {13}, number = {5}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {054057}, keywords = {color centers, diamond, quantum sensing}, web_url = {https://arxiv.org/abs/1912.10887}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.13.054057}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Bernardi, E. and Traina, P. and Sosso, A. and Tchernij, S.D. and Forneris, J. and Picollo, F. and Brida, G. and Pastuović, Ž. and Degiovanni, I. P. and Olivero, P. and Genovese, M.} } @Article { MorevaBTSTFPBPDOG20200, subid = {1710}, title = {Practical Applications of Quantum Sensing: A Simple Method to Enhance the Sensitivity of Nitrogen-Vacancy-Based Temperature Sensors}, journal = {Physical Review Applied}, year = {2020}, month = {5}, day = {22}, volume = {13}, number = {5}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {054057}, keywords = {color centers, diamond, quantum sensing}, web_url = {https://arxiv.org/abs/1912.10887}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.13.054057}, stag_bib_extends_levelofaccess = {NA}, author = {Moreva, E. and Bernardi, E. and Traina, P. and Sosso, A. and Tchernij, S.D. and Forneris, J. and Picollo, F. and Brida, G. and Pastuović, Ž. and Degiovanni, I. P. and Olivero, P. and Genovese, M.} } @Article { YamakawaBATBSNKYD2020, subid = {2039}, title = {Hg isotopic composition and total Hg mass fraction in NIES Certified Reference Material No. 28 Urban Aerosols}, journal = {Analytical and Bioanalytical Chemistry}, year = {2020}, month = {5}, day = {18}, volume = {412}, number = {19}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {4483-4493}, keywords = {Hg isotopic composition, Certified Reference Material, Urban Aerosols}, misc2 = {EMPIR 2016: Environment}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-020-02691-9}, stag_bib_extends_levelofaccess = {NA}, author = {Yamakawa, A. and B{\'e}rail, S. and Amouroux, D. and Tessier, E. and Barre, J. and Sano, T. and Nagano, K. and Kanwal, S. and Yoshinaga, J. and Donard, O.F.X.} } @Article { BilousBBSvTPLP2020, subid = {1541}, title = {Electronic Bridge Excitation in Highly Charged Th229 Ions}, journal = {Physical Review Letters}, year = {2020}, month = {5}, day = {12}, volume = {124}, number = {19}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {highly charged Ionshigh-intensity optical laserHighly Charged 229Th Ions}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.124.192502}, stag_bib_extends_levelofaccess = {NA}, author = {Bilous, P.V. and Bekker, H. and Berengut, J.C. and Seiferle, B. and von der Wense, L. and Thirolf, P.G. and Pfeifer, T. and L{\'o}pez-Urrutia, J.R.C. and P{\'a}lffy, A.} } @Article { CouplandPBDLTSL2020, subid = {1523}, title = {Lens aberration compensation in interference microscopy}, journal = {Optics and Lasers in Engineering}, year = {2020}, month = {5}, volume = {128}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {106015}, keywords = {Lens aberration interference microscopy}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, address = {Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands}, language = {30}, ISSN = {0143-8166}, DOI = {10.1016/j.optlaseng.2020.106015}, stag_bib_extends_levelofaccess = {NA}, author = {Su, R. and Thomas, M. and Liu, M. and Drs, J. and Bellouard, Y. and Pruss, C. and Coupland, J. and Leach, R.} } @Article { OsanBCDGSH2020, subid = {1569}, title = {Experimental evaluation of the in-the-field capabilities of total-reflection X-ray fluorescence analysis to trace fine and ultrafine aerosol particles in populated areas}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2020}, month = {5}, volume = {167}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {105852}, keywords = {Atmospheric aerosols, Ultrafine particles, Cascade impactor, TXRF, Elemental size distribution}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, address = {Elsevier BV Radarweg 29 Amsterdam NX 1043 Netherlands}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2020.105852}, stag_bib_extends_levelofaccess = {NA}, author = {Os{\'a}n, J{\'a}nos and B{\"o}rcs{\"o}k, Endre and Cz{\"o}mp{\"o}ly, Ott{\'o} and Dian, Csenge and Groma, Veronika and Stabile, Luca and Hensey, Garry} } @Article { KasebergSKB2020, subid = {1595}, title = {Inverted plasmonic lens design for nanometrology applications}, journal = {Measurement Science and Technology}, year = {2020}, month = {5}, volume = {31}, number = {7}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {074013}, keywords = {Plasmonics, Metrology, Plasmonic lens, Microscopy, Nanostructures, Finite Element Method}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab7e6b}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}seberg, T. and Siefke, T. and Kroker, S. and Bodermann, B.} } @Proceedings { SilvaPA2020, subid = {1612}, title = {Uncertainty Analysis in the Measurement of Switching Losses in GaN FETs Power Converters}, journal = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2020}, month = {5}, volume = {2020}, number = {-}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {1-6}, keywords = {-}, web_url = {https://ieeexplore.ieee.org/document/9129552}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Dubrovnik, Croatia}, event_name = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {25-05-2020 to 28-05-2020}, language = {30}, ISBN = {Electronic ISBN: 978-1-7281-44}, ISSN = {Electronic ISSN: 2642-2077}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/2117/328678}, author = {Silva, F. and Pous, M. and Azpurua, M.A.} } @Article { KatiFS2020, subid = {1655}, title = {Investigation of Temperature-Induced Errors in XCT Metrology}, journal = {International Journal of Automation Technology}, year = {2020}, month = {5}, volume = {14}, number = {3}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {484-490}, keywords = {length metrology, computed tomography, traceability, temperature measurement}, web_url = {https://www.fujipress.jp/ijat/au/ijate001400030484/}, misc2 = {EMPIR 2017: Industry}, publisher = {Fuji Technology Press Ltd.}, language = {30}, ISSN = {1883-8022, 1881-7629}, DOI = {10.20965/ijat.2020.p0484}, stag_bib_extends_levelofaccess = {NA}, author = {Katić, M. and Ferdelji, N. and Sestan, D.} } @Proceedings { MariscottiGFS2020, subid = {1944}, title = {Filter Transients onboard DC Rolling Stock and Exploitation for the Estimate of the Line Impedance}, journal = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2020}, month = {5}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Harmonics, Power Quality, Power supply transient, Railways, Rolling stock}, web_url = {https://zenodo.org/record/4569878}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Dubrovnik, Croatia}, event_name = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {25-05-2020 to 28-05-2020}, language = {30}, DOI = {10.1109/I2MTC43012.2020.9128903}, stag_bib_extends_levelofaccess = {NA}, author = {Mariscotti, A. and Giordano, D. and Femine, A.D. and Signorino, D.} } @Article { SchumacherSG2020, subid = {2122}, title = {Inhomogeneous field calibration of a magneto-optical indicator film device}, journal = {Measurement Science and Technology}, year = {2020}, month = {5}, volume = {31}, number = {7}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {075009}, keywords = {magneto-optic indicator film (MOIF),microscopic calibration,quantitative,traceable,Faraday effect,magnetic microstructures,stray field measurement}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab816e}, stag_bib_extends_levelofaccess = {NA}, author = {Schumacher, H.W. and Sievers, S. and Gerken, M.} } @Article { SilanderFZZA2020, subid = {1679}, title = {Invar-based refractometer for pressure assessments}, journal = {Optics Letters}, year = {2020}, month = {4}, day = {30}, volume = {45}, number = {9}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {2652}, keywords = {Gas Modulation Refractometry (GAMOR), Fabry-Perot, Invar}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.391708}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Article { SundarapandianL2020, subid = {1797}, title = {On using converging shock waves for pressure amplification in shock tubes}, journal = {Metrologia}, year = {2020}, month = {4}, day = {22}, volume = {57}, number = {3}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {035008}, keywords = {dynamic pressure amplification,converging shock wave,shock tube,dynamic pressure calibration}, web_url = {https://iopscience.iop.org/article/10.1088/1681-7575/ab7f99/pdf}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/1681-7575/ab7f99}, stag_bib_extends_levelofaccess = {NA}, author = {Sundarapandian, S. and Liverts, M.} } @Miscellaneous { SilvaALSCRMBS_2, subid = {1486}, title = {EMUE-D6-4-Mobile Optical Measurement}, year = {2020}, month = {4}, day = {18}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Calibration; Mobile optical measurement system}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3756658}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, M.A. and Almeida, M.C. and Loureiro, D. and Sousa, J.A. and Cox, M.G. and Ribeiro, A.S. and Martins, L.L. and Brito, R. and Soares, A.C.} } @Article { ObsilSiiLP2020, subid = {1832}, title = {Optical frequency analysis on dark state of a single trapped ion}, journal = {Optics Express}, year = {2020}, month = {4}, day = {16}, volume = {28}, number = {9}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {13091}, keywords = {Optical frequency analysis, dark state of a single trapped ion}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.389411}, stag_bib_extends_levelofaccess = {NA}, author = {Obšil, P. and Slodička, L. and Č{\'i}p, O. and Č{\'i}žek, M. and Lešund{\'a}k, A. and Pham, T.M.} } @Miscellaneous { SilvaALSCRMBS, subid = {1484}, title = {EMUE-D1-3-Single Burning Item}, year = {2020}, month = {4}, day = {1}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Measurement model; SBI – Single Burning Item; Reaction to fire test}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3736602}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, M.A. and Almeida, M.C. and Loureiro, D. and Sousa, J.A. and Cox, M.G. and Ribeiro, A.S. and Martins, L.L. and Brito, R. and Soares, A.C.} } @Article { AlveseSousaTNGBFPFBO2020, subid = {1468}, title = {New EMPIR project – Metrology for Drug Delivery}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {4}, volume = {72}, number = {Special Is}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {101716}, keywords = {Microflow, drug delivery, calibration, health}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101716}, stag_bib_extends_levelofaccess = {NA}, author = {Batista, E. and Furtado, A. and Pereira, J. and Ferreira, M. and Bissig, H. and Graham, E. and Niemann, A. and Timmerman, A. and Sousa, J.A. and Ogheard, F.} } @Article { PimonSKGMM2020, subid = {1500}, title = {DFT calculation of 229thorium-doped magnesium fluoride for nuclear laser spectroscopy}, journal = {Journal of Physics: Condensed Matter}, year = {2020}, month = {4}, volume = {32}, number = {25}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {255503}, keywords = {DFT, thorium,MgF2, nuclear clock}, web_url = {https://iopscience.iop.org/article/10.1088/1361-648X/ab7c90/pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {0953-8984, 1361-648X}, DOI = {10.1088/1361-648X/ab7c90}, stag_bib_extends_levelofaccess = {NA}, author = {Pimon, M. and Gugler, J. and Mohn, P. and Kazakov, G.A. and Mauser, N. and Schumm, T.} } @Article { ChretienLSS2020, subid = {1756}, title = {Efficient Hyper-Parameter Selection in Total Variation-Penalised XCT Reconstruction Using Freund and Shapire’s Hedge Approach}, journal = {Mathematics}, year = {2020}, month = {4}, volume = {8}, number = {4}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {493}, keywords = {hyper-parameter selection, image reconstruction, limited data reconstruction, total variation regularisation, cone-beam computed tomography}, web_url = {https://www.mdpi.com/2227-7390/8/4/493}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-7390}, DOI = {10.3390/math8040493}, stag_bib_extends_levelofaccess = {NA}, author = {Chretien, S. and Lohvithee, M. and Sun, W. and Soleimani, M.} } @Article { SliwczynskiKIESPB2020, subid = {1851}, title = {Fiber-Based UTC Dissemination Supporting 5G Telecommunications Networks}, journal = {IEEE Communications Magazine}, year = {2020}, month = {4}, volume = {58}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {67-73}, keywords = {time transfer, frequency transfer, fiber optic, 5G, network synchronization, synchronization supervision}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.5281/zenodo.3903158}, stag_bib_extends_levelofaccess = {NA}, author = {Śliwczyński, L. and Krehlik, P. and Imlau, H. and Ender, H. and Schnatz, H. and Piester, D. and Bauch, A.} } @Miscellaneous { RibeiroCSM, subid = {1485}, title = {EMUE-D4-5-Thermal Comfort}, year = {2020}, month = {3}, day = {30}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Thermal comfort; Implicit model formulation; Monte Carlo model}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3733403}, stag_bib_extends_levelofaccess = {NA}, author = {Ribeiro, A.S. and Cox, M.G. and Sousa, J.A. and Martins, L.L.} } @Article { OjalaBTPZTSGP2020, subid = {1496}, title = {Calculated beam quality correction factors for ionization chambers in MV photon beams}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {3}, day = {26}, volume = {65}, number = {7}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {075003}, keywords = {kQ factors, radiotherapy dosimetry, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab7107}, stag_bib_extends_levelofaccess = {NA}, author = {Tikkanen, J. and Zink, K. and Pimpinella, M. and Teles, P. and Borbinha, J. and Ojala, J. and Siiskonen, T. and Gom{\`a}, C. and Pinto, M.} } @Miscellaneous { SousaPvCFDBKE, subid = {1467}, title = {EMUE-D1-2-Bayesian Mass Calibration}, year = {2020}, month = {3}, day = {25}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Bayesian statistics, measurement uncertainty, prior knowledge, calibration}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3726908}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Pellegrino, O. and van der Veen, A.M.H. and Cox, M.G. and Fischer, N. and Demeyer, S. and Bošnjakovic, A. and Karahodžić, V. and Elster, C.} } @Article { PeregoDS2020, subid = {1700}, title = {Electro-Optical Ion Trap for Experiments with Atom-Ion Quantum Hybrid Systems}, journal = {Applied Sciences}, year = {2020}, month = {3}, day = {25}, volume = {10}, number = {7}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {2222}, keywords = {Paul traps; ion optical trapping; atom-ion interactions; atom-ion mixtures}, web_url = {https://www.mdpi.com/2076-3417/10/7/2222}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app10072222}, stag_bib_extends_levelofaccess = {NA}, author = {Perego, E. and Duca, L. and Sias, C.} } @Article { GaudinoCASCPC2020, subid = {1537}, title = {Robust optical frequency dissemination with a dual-polarization coherent receiver}, journal = {Optics Express}, year = {2020}, month = {3}, day = {10}, volume = {28}, number = {6}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {8494}, keywords = {Frequency dissemination, optical fiber, polarization}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.378602}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Savio, P. and Abrate, S. and Curri, V. and Gaudino, R. and Pizzocaro, M. and Calonico, D.} } @Article { SalmiCVWVYKHS2020, subid = {1354}, title = {AlOx surface passivation of black silicon by spatial ALD: Stability under light soaking and damp heat exposure}, journal = {Journal of Vacuum Science \& Technology A}, year = {2020}, month = {3}, volume = {38}, number = {2}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {022401}, keywords = {Spatial Atomic Layer Deposition, aluminum oxide, surface passivation, light soaking, damp heat}, misc2 = {EMPIR 2016: Energy}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5133896}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, I.T.S. and Koutsourakis, G. and Virtanen, S. and Yli-Koski, M. and Wood, S. and V{\"a}h{\"a}nissi, V. and Salmi, E. and Castro, F.A. and Savin, H.} } @Article { LucasTECSZ2020, subid = {1449}, title = {Magnetic and multiferroic properties of dilute Fe-doped BaTiO3 crystals}, journal = {APL Materials}, year = {2020}, month = {3}, volume = {8}, number = {3}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {031109}, keywords = {multiferroic, X-ray absorption spectroscopy, magnetic measurements}, web_url = {https://aip.scitation.org/doi/10.1063/5.0002863}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, language = {30}, ISSN = {2166-532X}, DOI = {10.1063/5.0002863}, stag_bib_extends_levelofaccess = {NA}, author = {Staruch, M. and ElBidweihy, H. and Cain, M.G. and Thompson, P. and Lucas, C.A. and Finkel, P.} } @Article { RabagoFCFFQPCQS2020, subid = {2029}, title = {Intercomparison of Indoor Radon Measurements Under Field Conditions In the Framework of MetroRADON European Project}, journal = {International Journal of Environmental Research and Public Health}, year = {2020}, month = {3}, volume = {17}, number = {5}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {1780}, keywords = {radon, proficiency test, quality assurance, metrology, interlaboratory comparison}, web_url = {https://www.mdpi.com/1660-4601/17/5/1780}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1660-4601}, DOI = {10.3390/ijerph17051780}, stag_bib_extends_levelofaccess = {NA}, author = {Rabago, D. and Fuente, I. and Celaya, S. and Fernandez , A. and Fernandez, E. and Quindos, J. and Pol, R. and Cinelli, G. and Quindos, L. and Sainz, C.} } @Article { JonesPS2020, subid = {2731}, title = {Probing new physics using Rydberg states of atomic hydrogen}, journal = {Physical Review Research}, year = {2020}, month = {3}, volume = {2}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Rydberg states, Standard Model, new physics beyond SM}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/PhysRevResearch.2.013244}, stag_bib_extends_levelofaccess = {NA}, author = {Jones, M.P.A. and Potvliege, R.M. and Spannowsky, M.} } @Article { TangSLKNBMSCKMKBNMKKSSDPvM2020, subid = {1473}, title = {Clinical quantitative cardiac imaging for the assessment of myocardial ischaemia}, journal = {Nature Reviews Cardiology}, year = {2020}, month = {2}, day = {24}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, keywords = {cardiac imaging, myocardial ischaemia}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1759-5002, 1759-5010}, DOI = {10.1038/s41569-020-0341-8}, stag_bib_extends_levelofaccess = {NA}, author = {Dewey, M. and Siebes, M. and Kachelrie{\ss}, M. and Kofoed, K.F. and Maurovich-Horvat, P. and Nikolaou, K. and Bai, W. and Kofler, A. and Manka, R. and Kozerke, S. and Chiribiri, A. and Schaeffter, T. and Michallek, F. and Bengel, F. and Nekolla, S. and Knaapen, P. and Lubberink, M. and Senior, R. and Tang, M-X. and Piek, J.J. and van de Hoef, T. and Martens, J. and Schreiber, L.} } @Article { JeziorskiLSP2020, subid = {1437}, title = {QED calculation of the dipole polarizability of helium atom}, journal = {Physical Review A}, year = {2020}, month = {2}, day = {18}, volume = {101}, number = {2}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {022505}, keywords = {Electron correlation calculations for atoms \& ionsElectronic structure of atoms \& moleculesFine \& hyperfine structureRelativistic \& quantum electrodynamic effects in atoms, molecules,\& ions}, web_url = {https://arxiv.org/abs/1912.12242}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.101.022505}, stag_bib_extends_levelofaccess = {NA}, author = {Puchalski, M. and Szalewicz, K. and Lesiuk, M. and Jeziorski, B.} } @Techreport { WeberHSRDBMHKMENHSW2020, subid = {1431}, title = {Document specifying rules for the secure use of DCC covering legal aspects of metrology}, journal = {Zenodo}, year = {2020}, month = {2}, day = {12}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {digital calibration certificate (DCC) cryptography minimum requirements data communication IoT-communication IoT-networking SmartCom}, web_url = {https://zenodo.org/record/3664211\#.XlO2QTFKhaR}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.3664211}, stag_bib_extends_levelofaccess = {NA}, author = {Weber, H. and Hutzschenreuter, D. and Smith, I. and Rhodes, S. and Dawkins, J. and Brown, C. and Maennel, O. and Hovhannisyan, K. and Kuosmanen, P. and Mustap{\"a}{\"a}, T. and Elo, T. and Nikander, P. and Heeren, W. and Sch{\"o}nhals, S. and Wiedenh{\"o}fer, Th.} } @Article { DryakS2020, subid = {1549}, title = {Measurement of the branching ratio related to the internal pair production of Y-90}, journal = {Applied Radiation and Isotopes}, year = {2020}, month = {2}, volume = {156}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {108942}, keywords = {Measurement of the branching ratio related to the internal pair production of Y-90}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2019.108942}, stag_bib_extends_levelofaccess = {NA}, author = {Dry{\'a}k, P. and Solc, J.} } @Article { CaraFFDTGSH2020, subid = {1568}, title = {Directed Self-Assembly of Polystyrene Nanospheres by Direct Laser-Writing Lithography}, journal = {Nanomaterials}, year = {2020}, month = {2}, volume = {10}, number = {2}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {280}, keywords = {directed self-assembly; nanospheres lithography; colloidal nanospheres; directlaser-writing}, web_url = {https://www.researchgate.net/publication/339105418_Directed_Self-Assembly_of_Polystyrene_Nanospheres_by_Direct_Laser-Writing_Lithography/link/5e3d9bbd458515072d88c1ab/download}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, address = {Postfach Basel CH-4005 Switzerland}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano10020280}, stag_bib_extends_levelofaccess = {NA}, author = {Cara, Eleonora and Ferrarese Lupi, Federico and Fretto, Matteo and De Leo, Natascia and Tortello, Mauro and Gonnelli, Renato and Sparnacci, Katia and Hensey, Garry} } @Manual { PearceABEdIKS2020, subid = {1766}, title = {Guidelines on the Calibration of Thermocouples: EURAMET Calibration Guide No. 8}, year = {2020}, month = {2}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, keywords = {Thermocouples, calibration, thermoelectric, thermometry, ITS-90, EMPRESS 2}, web_url = {https://www.euramet.org/publications-media-centre/calibration-guidelines/}, misc2 = {EMPIR 2017: Industry}, publisher = {EURAMET}, address = {Braunschweig}, language = {30}, ISBN = {ISBN 978-3-942992-57-2}, ISSN = {N/A}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISBN 978-3-942992-57-2}, author = {Pearce, J. and Arifovic, N. and Bojkovski, J. and Edler, F. and de Groot, M. and Izquierdo, G.G. and Kalemci, M. and Strnad, R.} } @Proceedings { IurlaroSMIBMCFMIPD2020, subid = {2019}, title = {DOSE RATE DATA OF MEASURING INSTRUMENTS USED IN NONGOVERNMENTAL NETWORKS (MINNs) IN THE FRAMEWORK OF PREPAREDNESS EMPIR PROJECT}, journal = {EUROSAFE}, year = {2020}, month = {2}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, keywords = {dose rate, measuring instruments, non-governmental networks, preparedness}, web_url = {http://www.etson.eu/sites/default/files/eurosafes/2019/EUROSAFE2019_Proceedings.pdf}, misc2 = {EMPIR 2016: Environment}, event_place = {Cologne}, event_name = {EUROSAFE 2019}, event_date = {04-11-2019 to 05-11-2019}, language = {30}, ISBN = {978-3-947685-51-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {978-3-947685-51-6}, author = {Iurlaro, G. and Sperandio, L. and Morosh, V. and ŽIivanovic, M. and Bell, S. and Mariotti, F. and Campani, L. and Ferrari, P. and Morelli, B. and Ioannidis, S. and Pantelić, G. and De Cort, M.} } @Proceedings { ZaniniSSC2020, subid = {2609}, title = {Uncertainty of CT dimensional measurements performed on metal additively manufactured lattice structures}, journal = {Proceeding - 10th Conference on Industrial Computed Tomography, Wels, Austria (iCT 2020), www.ict-conference.com/2020}, year = {2020}, month = {2}, number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry}, keywords = {X-ray computed tomography, additive manufacturing, lattice structures, dimensional metrology, uncertainty}, web_url = {https://www.ndt.net/search/docs.php3?id=25084}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Wels, Austria}, event_name = {10th Conference on Industrial Computed Tomography 2020}, event_date = {04-02-2020 to 07-02-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4746036}, author = {Zanini, F. and Sorgato, M. and Savio, E. and Carmignato, S.} } @Article { WiekhorstLMSJB2020, subid = {1504}, title = {Quantitative 2D Magnetorelaxometry Imaging of Magnetic Nanoparticles Using Optically Pumped Magnetometers}, journal = {Sensors}, year = {2020}, month = {1}, day = {29}, volume = {20}, number = {3}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {753}, keywords = {magnetic nanoparticles; optically pumped magnetometers; magnetorelaxometry imaging}, web_url = {https://www.mdpi.com/1424-8220/20/3/753/htm}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20030753}, stag_bib_extends_levelofaccess = {NA}, author = {Jaufenthaler, A. and Schier, P. and Middelmann, T. and Liebl, M. and Wiekhorst, F. and Baumgarten, D.} } @Article { SchwarzSSBKLMCS2020, subid = {1540}, title = {Coherent laser spectroscopy of highly charged ions using quantum logic}, journal = {Nature}, year = {2020}, month = {1}, day = {29}, volume = {578}, number = {7793}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {60-65}, keywords = {spectroscopy highly charged ions atomic clocks3}, web_url = {https://arxiv.org/abs/2010.15984}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0028-0836, 1476-4687}, DOI = {10.1038/s41586-020-1959-8}, stag_bib_extends_levelofaccess = {NA}, author = {Schwarz, M. and Schm{\"o}ger, L. and Spie{\ss}, L.J. and Benkler, E. and King, S.A. and Leopold, T. and Micke, P. and Crespo L{\'o}pez-Urrutia, J.R. and Schmidt, P.O.} } @Article { BurnellLRvHBNSRMHBFZM2020, subid = {1425}, title = {Diameter-independent skyrmion Hall angle observed in chiral magnetic multilayers}, journal = {Nature Communications}, year = {2020}, month = {1}, day = {22}, volume = {11}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {skyrmion motion, spin-orbit torque}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-14232-9}, stag_bib_extends_levelofaccess = {NA}, author = {Zeissler, K. and Finizio, S. and Barton, C. and Huxtable, A.J. and Massey, J. and Raabe, J. and Sadovnikov, A.V. and Nikitov, S.A. and Brearton, R. and Hesjedal, T. and van der Laan, G. and Rosamond, M.C. and Linfield, E.H. and Burnell, G. and Marrows, C.H.} } @Article { SetionoBNXFKUDFSWP2020, subid = {2362}, title = {In-Plane and Out-of-Plane MEMS Piezoresistive Cantilever Sensors for Nanoparticle Mass Detection}, journal = {Sensors}, year = {2020}, month = {1}, day = {22}, volume = {20}, number = {3}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {618}, keywords = {MEMS piezoresistive cantilever sensors, dynamic mode, carbon nanoparticle, particle mass measurement}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20030618}, stag_bib_extends_levelofaccess = {NA}, author = {Setiono, A. and Bertke, M. and Nyang’au, W.O. and Xu, J. and Fahrbach, M. and Kirsch, I. and Uhde, E. and Deutschinger, A. and Fantner, E.J. and Schwalb, C. H. and Wasisto, H.S. and Peiner, E.} } @Article { SarjonenRBSB2020, subid = {1391}, title = {A Versatile Capacitive Sensing Platform for the Assessment of the Composition in Gas Mixtures}, journal = {Micromachines}, year = {2020}, month = {1}, day = {21}, volume = {11}, number = {2}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {116}, keywords = {energy  transition;  gas  composition  sensor;  capacitive  sensor  array;  interdigitated  electrodes; responsive coatings; tunable filter infrared spectrometer; LNG; biogas}, tags = {EnG}, web_url = {https://www.mdpi.com/2072-666X/11/2/116/pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, address = {Postfach Basel CH-4005 Switzerland}, language = {30}, ISSN = {2072-666X}, DOI = {10.3390/mi11020116}, stag_bib_extends_levelofaccess = {NA}, author = {Sweelssen, J. and Blokland, H. and Rajamaki, T. and Sarjonen, R. and Boersma, A.} } @Article { PierreRS2020, subid = {1246}, title = {Experimental facility for the production of reference atmosphere of radioactive gases (Rn, Xe, Kr, and H isotopes)}, journal = {Applied Radiation and Isotopes}, year = {2020}, month = {1}, volume = {155}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {108934}, keywords = {Calibration, Radioactive Gas, Metrology, Radon, Xenon, Tritium, Krypton}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2019.108934}, stag_bib_extends_levelofaccess = {NA}, author = {Sabot, B. and Rodrigues, M. and Pierre, S.} } @Article { SantosCMGPAMI2020, subid = {1338}, title = {Overview and calculation of X‐ray K‐shell transition yields for comprehensive data libraries}, journal = {X-Ray Spectrometry}, year = {2020}, month = {1}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, keywords = {X-ray K-shell transition yields}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {0049-8246, 1097-4539}, DOI = {10.1002/xrs.3123}, stag_bib_extends_levelofaccess = {NA}, author = {Martins, L. and Amaro, P. and Pessanha, S. and Guerra, M. and Machado, J. and Carvalho, M. L. and Santos, J. P. and Indelicato, P.} } @Article { MatousekSPFLD2020, subid = {1375}, title = {Influence of mounting on the optical surface figure in optical reference surfaces}, journal = {Journal of Instrumentation}, year = {2020}, month = {1}, volume = {15}, number = {01}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {P01005}, keywords = {Optics; Overall mechanics design (support structures and materials, vibration analysisetc); Manufacturing; Interferometry}, web_url = {https://iopscience.iop.org/article/10.1088/1748-0221/15/01/P01005\#back-to-top-target}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/15/01/P01005}, stag_bib_extends_levelofaccess = {NA}, author = {L{\'e}dl, V. and Fortmeier, I. and Psota, P. and Schulz, M. and Matoušek, O. and Doleček, R.} } @Article { FortmeierSLMSHBBKSE2020, subid = {1374}, title = {Round robin comparison study on the form measurement of optical freeform surfaces}, journal = {Journal of the European Optical Society-Rapid Publications}, year = {2020}, month = {1}, volume = {16}, number = {1}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, keywords = {Freeform optical surfaces, Metrology, Interlaboratory comparison}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1990-2573}, DOI = {10.1186/s41476-019-0124-1}, stag_bib_extends_levelofaccess = {NA}, author = {Fortmeier, I. and Schachtschneider, R. and L{\'e}dl, V. and Matoušek, O. and Siepmann, J. and Harsch, A. and Beisswanger, R. and Bitou, Y. and Kondo, Y. and Schulz, M. and Elster, C.} } @Article { MinkMFMZSBSMNAAL2020, subid = {1399}, title = {Experimental Low-Latency Device-Independent Quantum Randomness}, journal = {Physical Review Letters}, year = {2020}, month = {1}, volume = {124}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {quantum randomness}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.124.010505}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1812.07786}, author = {Zhang, Y. and Shalm, L.K. and Bienfang, J.C. and Stevens, M.J. and Mazurek, M.D. and Nam, S.W. and Abell{\'a}n, C. and Amaya, W. and Mitchell, M.W. and Fu, H. and Miller, C.A. and Mink, A. and Knill, E.} } @Article { ChristensenJHTS2020, subid = {1498}, title = {Lasing on a narrow transition in a cold thermal strontium ensemble}, journal = {Physical Review A}, year = {2020}, month = {1}, volume = {101}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {superradiant laser, optical clock, ultra narrow laser}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.101.013819}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"a}ffer, S.A. and Tang, M. and Henriksen, M.R. and J{\o}rgensen, A.A. and Christensen, B.T.R.} } @Article { D039ArienzoPDCFMIUS2020, subid = {1548}, title = {Absorbed dose measurements from a 90Y radionuclide liquid solution using LiF:Mg,Cu,P thermoluminescent dosimeters}, journal = {Physica Medica}, year = {2020}, month = {1}, volume = {69}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {127-133}, keywords = {Absorbed dose measurements from a 90Y}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2019.11.010}, stag_bib_extends_levelofaccess = {NA}, author = {D'Arienzo, M. and Pimpinella, M. and De Coste, V. and Capogni, M. and Ferrari, P. and Mariotti, F. and Iaccarino, G. and Ungania, S. and Strigari, L.} } @Article { CavuotoLGS2020, subid = {1591}, title = {Speed of sound measurements in liquid methane (CH4) at cryogenic temperatures between (130 and 162) K and at pressures up to 10 MPa}, journal = {The Journal of Chemical Thermodynamics}, year = {2020}, month = {1}, volume = {142}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {106007}, keywords = {Speed of soundMethaneLngNatural gasCryogenic conditions}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-9614}, DOI = {10.1016/j.jct.2019.106007}, stag_bib_extends_levelofaccess = {NA}, author = {Cavuoto, G. and Lago, S. and Giuliano Albo, P.A. and Serazio, D.} } @Article { VilloneVMDSFD2020, subid = {1418}, title = {Mutual Inductance Behavioral Modeling for Wireless Power Transfer System Coils}, journal = {IEEE Transactions on Industrial Electronics}, year = {2020}, volume = {ea}, number = {ea}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-11}, keywords = {This paper derives low-complexity behavioral analytical models of the mutual inductance between the coupling coils of Wireless Power Transfer Systems (WPTSs), as functions of their reciprocal position. These models are extremely useful in the characterization and design optimization of WPTSs. Multi-Objective Genetic Programming (MOGP) algorithm is adopted to generate models ensuring an optimal trade-off between accuracy and complexity. The training and validation data sets needed for the generation of the models are here obtained by performing numerical full-3D electromagnetic simulations. The resulting behavioral models allow accurate and fast evaluation of the WPTS coils mutual inductance, over a wide range of misalignment conditions, enabling easier system analysis and optimization.}, web_url = {https://ieeexplore.ieee.org/document/8994192}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0278-0046, 1557-9948}, DOI = {10.1109/TIE.2019.2962432}, stag_bib_extends_levelofaccess = {NA}, author = {Di Capua, G. and Femia, N. and Stoyka, K. and Di Mambro, G. and Maffucci, A. and Ventre, S. and Villone, F.} } @Article { TummonLKCCCAZSV2020, subid = {1472}, title = {Real-time pollen monitoring using digital holography}, journal = {Atmospheric Measurement Techniques}, year = {2020}, volume = {13}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {1539–1550}, keywords = {pollen monitoring, digital holography,}, web_url = {https://www.atmos-meas-tech.net/13/1539/2020/}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus Publications}, language = {30}, DOI = {10.5194/amt-13-1539-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Sauvageat , E. and Zeder, Y. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Konzelmann, T. and Lieberherr, G. and Tummon, F. and Vasilatou, K.} } @Article { FlierlRBMS2020, subid = {1598}, title = {Absolute isotope ratios of carbon dioxide – a feasibility study}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, keywords = {Gas Metrology, SI traceability, Carbon Dioxide refrence maerial}, web_url = {https://pubs.rsc.org/is/content/articlelanding/2020/ja/d0ja00318b\#!divAbstract}, misc2 = {EMPIR 2016: Environment}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/d0ja00318b}, stag_bib_extends_levelofaccess = {NA}, author = {Flierl, L. and Rienitz, O. and Brewer, P.J. and Meijer, H.A.J. and Steur, F.M.} } @Proceedings { ShlomaSKNPP2020, subid = {1528}, title = {Analysis of accuracy requirements to the meteorological sensors used to compensate for the influence of the Earth’s atmosphere in high precision length measurement}, journal = {SMSI Sensor and Measurement Science International}, year = {2020}, volume = {SMSI 2020}, number = {2020}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {279 - 280}, keywords = {length measurement, meteorological sensors, refractive index, gradient method, GeoMetre}, web_url = {https://www.ama-science.org/proceedings/details/3759}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {AMA Association for Sensors and Measurement}, address = {Berlin}, event_place = {Nuremberg, Germany}, event_name = {SMSI 2020}, event_date = {22-06-2020 to 25-06-2020}, language = {30}, ISBN = {978-3-9819376-2-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {dx.doi.org/10.5162/SMSI2020/D3.3}, author = {Shloma, A. and Skliarov, V. and Kupko, V. and Neyezhmakov, P. and Panasenko, T. and Prokopov, A.} } @Article { AkoWHS2020, subid = {1673}, title = {Communication and validation of smart data in IoT-networks}, journal = {Advances in Production Engineering \& Management}, year = {2020}, volume = {15}, number = {Number 1}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, pages = {pp 107–117}, keywords = {Metrology; Measurement metadata; Information and communication technology (ICT); Smart Data; Data communication; IoT-communication; IoT-networking; Digital calibration certificate}, web_url = {http://apem-journal.org/Archives/2020/Abstract-APEM15-1_107-117.html}, misc2 = {EMPIR 2017: Industry}, publisher = {Advances in Production Engineering \& Management}, language = {30}, DOI = {10.14743/apem2020.1.353}, stag_bib_extends_levelofaccess = {NA}, author = {Acko, B. and Weber, H. and Hutzschenreuter, D. and Smith, I.} } @Article { WodarczykKl2020, subid = {1691}, title = {A MAINTENANCE-FREE SOLUTION FOR OPTICAL FREQUENCY TRANSFER}, journal = {Metrology and Measurement Systems}, year = {2020}, volume = {27}, number = {3}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {441–450}, keywords = {fiber-optics, optical frequency transfer, tracking filter, automatic startup}, web_url = {https://zenodo.org/record/4110659\#.X7zfu2j7Q2x}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Polish Academy of Sciences Committee on Metrology and Scientific Instrumentation}, language = {30}, ISSN = {ISSN 0860-8229}, DOI = {10.24425/mms.2020.134586}, stag_bib_extends_levelofaccess = {NA}, author = {Włodarczyk, P. and Krehlik, P. and Śliwczyński, Ł.} } @Article { LinYCWGCLXSHCFCTYC2020, subid = {1760}, title = {Perpendicular Magnetic Anisotropy and Dzyaloshinskii-Moriya Interaction at an Oxide/Ferromagnetic Metal Interface}, journal = {Physical Review Letters}, year = {2020}, volume = {124}, number = {21}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {217202}, keywords = {DMI, spin waves}, web_url = {https://arxiv.org/abs/2006.14268}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.124.217202}, stag_bib_extends_levelofaccess = {NA}, author = {Lin , W. and Yang, B. and Chen, A.P. and Wu, X. and Guo, R. and Chen, S. and Liu, L. and Xie, Q. and Shu, X. and Hui, Y. and Chow, G.M. and Feng, Y. and Carlotti, G. and Tacchi, S. and Yang, H. and Chen, J.} } @Article { CaraMSGRCDHKBMZCLBF2020, subid = {1829}, title = {Towards a traceable enhancement factor in surface-enhanced Raman spectroscopy}, journal = {Journal of Materials Chemistry C}, year = {2020}, volume = {8}, number = {46}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {16513-16519}, keywords = {Raman spectroscopy (SERS)}, misc2 = {EMPIR 2016: Environment}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2050-7526, 2050-7534}, DOI = {10.1039/D0TC04364H}, stag_bib_extends_levelofaccess = {NA}, author = {Cara, E. and Mandrile, L. and Sacco, A. and Giovannozzi, A.M. and Rossi, A.M. and Celegato, F. and De Leo, N. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Marchi, D. and Zoccante, A. and Cossi, M. and Laus, M. and Boarino, L. and Ferrarese Lupi, F.} } @Proceedings { NedialkovSA2020, subid = {1890}, title = {MetForTC Traceable Measurement Capabilities for Monitoring Thermocouple Performance}, journal = {Metrology and Metrology Assurance 2020 - Proceedings}, year = {2020}, volume = {30th Inter}, number = {130 Issues}, number2 = {18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance}, pages = {15-18}, keywords = {metrology, thermocouple, traceable measurement, MetForTC}, web_url = {http://metrology-bg.org/fulltextpapers/Proceedings_MMO_2020.pdf}, misc2 = {EMPIR 2018: Research Potential}, publisher = {Sasho Nedialkov; Snezhana Spasova; Kostadin Aldev}, event_place = {Sozopol, Bulgaria}, event_name = {Metrology and Metrology Assurance 2020}, event_date = {07-09-2020 to 11-09-2020}, language = {30}, ISSN = {ISSN 2603-3194}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISSN: 2603-3194}, author = {Nedialkov, S. and Spasova, S. and Aldev, K.} } @Proceedings { GiordanoSLLDC2020, subid = {1963}, title = {Power quality in DC railway system: A facility to characterize the on-board detection systems}, journal = {IMEKO Proceedings}, year = {2020}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {DC power quality, DC railway system, electric arcs}, web_url = {https://www.imeko.org/publications/tc4-2020/IMEKO-TC4-2020-22.pdf}, misc2 = {EMPIR 2016: Energy}, event_place = {Palermo, Italy}, event_name = {International Measurement Confederation 2020}, event_date = {14-09-2020 to 16-09-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4589149}, author = {Giordano, D. and Signorino, D. and Landi, C. and Luiso, M. and Delle Femine, A. and Crotti, G.} } @Article { StrodthoffWSS2020, subid = {1967}, title = {Deep Learning for ECG Analysis: Benchmarks and Insights from PTB-XL}, journal = {IEEE Journal of Biomedical and Health Informatics}, year = {2020}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {1-1}, keywords = {Electrocardiography, Task analysis, Benchmark testing, Prediction algorithms, Time series analysis, Machine learning, Uncertainty}, misc2 = {EMPIR 2018: Health}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2168-2194, 2168-2208}, DOI = {10.1109/JBHI.2020.3022989}, stag_bib_extends_levelofaccess = {NA}, author = {Strodthoff, N. and Wagner, P. and Schaeffter, T. and Samek, W.} } @Article { SachseBSHHKNL2020, subid = {2015}, title = {Colloidal bimetallic platinum–ruthenium nanoparticles in ordered mesoporous carbon films as highly active electrocatalysts for the hydrogen evolution reaction}, journal = {Catalysis Science \& Technology}, year = {2020}, volume = {10}, number = {7}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {2057-2068}, keywords = {Hydrogen, Nanoparticles, Hyrdrogen evolution reaction (HER)}, web_url = {https://pubs.rsc.org/en/content/articlelanding/2020/CY/C9CY02285F\#!divAbstract}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2044-4753, 2044-4761}, DOI = {10.1039/C9CY02285F}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Bernsmeier, D. and Schmack, R. and H{\"a}usler, I. and Hertwig, A. and Kraffert, K. and Nissen, J. and Lewis, H.} } @Article { NeyezhmakovPPTS2020, subid = {1860}, title = {Comparative analysis of quadrature formulas for the mean integral refractive index of air in high-precision ranging}, journal = {Modern achievements of geodesic science and industry}, year = {2020}, volume = {1(39)}, number = {2020}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {69-73}, keywords = {gradient method, mean integral indicator of atmospheric depressions, Earth's atmosphere}, web_url = {http://zgt.com.ua/wp-content/uploads/2021/01/\%D0\%A1\%D1\%82\%D0\%B0\%D1\%82\%D1\%82\%D1\%8F-\%D0\%9F\%D0\%9E\%D0\%A0\%D0\%86\%D0\%92\%D0\%9D\%D0\%AF\%D0\%9B\%D0\%AC\%D0\%9D\%D0\%98\%D0\%99-\%D0\%90\%D0\%9D\%D0\%90\%D0\%9B\%D0\%86\%D0\%97-\%D0\%9A\%D0\%92\%D0\%90\%D0\%94\%D0\%A0\%D0\%90\%D0\%A2\%D0\%A3\%D0\%A0\%D0\%9D\%D0}, misc2 = {EMPIR 2018: SI Broader Scope}, language = {130}, DOI = {10.33841/1819-1339-1-39-13}, stag_bib_extends_levelofaccess = {NA}, author = {Neyezhmakov, P. and Prokopov, O. and Panasenko, T. and Trevoho, I. and Shloma, A.} } @Article { TassoneMMPSN2020, subid = {2040}, title = {Modification of the EPA method 1631E for the quantification of total mercury in natural waters}, journal = {MethodsX}, year = {2020}, volume = {7}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {100987}, keywords = {EPA method 1631E, total mercury, waters}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {2215-0161}, DOI = {10.1016/j.mex.2020.100987}, stag_bib_extends_levelofaccess = {NA}, author = {Tassone, A. and Moretti, S. and Martino, M. and Pirrone, N. and Sprovieri, F. and Naccarato, A.} } @Article { SchoneweisKK2020, subid = {2545}, title = {A laboratory study for occupational safety and health on the structure of airborne ultrasound fields}, journal = {Acta Acustica}, year = {2020}, volume = {4}, number = {4}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {12}, keywords = {occupational safety, aorborne-ultrasound, noise,}, misc2 = {EMPIR 2015: Health}, publisher = {EDP Sciences}, language = {30}, ISSN = {2681-4617}, DOI = {10.1051/aacus/2020013}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"o}newei{\ss}, R. and Kling, C. and Koch, C.} } @Article { CalinALSSR2019, subid = {1770}, title = {Education and training tradition at IFIN-HH in radon measurement and evaluation of radiological impact}, journal = {Romanian Reports in Physics}, year = {2019}, month = {12}, day = {20}, volume = {71}, number = {4}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {906}, keywords = {Radon measurement, 222Rn standard system, Radon chamber, Indoor and outdoor radon, education and training, ANNETTE, EU project}, misc2 = {EMPIR 2016: Environment}, publisher = {Editura Academiei Romane}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://www.rrp.infim.ro/2019/AN71906.pdf}, author = {Calin, M.R. and Antohe, A. and Luca, A. and Stanescu, G. and Sahagia, M. and Radulescu, I.} } @Article { KlenovskyCSRCLHR2019, subid = {1360}, title = {Single-particle-picture breakdown in laterally weakly confining GaAs quantum dots}, journal = {Physical Review B}, year = {2019}, month = {12}, day = {13}, volume = {100}, number = {23}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {GaAs, quantum dot}, web_url = {https://journals.aps.org/prb/pdf/10.1103/PhysRevB.100.235425}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.235425}, stag_bib_extends_levelofaccess = {NA}, author = {Huber, D. and Lehner, B.U. and Csontosov{\'a}, D. and Reindl, M. and Schuler, S. and Covre Da Silva, S.F. and Klenovsk{\'y}, P. and Rastelli, A.} } @Article { SchinkeFBN2019, subid = {1641}, title = {Implementation and uncertainty evaluation of spectral stray light correction by Zong’s method}, journal = {Applied Optics}, year = {2019}, month = {12}, day = {13}, volume = {58}, number = {36}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {9998}, keywords = {spectral stray light, spectrometer, measurement uncertainty analysis}, misc2 = {EMPIR 2016: Energy}, publisher = {The Optical Society}, language = {30}, ISSN = {1559-128X, 2155-3165}, DOI = {10.1364/AO.58.009998}, stag_bib_extends_levelofaccess = {NA}, author = {Schinke, C. and Franke, M. and Bothe, K. and Nevas, S.} } @Article { RodtHSSHKFSR2019, subid = {1359}, title = {Deterministically fabricated spectrally-tunable quantum dot based single-photon source}, journal = {Optical Materials Express}, year = {2019}, month = {12}, day = {10}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {76}, keywords = {quantum dot, single-photon source}, web_url = {https://arxiv.org/ftp/arxiv/papers/1805/1805.10623.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {2159-3930}, DOI = {10.1364/OME.10.000076}, stag_bib_extends_levelofaccess = {NA}, author = {Schmidt, R. and Schmidt, M. and Helversen, M.V. and Fischbach, S. and Kaganskiy, A. and Schliwa, A. and Heindel, T. and Rodt, S. and Reitzenstein, S.} } @Article { JeneiPZTRTCSMD2019, subid = {1545}, title = {Waiting time distributions in a two-level fluctuator coupled to a superconducting charge detector}, journal = {Physical Review Research}, year = {2019}, month = {12}, day = {10}, volume = {1}, number = {3}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Waiting time distributions in a two-level fluctuator coupled to a superconducting charge detector}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2643-1564}, DOI = {10.1103/physrevresearch.1.033163}, stag_bib_extends_levelofaccess = {NA}, author = {Jenei, M. and Potanina, E. and Zhao, R. and Tan, K.Y. and Rossi, A. and Tanttu, T. and Chan, K.W. and Sevriuk, V. and M{\"o}tt{\"o}nen, M. and Dzurak, A.} } @Article { LoseroRMASG2019, subid = {1573}, title = {Quantum differential ghost microscopy}, journal = {Physical Review A}, year = {2019}, month = {12}, day = {10}, volume = {100}, number = {6}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {063818}, keywords = {Quantum Optics, Ghost Imaging, Quantum Correlations}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.100.063818}, stag_bib_extends_levelofaccess = {NA}, author = {Losero, E. and Ruo-Berchera, I. and Meda, A. and Avella, A. and Sambataro, O. and Genovese, M.} } @Article { PanuJTS2019, subid = {1309}, title = {Dynamic calibration method for reactive gases}, journal = {Measurement Science and Technology}, year = {2019}, month = {12}, volume = {31}, number = {3}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {034001}, keywords = {evaporation, traceability, reference gas, gas generator, gas flow, reactivecompounds, mercury}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab4d68}, stag_bib_extends_levelofaccess = {NA}, author = {Sari, S. and Timo, R. and Jussi, H. and Panu, H.} } @Article { PraakSSP2019, subid = {1386}, title = {Changing the status of mmHg}, journal = {Accreditation and Quality Assurance}, year = {2019}, month = {12}, volume = {n/a}, number = {n/a}, number2 = {16RPT03: inTENSE: Developing research capabilities for traceable intraocular pressure measurements}, pages = {1-2}, keywords = {SI, Pressure units, Sphygmomanometry, Eye tonometry}, web_url = {https://link.springer.com/article/10.1007/s00769-019-01414-7}, misc2 = {EMPIR 2016: Research Potential}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0949-1775, 1432-0517}, DOI = {10.1007/s00769-019-01414-7}, stag_bib_extends_levelofaccess = {NA}, author = {Praž{\'a}k, D. and Sedl{\'a}k, V. and Sınır, E. and Pluh{\'a}ček, F.} } @Article { SliwczynskiKT2019, subid = {1471}, title = {Stability limitations of optical frequency transfer in telecommunication DWDM networks}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2019}, month = {12}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {1-1}, keywords = {optical frequency transfer, DWDM network, optical fiber, alien wavelength}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010, 1525-8955}, DOI = {10.1109/TUFFC.2019.2957176}, stag_bib_extends_levelofaccess = {NA}, author = {Śliwczyński, L. and Krehlik, P. and Turza, K.} } @Article { BenklerLPWRS2019, subid = {1661}, title = {End-to-end topology for fiber comb based optical frequency transfer at the 10−21 level}, journal = {Optics Express}, year = {2019}, month = {12}, volume = {27}, number = {25}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {36886}, keywords = {optical frequency combs, stability transfer}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.036886}, stag_bib_extends_levelofaccess = {NA}, author = {Benkler, E. and Lipphardt, B. and Puppe, T. and Wilk, R. and Rohde, F. and Sterr, U.} } @Thesis { Simoes2019, subid = {1958}, title = {Optimization and automation of the hydrostatic weighing system for the determination of the liquid density of IPQ}, year = {2019}, month = {12}, number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements}, keywords = {Optimization; Hydrostatic weighing apparatus; Density of liquids; Design of automated mechanisms; Uncertainty in measurements; Calibration}, misc2 = {EMPIR 2017: Research Potential}, publisher = {Diogo Sim{\~o}es}, school = {Faculty of Science and Technology of the Universidade Nova de Lisboa}, language = {92}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/10362/92306}, author = {Sim{\~o}es, D.} } @Article { RibeiroPBAM2019, subid = {1427}, title = {Method selection to evaluate measurement uncertainty in microflow applications}, journal = {Journal of Physics: Conference Series}, year = {2019}, month = {11}, day = {29}, volume = {1379}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {012033}, keywords = {Uncertainty, microflow, Monte Carlo method, Bayesian method}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1379/1/012033/pdf}, misc2 = {EMPIR 2018: Health}, publisher = {IOP science}, language = {30}, ISSN = {17426588}, DOI = {10.1088/1742-6596/1379/1/012033}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Batista, E. and Pellegrino, O. and Ribeiro, {\'A}. and Martins, L.} } @Article { HorenderSIDVA2019, subid = {1333}, title = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm−3}, journal = {Metrologia}, year = {2019}, month = {11}, day = {27}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, keywords = {aerosol, optical particle counter, calibration, clean room, counting efficiency}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, booktitle = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm\(^{−3}\)}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab5c84}, stag_bib_extends_levelofaccess = {NA}, author = {Vasilatou, Konstantina and Dirscherl, Kai and Iida, Kenjiro and Sakurai, Hiromu and Horender, Stefan and Auderset, Kevin} } @Article { FitzGeraldMSH2019, subid = {1547}, title = {Development of a new primary humidity measurement standard}, journal = {Measurement Science and Technology}, year = {2019}, month = {11}, day = {27}, volume = {31}, number = {2}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {024007}, keywords = {Development of a new primary humidity}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab4a54}, stag_bib_extends_levelofaccess = {NA}, author = {FitzGerald, C. and Mac Lochlainn, D. and Strnad, R. and Hodzic, N.} } @Article { GeislerNBHSRKWHTHMSU2019, subid = {1316}, title = {Determining the Thickness and Completeness of the Shell of Polymer Core–Shell Nanoparticles by X-ray Photoelectron Spectroscopy, Secondary Ion Mass Spectrometry, and Transmission Scanning Electron Microscopy}, journal = {The Journal of Physical Chemistry C}, year = {2019}, month = {11}, day = {26}, number2 = {17SIP03: ESCoShell: An ISO Technical Report on the use of Electron Spectroscopy for Measurement of Core-Shell Nanoparticle Shell Thicknesses}, keywords = {Nanoparticles, core-shell, XPS, SIMS, T-SEM, polymer}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.9b09258}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, A. and Heinrich, T. and Tougaard, S. and Werner, W. S. M. and Hronek, M. and Kunz, V. and Radnik, J. and Stockmann, J. M. and Hodoroaba, V-D. and Benemann, S. and Nirmalananthan-Budau, N. and Gei{\ss}ler, D. and Sparnacci, K. and Unger, W. E. S } } @Article { SimovskiM2019, subid = {1351}, title = {Dual-metasurface superlens: A comprehensive study}, journal = {Physical Review B}, year = {2019}, month = {11}, day = {25}, volume = {100}, number = {20}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {205426}, keywords = {Subwavelength resolution, superlens, metasurface, hybridization of plasmons, bandgap, nanoimaging205426}, web_url = {https://arxiv.org/pdf/1910.14295v1.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.205426}, stag_bib_extends_levelofaccess = {NA}, author = {Mollaei, M.S.M. and Simovski, C.} } @Article { KashcheyevsFBJLSGFRK2019, subid = {1312}, title = {Continuous-variable tomography of solitary electrons}, journal = {Nature Communications}, year = {2019}, month = {11}, day = {22}, volume = {10}, number = {1}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, keywords = {Single electron, Electron wave packet, Tomography}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-13222-1}, stag_bib_extends_levelofaccess = {NA}, author = {Fletcher, J. D. and Johnson, N. and Locane, E. and See, P. and Griffiths, J. P. and Farrer, I. and Ritchie, D. A. and Brouwer, P. W. and Kashcheyevs, V. and Kataoka, M.} } @Article { BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019, subid = {2340}, title = {The Metrological Traceability, Performance and Precision of European Radon Calibration Facilities}, journal = {International Journal of Environmental Research and Public Health}, year = {2019}, month = {11}, day = {21}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, keywords = {radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.3390/ijerph182212150}, stag_bib_extends_levelofaccess = {NA}, author = {Beck, T.R. and Antohe, A. and Cardellini, F. and Cucoş, A. and Fialova, E. and Grossi, C. and Hening, K. and Jensen, J. and Kastratović, D. and Krivoš{\'i}k, M. and Lobner, P. and Luca, A. and Maringer, F.J. and Michielsen, N. and Otahal, P.P.S. and Quindos, L. and Rabago, D. and Sainz, C. and Sz{\"u}cs, L. and Teodorescu, T. and Tolinsson, C. and Tugulan, C.L. and Turtiainen, T. and Vargas, A. and Vosahlik, J. and Vukoslavovic, G. and Wiedner, H. and Wołoszczuk, K.} } @Article { SchneiderHHCFKRSTR2019, subid = {1362}, title = {Resolving the temporal evolution of line broadening in single quantum emitters}, journal = {Optics Express}, year = {2019}, month = {11}, day = {18}, volume = {27}, number = {24}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {35290}, keywords = {single quantum emitter, GaAs and In(Ga)As quantum dots}, web_url = {https://www.osapublishing.org/DirectPDFAccess/0872F4C8-F64C-1DD3-BF83A9359A9A78C7_423274/oe-27-24-35290.pdf?da=1\&id=423274\&seq=0\&mobile=no}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.035290}, stag_bib_extends_levelofaccess = {NA}, author = {Schimpf, C. and Reindl, M. and Klenovsk{\'y}, P. and Fromherz, T. and Covre Da Silva, S.F. and Hofer, J. and Schneider, C. and H{\"o}fling, S. and Trotta, R. and Rastelli, A.} } @Article { StoschGZPFM2019, subid = {1299}, title = {Step‐by‐step monitoring of a magnetic and SERS‐active immunosensor assembly for purification and detection of tau protein}, journal = {Journal of Biophotonics}, year = {2019}, month = {11}, day = {13}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, keywords = {synthesis of iron oxide, tau protein, diagnosis of Alzheimer's disease, SERS‐active immunosensor, purification and detection of tau protein}, web_url = {https://onlinelibrary.wiley.com/doi/abs/10.1002/jbio.201960090}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {1864-063X, 1864-0648}, DOI = {10.1002/jbio.201960090}, stag_bib_extends_levelofaccess = {NA}, author = {Maurer, V. and Frank, C. and Porsiel, J. C. and Zellmer, S. and Garnweitner, G. and Stosch, R.} } @Manual { SmithHWB2019, subid = {1448}, title = {Document describing a universal and flexible structure for digital calibration certificates (DCC)}, year = {2019}, month = {11}, day = {11}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {digital calibration certificate (DCC), data communication, IoT-communication, IoT-networking SmartCom, minimum requirements}, misc2 = {EMPIR 2017: Industry}, publisher = {SmartCom}, language = {30}, DOI = {10.5281/zenodo.3696567}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, I. and Hutzschenreuter, D. and Wiedenh{\"o}fer, T. and Brown, C.} } @Article { RanitzschPNMKKEBBLRS2019, subid = {1234}, title = {Beta spectrometry with metallic magnetic calorimeters in the framework of the European EMPIR project MetroBeta}, journal = {Applied Radiation and Isotopes}, year = {2019}, month = {11}, volume = {153}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {108830}, keywords = {Beta spectrometry; Metallic magnetic calorimeter; Ionizing radiation metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2019.108830}, stag_bib_extends_levelofaccess = {NA}, author = {Loidl, M. and Beyer, J. and Bockhorn, L. and Enss, C. and Kempf, S. and Kossert, K. and Mariam, R. and N{\"a}hle, O. and Paulsen, M. and Ranitzsch, P. and Rodrigues, M. and Schmidt, M.} } @Article { GuarnizoMRFS2019, subid = {1272}, title = {Validation of Emission Spectroscopy Gas Temperature Measurements Using a Standard Flame Traceable to the International Temperature Scale of 1990 (ITS-90)}, journal = {International Journal of Thermophysics}, year = {2019}, month = {11}, volume = {40}, number = {11}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {99}, keywords = {Combustion, Emission spectroscopy, ITS-90, Rayleigh scattering, Standard Temperature}, web_url = {https://link.springer.com/content/pdf/10.1007\%2Fs10765-019-2557-6.pdf}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-019-2557-6}, stag_bib_extends_levelofaccess = {NA}, author = {Sutton, G. and Fateev, A. and Rodr{\'i}guez-Conejo, M.A. and Mel{\'e}ndez, J. and Guarnizo, G.} } @Article { KlenovskyBMASS2019, subid = {1361}, title = {Optical response of (InGa)(AsSb)/GaAs quantum dots embedded in a GaP matrix}, journal = {Physical Review B}, year = {2019}, month = {11}, volume = {100}, number = {19}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {electronic structure, quantum dot}, web_url = {https://arxiv.org/abs/1906.09842}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.195407}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Marr{\'o}n, D.F. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { RibeiroPBSM2019, subid = {1419}, title = {Method selection to evaluate measurement uncertainty in microflow applications}, journal = {Journal of Physics: Conference Series}, year = {2019}, month = {11}, volume = {1379}, number = {2019}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, pages = {012033}, keywords = {microflow, medicine, neonatology, oncology, measurement uncertainty, GUM, Monte Carlo}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1379/1/012033}, stag_bib_extends_levelofaccess = {NA}, author = {Sousa, J.A. and Batista, E. and Pellegrino, O. and Ribeiro, A.S. and Martins, L.L.} } @Manual { EloKnKALSZSFRBSHWHHHNHMMHP2019, subid = {1433}, title = {SmartCom Digital System of Units (D-SI) Guide for the use of the metadata-format used in metrology for the easy-to-use, safe, harmonised and unambiguous digital transfer of metrological data}, year = {2019}, month = {11}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Digital-SI (D-SI) metrology data digital exchange format SmartCom data communication IoT-networking IoT-communication}, web_url = {https://zenodo.org/record/3522631\#.XlTbaTFKhaQ}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.3522631}, stag_bib_extends_levelofaccess = {NA}, author = {Elo, T. and Kuosmanen, P. and  Mustap{\"a}{\"a}, T. and Klobucar, R. and Acko, B. and Linkeov{\'a}, I. and S{\'y}kora, J. and Zelen{\'y}, V. and Smith, I. and Forbes, A. and Rhodes, S. and Brown, C. and Scheibner, A. and Hackel, S.G. and Wiedenh{\"o}fer, T. and Heeren, W. and Haertig, F. and Hutschenreuter, D. and Nikander, P. and Hovhannisyan, K. and Maennel, O. and Muller, B. and Heindorf, L. and Paciello, V.} } @Techreport { SmithWHHB2019, subid = {1434}, title = {D-SI in Short - Digital brochure on establishing the use of units in digitalised communication}, journal = {Zenodo}, year = {2019}, month = {11}, volume = {1}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Digital-SI (D-SI) data communication IoT-communication IoT-networking metrology data SmartCom digital exchange format}, web_url = {https://zenodo.org/record/3522074\#.XlTiRTFKhaQ}, misc2 = {EMPIR 2017: Industry}, publisher = {SmartCom}, language = {30}, DOI = {10.5281/zenodo.3522074}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, I. and Wiedenh{\"o}fer, T. and Haertig, F. and Hutschenreuter, D. and Brown, C.} } @Article { AlveseSousaMB2019, subid = {1426}, title = {Calibration of insulin pumps}, journal = {Journal of Diabetes and Treatment}, year = {2019}, month = {11}, volume = {4}, number = {3}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {1075}, keywords = {Calibration, measurement, microflow, insulin pump, gravimetry, optical method}, misc2 = {EMPIR 2018: Health}, publisher = {Gavin Publishers}, language = {30}, ISSN = {2574-7568}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.gavinpublishers.com/assets/articles_pdf/1575449809article_pdf938882132.pdf}, author = {Sousa, J.A. and Martins, R. and Batista, E.} } @Article { SantosCMGPAM2019, subid = {1337}, title = {Multiconfiguration Dirac–Fock calculations of Zn K‐shell radiative and nonradiative transitions}, journal = {X-Ray Spectrometry}, year = {2019}, month = {10}, day = {29}, volume = {49}, number = {1}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {192-199}, keywords = {Dirac–Fock method, Zn K‐shell}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {0049-8246, 1097-4539}, DOI = {10.1002/xrs.3089}, stag_bib_extends_levelofaccess = {NA}, author = {Martins, L. and Amaro, P. and Pessanha, S. and Guerra, M. and Machado, J. and Carvalho, M. L. and Santos, J. P.} } @Article { BinghamWSTMFZSRKH2019, subid = {1353}, title = {Formation of N{\'e}el-type skyrmions in an antidot lattice with perpendicular magnetic anisotropy}, journal = {Physical Review B}, year = {2019}, month = {10}, day = {25}, volume = {100}, number = {14}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {144435}, keywords = {Skyrmions, DMI, spin waves}, web_url = {https://arxiv.org/abs/1910.04515}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.144435}, stag_bib_extends_levelofaccess = {NA}, author = {Saha, S. and Zelent, M. and Finizio, S. and Mruczkiewicz, M. and Tacchi, S. and Suszka, A. K. and Wintz, S. and Bingham, N. S. and Raabe, J. and Krawczyk, M. and Heyderman, L. J.} } @Article { LaihoSSKHSBWR2019, subid = {2617}, title = {Photon-number parity of heralded single photons from a Bragg-reflection waveguide reconstructed loss-tolerantly via moment generating function}, journal = {New Journal of Physics}, year = {2019}, month = {10}, volume = {21}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {103025}, keywords = {factorial moment of photon number, photon-number parity, moment generating function, parametric down-conversion, Bragg-reflection waveguide, transition-edge sensor}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab42ae}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab42ae}, stag_bib_extends_levelofaccess = {NA}, author = {Laiho, K. and Schmidt, M. and Suchomel, H. and Kamp, M. and H{\"o}fling, S. and Schneider, C. and Beyer, J. and Weihs, G. and Reitzenstein, S.} } @Proceedings { FortuneCRSPA2019, subid = {1198}, title = {STUDY OF NONINVASIVE INSTRUMENTS FOR THE MEASUREMENT OF X-RAY HIGH VOLTAGE TUBE}, journal = {Proceedings of CIM 2019}, year = {2019}, month = {9}, day = {24}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {Pulsed X-ray tube, KVp meters, Metrology, Dose.}, web_url = {https://www.cim2019.com}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Paris, France}, event_name = {The 19st Congr{\`e}s Internationla de M{\'e}trologie}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201902002}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {10.5281/zenodo.3335340}, author = {Agazar, M. and Perrillat, D. and Saadeddine, H. and Robert, C. and Casteignau, L. and Fortune, D.} } @Proceedings { CucciaSBLvAMCVSBPCT2019, subid = {1781}, title = {Development of standardized methods for the analysis of amines, terpenes and ammonia in biomethane}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, keywords = {biomethane, terpenes, amines, ammonia}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201906001}, stag_bib_extends_levelofaccess = {NA}, author = {Cuccia, L. and Sanz, B. and Ballestas Castro, D. and Li, J. and van der Veen, A.M.H. and Amico di Meane, E. and Moreno, S. and Culleton, L.P. and Vorin, D. and Senn{\'e}, C. and Bougueroua, F. and Pyr{\'e}e, L. and Courtois, Y. and Tastard, C.} } @Article { SanmamedSDGC2019, subid = {2151}, title = {Temperature influence on the frequency response of the Keysight 3458A digital multimeter}, journal = {Proceedings 23rd IMEKO TC 4 International Symposium}, year = {2019}, month = {9}, day = {20}, number2 = {17RPT03: DIG-AC: A digital traceability chain for AC voltage and current}, keywords = {Analog to Digital Converter, temperature coefficient, aperture time, digital sampling, digitizer}, misc2 = {EMPIR 2017: Research Potential}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc4-2019/IMEKO-TC4-2019-042.pdf}, author = {Sanmamed, Y.A. and Salinas, J.R. and Diaz de Aguilar, J. and Garc{\'i}a-Lagos, F. and Caballero, R.} } @Article { BurgerHSGSR2019, subid = {1291}, title = {Benchmarking Five Global Optimization Approaches for Nano-optical Shape Optimization and Parameter Reconstruction}, journal = {ACS Photonics}, year = {2019}, month = {9}, day = {17}, volume = {6}, number = {11}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {2726-2733}, keywords = {shape optimization, parameter reconstruction, machine learning, global optimization, Bayesian optimization}, web_url = {https://arxiv.org/abs/1809.06674}, misc2 = {EMPIR 2017: Fundamental}, publisher = {ACS}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.9b00706}, stag_bib_extends_levelofaccess = {NA}, author = {Schneider, P.I. and Garcia Santiago, X. and Soltwisch, Vi. and Hammerschmidt, M. and Burger, S. and Rockstuhl, C.} } @Article { SterpinG2019, subid = {1332}, title = {Monte Carlo calculation of beam quality correction factors in proton beams using PENH}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {9}, day = {17}, volume = {64}, number = {18}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {185009}, keywords = {beam quality correction factors, Monte Carlo calculation, radiation dosimetry, proton therapy}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab3b94}, stag_bib_extends_levelofaccess = {NA}, author = {Gom{\`a}, C. and Sterpin, E.} } @Article { SergeevaCholletFPPDMS2019, subid = {1268}, title = {Optimizing magnetoresistive sensor signal-to-noise via pinning field tuning}, journal = {Applied Physics Letters}, year = {2019}, month = {9}, day = {16}, volume = {115}, number = {12}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {122406}, keywords = {magnetic sensor, noise, magnetoresistance}, web_url = {https://arxiv.org/abs/1909.04531}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/1.5108604}, stag_bib_extends_levelofaccess = {NA}, author = {Moulin, J. and Doll, A. and Paul, E. and Pannetier-Lecoeur, M. and Fermon, C. and Sergeeva-Chollet, N. and Solignac, A.} } @Article { BremerFPRSHW2019, subid = {1804}, title = {Cesium‐Vapor‐Based Delay of Single Photons Emitted by Deterministically Fabricated Quantum Dot Microlenses}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {9}, day = {12}, volume = {3}, number = {2}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1900071}, keywords = {atomic vapors delays deterministic fabrication quantum dots single‐photon sources}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900071}, stag_bib_extends_levelofaccess = {NA}, author = {Bremer, L. and Fischbach, S. and Park, S‐I. and Rodt, S. and Song, J‐Dong. and Heindel, T. and Weber, N.} } @Proceedings { SahagiaL2019, subid = {1772}, title = {Absolute standardization of the radionuclide 54Mn and participation at international comparisons}, journal = {Proceedings of the 7th International Proficiency Testing Conference (PTconf), Oradea, Romania, 10-13 September 2019}, year = {2019}, month = {9}, day = {10}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {187-193}, keywords = {Primary Standard, Key Comparison CCRI(II)-K2.Mn-54 , 4piPC-gamma coincidence method, Ionisation chamber measurement}, misc2 = {EMPIR 2016: Environment}, publisher = {Smart Publishing Bucharest}, event_place = {Oradea (Romania)}, event_name = {7th International Proficiency Testing Conference}, event_date = {10-09-2019 to 13-09-2019}, language = {30}, ISSN = {2066-737X}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://www.pt-conf.org/2019/wp-content/uploads/2019/09/Proceedings-PT-Conf-2019.pdf}, author = {Sahagia, M. and Luca, A.} } @Proceedings { KrokerWSKB2019, subid = {1282}, title = {Sub-Wavelength Features in Spectroscopic Mueller Matrix Ellipsometry}, journal = {Deutsche Gesellschaft f{\"u}r angewandte Optik Proceedings 2019}, year = {2019}, month = {9}, volume = {120}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Gratings, Measurement Technology, Scatterometry}, web_url = {https://www.dgao-proceedings.de/download/120/120_p9.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Deutsche Gesellschaft f{\"u}r angewandte Optik e.V. (DGaO)}, event_place = {Darmstadt}, event_name = {120. Jahrestagung der Deutschen Gesellschaft f{\"u}r angewandte Optik}, event_date = {11-06-2019 to 15-06-2019}, language = {30}, ISSN = {1614-8436}, stag_bib_extends_levelofaccess = {NA}, author = {Kroker, Stefanie and Wurm, Matthias and Siefke, Thomas and K{\"a}seberg, Tim and Bodermann, Bernd} } @Article { KorpelainenGKAS2019, subid = {1298}, title = {Atomic force microscope with an adjustable probe direction and piezoresistive cantilevers operated in tapping-mode / Im Tapping-Modus betriebenes Rasterkraftmikroskop mit einstellbarer Antastrichtung und piezoresistiven Cantilevern}, journal = {tm - Technisches Messen}, year = {2019}, month = {9}, volume = {86}, number = {s1}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {12-16}, keywords = {Rasterkraftmikroskopie; piezoresistive Cantilever; Nanomessmaschine}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2196-7113, 0171-8096}, DOI = {10.1515/teme-2019-0035}, stag_bib_extends_levelofaccess = {NA}, author = {Schaude, J. and Albrecht, J. and Kl{\"o}pzig, U. and Gr{\"o}schl, A.C. and Hausotte, Tino} } @Proceedings { BermbachSHTL2019, subid = {1294}, title = {Guards and Watchdogs in One-Way Synchronization with Delay-Related Authentication Mechanisms}, journal = {2019 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, year = {2019}, month = {9}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-6}, keywords = {Synchronization, Protocols, Servers, Cryptography, Clocks, Global navigation satellite system}, web_url = {https://doi.org/10.1109/ISPCS.2019.8886633}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Portland (Oregon) United States}, event_name = {International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication}, event_date = {22-09-2019 to 27-09-2019}, language = {30}, ISBN = {978-1-5386-7607-3, 978-1-5386-}, ISSN = {1949-0313, 1949-0305}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.17IND06.CA.20191126}, author = {Bermbach, R. and Sibold, D. and Heine, K. and Teichel, K. and Langer, M.} } @Article { ReitzensteinSZBRDDDMWPOMKSSGSMoU2019, subid = {1363}, title = {Method for direct coupling of a semiconductor quantum dot to an optical fiber for single-photon source applications}, journal = {Optics Express}, year = {2019}, month = {9}, volume = {27}, number = {19}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {26772}, keywords = {semiconductor quantum dot, single-photon source}, web_url = {https://www.osapublishing.org/DirectPDFAccess/08FE2392-996C-94FE-814D27FFE5E6D46E_418606/oe-27-19-26772.pdf?da=1\&id=418606\&seq=0\&mobile=no}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.026772}, stag_bib_extends_levelofaccess = {NA}, author = {Żołnacz, K. and Musiał, A. and Srocka, N. and Gro{\ss}e, J. and Schl{\"o}singer, M.J. and Schneider, P-I. and Kravets, O. and Mikulicz, M. and Olszewski, J. and Poturaj, K. and W{\'o}jcik, G. and Mergo, P. and Dybka, K. and Dyrkacz, M. and Dłubek, M. and Rodt, S. and Burger, S. and Zschiedrich, L. and Sęk, G. and Reitzenstein, S. and Urbańczyk, W.} } @Article { LeferinkSAPH2019, subid = {1381}, title = {On-site Waveform Characterization at Static Meters Loaded with Electrical Vehicle Chargers}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {IEEE Keywords Current measurement, Meters, Time measurement, Electromagnetic interference, Time-domain analysis, Probes, Battery charge measurement INSPEC: Controlled Indexing battery storage plants, charge measurement, electric vehicle charging, electromagnetic interference, statistical distributions, time-domain analysis INSPEC: Non-Controlled Indexing electrical vehicle chargers, static meter misreadings, noisy waveforms, electric vehicle charging stations, on-site waveform characterization, EV charging stations, TEMPS software, time domain electromagnetic interference measurement and post-processing system, amplitude probability distribution, APD, EMI measurements, baseband digitizer}, web_url = {https://research.utwente.nl/en/publications/on-site-waveform-characterization-at-static-meters-loaded-with-el}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2019.8871469}, stag_bib_extends_levelofaccess = {NA}, author = {Hartman, T. and Pous, M. and Azpurua, M.A. and Silva, F. and Leferink, F.} } @Proceedings { MarrowsKGDCCBSK2019, subid = {1428}, title = {Measuring Interfacial Dzyaloshinskii-Moriya Interaction: A Review}, journal = {Proceedings}, year = {2019}, month = {9}, volume = {26}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {41}, keywords = {Dzyaloshinskii-Moriya interaction}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, event_place = {Ferrara}, event_name = {XXXVII International Symposium on Dynamical Properties of Solids}, event_date = {08-09-2019 to 12-09-2019}, language = {30}, ISSN = {2504-3900}, DOI = {10.3390/proceedings2019026041}, stag_bib_extends_levelofaccess = {NA}, author = {Back, C. and Carlotti, G. and Casiraghi, A. and Durin, G. and Garcia-Sanchez, F. and Kuepferling, M. and Marrows, C. and Soares, G. and Tacchi, S.} } @Proceedings { KehrtJS2019, subid = {1445}, title = {Comparison of Waveguide and Free-Space Power Measurement in the Millimeter-Wave Range}, journal = {2019 44th International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz)}, year = {2019}, month = {9}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, keywords = {Optical waveguides, Power measurement, Detectors, Antenna measurements, Horn antennas}, web_url = {https://oar.ptb.de/files/download/5e5d0f6f4c93903e3800394c}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Paris}, event_name = {2019 44th International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz)}, event_date = {01-09-2019 to 06-09-2019}, language = {30}, stag_bib_extends_levelofaccess = {NA}, author = {Kehrt, M. and Judaschke, R. and Steiger, A.} } @Article { KellmanMRSBXORNIRMGNPC2019, subid = {1474}, title = {Simultaneous 13N-Ammonia and gadolinium first-pass myocardial perfusion with quantitative hybrid PET-MR imaging: a phantom and clinical feasibility study}, journal = {European Journal of Hybrid Imaging}, year = {2019}, month = {9}, volume = {3}, number = {1}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, keywords = {myocardial perfusion, hybrid PET-MR}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2510-3636}, DOI = {10.1186/s41824-019-0062-6}, stag_bib_extends_levelofaccess = {NA}, author = {Nazir, M.S. and Gould, S-M. and Milidonis, X. and Reyes, E. and Ismail, T.F. and Neji, R. and Roujol, S. and O’Doherty, J. and Xue, H. and Barrington, S.F. and Schaeffter, T. and Razavi, R. and Marsden, P. and Kellman, P. and Plein, S. and Chiribiri, A.} } @Proceedings { NeubergerRSW2019, subid = {1502}, title = {LED-Based Differential Spectral Responsivity Measurements of PV Modules}, journal = {https://www.eupvsec-proceedings.com/proceedings}, year = {2019}, month = {9}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Spectral Response, LED, PV Modules, Solar Simulator, DSR}, misc2 = {EMPIR 2016: Energy}, event_place = {Marseille, France}, event_name = {36th European Photovoltaic Solar Energy Conference and Exhibitio}, event_date = {09-09-2019 to 13-09-2019}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/3784708}, author = {Neuberger, F. and Riechelmann, S. and Straeter, H. and Winter, S.} } @Proceedings { SeferiCBMS2019, subid = {1964}, title = {Power Quality Event Analysis in 25 kV 50 Hz AC Railway System Networks}, journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2019}, month = {9}, volume = {1}, number = {1}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Railway transportation power systems, power quality, power system transients, voltage interruption}, web_url = {https://strathprints.strath.ac.uk/70058/}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Aachen, Germany}, event_name = {International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {25-09-2019 to 27-09-2012}, language = {30}, ISBN = {978-1-7281-0075-3}, ISSN = {2475-2304g}, DOI = {10.1109/AMPS.2019.8897765}, stag_bib_extends_levelofaccess = {NA}, author = {Seferi, Y. and Clarkson, P. and Blair, S.M. and Mariscotti, A. and Stewart, B.G.} } @Proceedings { LuisoLGFSGCBD2019, subid = {1946}, title = {Monitoring Energy and Power Quality On Board Train}, journal = {2019 IEEE 10th International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2019}, month = {9}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {Power and Energy measurement, Railway system, Energy saving, Reversible Substation, DC Power Quality}, web_url = {https://zenodo.org/record/4598462}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Dubrovnik, Croatia}, event_name = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {25-05-2020 to 28-05-2020}, language = {30}, ISBN = {978-1-7281-0075-3}, ISSN = {2475-2304}, DOI = {10.1109/AMPS.2019.8897794}, stag_bib_extends_levelofaccess = {NA}, author = {Luiso, M. and Landi, C. and Gallo, D. and Femine, A.D. and Signorino, D. and Giordano, D. and Crotti, G. and Biancucci, A. and Donadio, L.} } @Proceedings { SauzayRJBBWS2019, subid = {1302}, title = {Estimating Uncertainty in Loss Measurement of Power Transformers}, journal = {Proceedings of the 21st International Symposium on High Voltage Engineering}, year = {2019}, month = {8}, day = {30}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {power transformers, losses, measurement, uncertainty.}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Budapest}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3559837}, stag_bib_extends_levelofaccess = {NA}, author = {Sauzay, M. and Rietveld, G. and J{\"o}nsson, B. and Bergman, A. and Bergman, A. and Walmsley, J. and Sund, J-B.} } @Proceedings { CastroVWKHS2019, subid = {1202}, title = {Stability of the surface passivation properties of atomic layer deposited aluminum oxide in damp heat conditions}, journal = {AIP Conference Proceedings}, year = {2019}, month = {8}, day = {27}, volume = {2147}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {050003}, keywords = {Aluminium oxide, surface passivation, damp heat exposure, atomic layer deposition, degradation}, web_url = {https://aip.scitation.org/doi/pdf/10.1063/1.5123852?class=pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, event_place = {Leuven, Belgium}, event_name = {SiliconPV 2019, THE 9TH INTERNATIONAL CONFERENCE ON CRYSTALLINE SILICON PHOTOVOLTAICS}, event_date = {08-04-2019 to 10-04-2019}, language = {30}, ISBN = {978-0-7354-1892-9}, ISSN = {1551-7616}, DOI = {10.1063/1.5123852}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, I.T.S. and Koutsourakis, G. and Wood, S. and V{\"a}h{\"a}nissi, V. and Castro, F.A. and Savin, H.} } @Proceedings { RoviraGSFA2019, subid = {1197}, title = {Characterisation of high voltage dividers for X-ray measurements}, journal = {Proceedings of IHS2019}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {High Voltage, Pulsed X-ray tube , Divider, Metrology}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary,}, event_name = {The 21st International Symposium on High Voltage Engineering (ISH2019)}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3243494}, author = {Rovira, J. and Garnacho, F. and Saadeddine, H. and Fortune, D. and Agazar, M.} } @Proceedings { LehtonenHTSHM2019, subid = {1303}, title = {Measuring Losses of an Air-Core Shunt Reactor with an Advanced Loss Measuring System}, journal = {Proceedings of ISH 2019}, year = {2019}, month = {8}, day = {26}, number2 = {17NRM01: TrafoLoss: Loss Measurements on Power Transformers and Reactors}, keywords = {Reactor, loss measurement, voltage divider, loss measuring system}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Budapest, Hungary}, event_name = {21st International Symposium on High Voltage Engineering}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, DOI = {10.5281/zenodo.3521194}, stag_bib_extends_levelofaccess = {NA}, author = {Havunen, J. and Suomalainen, E-P. and Tornberg, J. and H{\"a}llstr{\"o}m, J. and Lehtonen, T. and Mervi{\"o}, A.} } @Inbook { RuttingerPGCPSKBJSBSWWS2019, subid = {1193}, title = {European Research on Magnetic Nanoparticles for Biomedical Applications: Standardisation Aspects}, year = {2019}, month = {8}, day = {23}, volume = {Advances i}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {316-326}, keywords = {magnetic nanoparticles, standardisation European research}, web_url = {https://arxiv.org/abs/1905.08791}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer International Publishing}, address = {Cham}, booktitle = {Current Trends in Biomedical Engineering and Bioimages Analysis. PCBEE 2019.}, language = {30}, ISBN = {978-3-030-29884-5}, DOI = {10.1007/978-3-030-29885-2_29}, stag_bib_extends_levelofaccess = {NA}, author = {Schier, Peter and Barton, Craig and Spassov, Simo and Johansson, Christer and Baumgarten, Daniel and Kazakova, Olga and Southern, Paul and Pankhurst, Quentin and Coisson, Marco and Gr{\"u}ttner, Cordula and Price, Alex and R{\"u}ttinger, Roman and Wiekhorst, Frank and Wells, James and Steinhoff, Uwe} } @Article { FuenteSMDGQPR2019, subid = {1290}, title = {Testing and Calibration of CDs as Radon Detectors at Highly Variable Radon Concentrations and Temperatures}, journal = {International Journal of Environmental Research and Public Health}, year = {2019}, month = {8}, day = {22}, volume = {16}, number = {17}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {3038}, keywords = {radon; CD-method; blind comparison; extremely variable concentrations; unstabletemperature}, web_url = {https://www.mdpi.com/1660-4601/16/17/3038/htm}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {1660-4601}, DOI = {10.3390/ijerph16173038}, stag_bib_extends_levelofaccess = {NA}, author = {Pressyanov, D. and Quindos Poncela, L.S. and Georgiev, S. and Dimitrova, I. and Mitev, K. and Sainz, C. and Fuente, I. and Rabago, D.} } @Proceedings { VentreMDBCFPPRSTBASSGHBZFDKL2019, subid = {1200}, title = {Metrology for Inductive Charging of Electric Vehicles (MICEV)}, journal = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, year = {2019}, month = {8}, day = {19}, volume = {Electrical}, number = {2019 AEIT}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {6 pages}, keywords = {Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety}, web_url = {http://arxiv.org/abs/1908.11108}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Turin (Italy)}, event_name = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, event_date = {02-07-2019 to 04-07-2019}, language = {30}, ISBN = {978-8-8872-3743-6}, ISSN = {0018-9219}, DOI = {10.23919/EETA.2019.8804498}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Bottauscio, O. and Harmon, S. and Guilizzoni, R. and Schilling, F. and Schmidt, M. and Ankarson, P. and Bergsten, T. and Tammi, K. and Sainio, P. and Romero, J.B. and Puyal, E.L. and Pichon, L. and Freschi, F. and Cirimele, V. and Bauer, P. and Dong, J. and Maffucci, A. and Ventre, S. and Femia, N. and Di Capua, G. and Kuster, N. and Liorni, I.} } @Article { AslanDSWZOY2019, title = {Comparison of two methods for the rapid radiochemical analysis of air dust samples in emergency situations}, journal = {Applied Radiation and Isotopes}, year = {2019}, month = {8}, volume = {150}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {120-126}, keywords = {Emergency preparedness, airborne radioactivity, radiochemical analysis, extraction chromatography}, web_url = {https://www.sciencedirect.com/science/article/pii/S0969804317308229?dgcid=raven_sd_via_email}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, address = {230 Park Avenue Suite 800 Shantae McGee New York NY 10169-0935 United States}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2019.04.031}, stag_bib_extends_levelofaccess = {NA}, author = {Aslan, N. and Dirican, A. and Seferinoğlu, M. and Wershofen, H. and Zapata-Garc{\'i}a, D. and {\"O}z\c{c}ayan, G. and Y{\"u}cel, {\"U}.} } @Article { ColemanERGS2019, subid = {1191}, title = {Uncertainty requirements of the European Union’s Industrial Emissions Directive for monitoring sulfur dioxide emissions: Implications from a blind comparison of sulfate measurements by accredited laboratories}, journal = {Journal of the Air \& Waste Management Association}, year = {2019}, month = {8}, volume = {69}, number = {9}, number2 = {15NRM01: Sulf-Norm: Metrology for sampling and conditioning SO2 emissions from stacks}, pages = {1070-1078}, keywords = {Uncertainty requirements, European Union’s Industrial Emissions Directive, monitoring sulfur dioxide emissions}, web_url = {https://doi.org/10.1080/10962247.2019.1604449}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1096-2247, 2162-2906}, DOI = {10.1080/10962247.2019.1604449}, stag_bib_extends_levelofaccess = {NA}, author = {Coleman, M.D. and Ellison, M. and Robinson, R.A. and Gardiner, T.D. and Smith, T.O.M.} } @Article { KotilHHSK2019, subid = {1242}, title = {Analysis of elemental composition and porosity of mesoporous iridium-titanium mixed oxide thin films for energy application by SEM/EDS}, journal = {Microscopy and Microanalysis}, year = {2019}, month = {8}, volume = {25}, number = {S2}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {1770-1771}, keywords = {oxide thin films}, misc2 = {EMPIR 2016: Energy}, publisher = {Cambridge University Press (CUP)}, language = {30}, ISSN = {1431-9276, 1435-8115}, DOI = {10.1017/S1431927619009589}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Hodoroaba, V.-D. and Hertwig, A. and Kotil, L. and Kraehnert, R.} } @Article { OrtolanoARCETCZSCC2019, subid = {1227}, title = {Mapping the conductivity of graphene with Electrical Resistance Tomography}, journal = {Scientific Reports}, year = {2019}, month = {7}, day = {23}, volume = {9}, number = {1}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, keywords = {graphene, electrical resistance tomography, conductivity, terahertz spectroscopy}, web_url = {https://doi.org/10.1038/s41598-019-46713-8}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-46713-8}, stag_bib_extends_levelofaccess = {NA}, author = {Cultrera, A. and Serazio, D. and Zurutuza, A. and Centeno, A. and Txoperena, O. and Etayo, D. and Cordon, A. and Redo-Sanchez, A. and Arnedo, I. and Ortolano, M. and Callegaro, L.} } @Thesis { Schaffer2019, subid = {1814}, title = {Cavity-enhanced optical clocks}, year = {2019}, month = {7}, day = {21}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Optical Lattice Clock, Superradiant laser}, misc2 = {EMPIR 2017: Fundamental}, school = {Kopenagen University}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.nbi.ku.dk/english/theses/phd-theses/phd_theses_2019/stefan_alaric_schaffer/}, author = {Sch{\"a}ffer, S.A.} } @Article { SOCHOROVARLLKFDCCBBT2019, subid = {1285}, title = {Activity measurements and determination of nuclear decay data of 166Ho in the MRTDosimetry project}, journal = {Applied Radiation and Isotopes}, year = {2019}, month = {7}, day = {20}, volume = {153}, number = {November 2}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {1-11}, keywords = {Ho166, Activity standardization, gamma-spectrometry, Half-life measurements, Molecular radiotherapy, MRTDosimetry}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2019.108826}, stag_bib_extends_levelofaccess = {NA}, author = {Bobin, C. and BOUCHARD, J. and CHISTE, V. and COLLINS, S. and Dry{\'a}k, P. and FENWICK, A. and Keightley, J. and L{\'e}py, M.C. and Lourenco, V. and Robinson, A. and Sochorov{\'a}, J. and THIAM, C.} } @Article { ShardCHS2019, subid = {1182}, title = {Summary of ISO/TC 201 Standard: ISO 22415—Surface chemical analysis—Secondary ion mass spectrometry—Method for determining yield volume in argon cluster sputter depth profiling of organic materials}, journal = {Surface and Interface Analysis}, year = {2019}, month = {7}, day = {15}, number2 = {15SIP02: ISOChemDepth: An International Standard for Reliable Chemical Depth Profiling of Organic Materials}, keywords = {ISO, standard, SIMS, sputtering, yield volumes}, web_url = {https://doi.org/10.1002/sia.6686}, misc2 = {EMPIR 2015: Support for Impact}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421, 1096-9918}, DOI = {10.1002/sia.6686}, stag_bib_extends_levelofaccess = {NA}, author = {Shard, A.G. and Havelund, R. and Seah, M.P. and CLIFFORD, C.} } @Article { RedshawQPMIHGEDBSRY2019, subid = {1232}, title = {Direct determination of the La138\(\beta\)-decay Q value using Penning trap mass spectrometry}, journal = {Physical Review C}, year = {2019}, month = {7}, day = {11}, volume = {100}, number = {1}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {014308}, keywords = {138La, high-precision Q-values, mass spectrometry, Penning trap}, web_url = {https://arxiv.org/abs/1904.12076v2}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9985, 2469-9993}, DOI = {10.1103/PhysRevC.100.014308}, stag_bib_extends_levelofaccess = {NA}, author = {Sandler, R. and Bollen, G. and Dissanayake, J. and Eibach, M. and Gulyuz, K. and Hamaker, A. and Izzo, C. and Mougeot, X. and Puentes, D. and Quarati, F. G. A. and Redshaw, M. and Ringle, R. and Yandow, I.} } @Article { ImbraguglioDSMG2019, subid = {1178}, title = {Determination of the thermodynamic temperature between 236 K and 430 K from speed of sound measurements in helium}, journal = {Metrologia}, year = {2019}, month = {7}, volume = {56}, number = {4}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {045006}, keywords = {Boltzmann constant, acoustic gas thermometry, primary thermometry, ITS-90}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab29a2}, stag_bib_extends_levelofaccess = {NA}, author = {Gavioso, R.M. and Madonna Ripa, D. and Steur, P.P.M. and Dematteis, R. and Imbraguglio, D} } @Article { SchmidtCOHBMLK2019, subid = {1340}, title = {A cryogenic radio-frequency ion trap for quantum logic spectroscopy of highly charged ions}, journal = {Review of Scientific Instruments}, year = {2019}, month = {7}, volume = {90}, number = {7}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {073201}, keywords = {Optical ClocksTrapped Ions}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5100594}, stag_bib_extends_levelofaccess = {NA}, author = {Leopold, T. and King, S. A. and Micke, P. and Bautista-Salvador, A. and Heip, J. C. and Ospelkaus, C. and Crespo L{\'o}pez-Urrutia, J. R. and Schmidt, P. O.} } @Article { SilanderHFZA2019, subid = {1542}, title = {Gas equilibration gas modulation refractometry for assessment of pressure with sub-ppm precision}, journal = {Journal of Vacuum Science \& Technology B}, year = {2019}, month = {7}, volume = {37}, number = {4}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {042901}, keywords = {Gas equilibration gas modulation refractometry for assessment of pressure with sub-ppm precision}, misc2 = {EMPIR 2014: Industry}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/1.5090860}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Hausmaninger, T. and Forss{\'e}n, C. and Zelan, M. and Axner, O.} } @Article { StollWerianFRNKP2019, subid = {1563}, title = {Absolute isotope ratios – Analytical solution for the determination of calibration factors for any number of isotopes and isotopologues}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2019}, month = {7}, volume = {157}, number2 = {16ENV06: SIRS: Metrology for stable isotope reference standards}, pages = {76-83}, keywords = {Mass bias correction, Absolute isotope ratio, SI traceability, Metrology, Isotopic composition}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2019.04.008}, stag_bib_extends_levelofaccess = {NA}, author = {Stoll-Werian, Anne and Flierl, Lukas and Rienitz, Olaf and Noordmann, Janine and Kessel, R{\"u}diger and Pramann, Axel} } @Article { GaviosoMSDI2019, subid = {2646}, title = {Determination of the thermodynamic temperature between 236 K and 430 K from speed of sound measurements in helium}, journal = {Metrologia}, year = {2019}, month = {7}, volume = {56}, number = {4}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {045006}, keywords = {primary thermometry, acoustic gas thermometry, ITS-90}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab29a2}, stag_bib_extends_levelofaccess = {NA}, author = {Gavioso, R.M. and Madonna Ripa, D. and Steur, P.P.M. and Dematteis, R. and Imbraguglio, D.} } @Article { BrinkmannMSBLI2019, subid = {1322}, title = {3D nonrigid motion correction for quantitative assessment of hepatic lesions in DCE‐MRI}, journal = {Magnetic Resonance in Medicine}, year = {2019}, month = {6}, day = {22}, volume = {82}, number = {5}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, pages = {1753-1766}, keywords = {quantification, nonrigid motion correction, hepatic lesions, DCE-MRI}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.27867}, stag_bib_extends_levelofaccess = {NA}, author = {Ippoliti, M. and Lukas, M. and Brenner, W. and Schaeffter, T. and Makowski, M. R. and Kolbitsch, C.} } @Proceedings { KrokerWSDKB2019, subid = {1281}, title = {Mueller matrix ellipsometry for enhanced optical form metrology of sub-lambda structures}, journal = {Modeling Aspects in Optical Metrology VII}, year = {2019}, month = {6}, day = {21}, volume = {11057}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {155-165}, keywords = {Plasmonics, Ellipsometry, Scanning electron microscopy, Numerical simulations, Metrology, Nanostructures, Near field optics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {SPIE}, event_place = {Munich}, event_name = {International Society for Optics and Photonics Optical Metrology}, event_date = {24-06-2019 to 27-06-2019}, language = {30}, DOI = {10.1117/12.2527419}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}seberg, T. and Dickmann, J. and Siefke, T. and Wurm, M. and Kroker, S. and Bodermann, B.} } @Proceedings { MontavonPS2019, subid = {1387}, title = {Model-based interfacing of large-scale metrology instruments}, journal = {Multimodal Sensing: Technologies and Applications}, year = {2019}, month = {6}, day = {21}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, keywords = {Large-Scale Metrology, Internet of Production, Cyper Physical Production Systems}, web_url = {http://arxiv.org/abs/2001.05897}, misc2 = {EMPIR 2017: Industry}, publisher = {SPIE}, event_place = {Munich}, event_name = {SPIE Optical Metrology}, event_date = {24-06-2019 to 28-06-2019}, language = {30}, DOI = {10.1117/12.2527461}, stag_bib_extends_levelofaccess = {NA}, author = {Montavon, B. and Peterek, M. and Schmitt, R.H.} } @Article { HannNFSTK2019, subid = {1196}, title = {FI-ICP-TOFMS for quantification of biologically essential trace elements in cerebrospinal fluid – high-throughput at low sample volume}, journal = {The Analyst}, year = {2019}, month = {6}, day = {11}, volume = {144}, number = {15}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {4653-4660}, keywords = {cerebrospinal fluid, FI-ICP-TOFMS, quantification of biologically essential trace elements}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2019/AN/C9AN00039A\#!divAbstract}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0003-2654, 1364-5528}, DOI = {10.1039/C9AN00039A}, stag_bib_extends_levelofaccess = {NA}, author = {Theiner, S. and Schoeberl, A. and Fischer, L. and Neumayer, S. and Hann, S. and Koellensperger, G.} } @Article { BeckerGKDS2019, subid = {1104}, title = {Electrometer Calibration With Sub-Part-Per-Million Uncertainty}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {1887-1894}, keywords = {Ammeters, calibration, current measurement, measurement standards, measurement uncertainty, precisionmeasurements}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2019.2900129}, stag_bib_extends_levelofaccess = {NA}, author = {Scherer, H. and Drung, D. and Krause, C. and G{\"o}tz, M. and Becker, U.} } @Article { SchererGDG2019, subid = {1109}, title = {Interlaboratory Nanoamp Current Comparison With Subpart-Per-Million Uncertainty}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {1996-2002}, keywords = {Small current measurements, high resistance measurements, interlab comparisons, ULCA, electrical transfer standards, transimpedance amplifiers}, web_url = {https://arxiv.org/abs/1808.09741}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2879126}, stag_bib_extends_levelofaccess = {NA}, author = {Giblin, S.P. and Drung, D. and G{\"o}tz, M. and Scherer, H.} } @Article { TeodoroFBS2019, subid = {1265}, title = {3D-Simulation of a Bayard Alpert ionisation gauge using SIMION program}, journal = {Vacuum}, year = {2019}, month = {6}, volume = {164}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {300-307}, keywords = {Vacuum measurementIonisation gaugeSimulationGauge sensitivity}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2019.03.039}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, R. and Bundaleski, N. and Fonseca, A.L. and Teodoro, O.} } @Article { KorpelainenBDS2019, subid = {1297}, title = {Tip wear and tip breakage in high-speed atomic force microscopes}, journal = {Ultramicroscopy}, year = {2019}, month = {6}, volume = {201}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {28-37}, keywords = {Atomic force microscopy (AFM), High-speed AFM, Tip wear, Tip breakage, Tip characterization, Tip-sample interaction}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2019.03.013}, stag_bib_extends_levelofaccess = {NA}, author = {Strahlendorff, T. and Dai, G. and Bergmann, D. and Tutsch, R.} } @Article { UrsinTSFC2019, subid = {1349}, title = {Hong-Ou-Mandel interferometry on a biphoton beat note}, journal = {npj Quantum Information}, year = {2019}, month = {5}, day = {24}, volume = {5}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {quantum metrology, Hong-Ou-Mandel}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2056-6387}, DOI = {10.1038/s41534-019-0161-z}, stag_bib_extends_levelofaccess = {NA}, author = {Chen, Y. and Fink, M. and Steinlechner, F. and Torres, J.P. and Ursin, R.} } @Article { MainzBGWSZW2019, subid = {1206}, title = {Photon flux determination of a liquid-metal jet X-ray source by means of photon scattering}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2019}, month = {5}, day = {23}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, keywords = {Liquid-metal jet, X-ray sources, photon flux determination, elastic and inelastic photon scattering}, web_url = {https://arxiv.org/abs/1903.06024}, misc2 = {EMPIR 2016: Energy}, language = {30}, DOI = {10.1039/C9JA00127A}, stag_bib_extends_levelofaccess = {NA}, author = {Wansleben, M. and Zech, C. and Streeck, C. and Weser, J. and Genzel, C. and Beckhoff, B. and Mainz, R.} } @Article { OliveroBOFCJGSPBFHBER2019, subid = {1261}, title = {Quantum Micro–Nano Devices Fabricated in Diamond by Femtosecond Laser and Ion Irradiation}, journal = {Advanced Quantum Technologies}, year = {2019}, month = {5}, day = {20}, volume = {2}, number = {5-6}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1900006}, keywords = {diamond, ion‐beam irradiation, nitrogen vacancies ,NV magnetometry, quantum sensing, ultrafast laser writing}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {2511-9044, 2511-9044}, DOI = {10.1002/qute.201900006}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/2318/1704485}, author = {Eaton, S.M. and Hadden, J.P. and Bharadwaj, V. and Forneris, J. and Picollo, F. and Bosia, F. and Sotillo, B. and Giakoumaki, A.N. and Jedrkiewicz, O. and Chiappini, A. and Ferrari, M. and Osellame, R. and Barclay, P.E. and Olivero, P. and Ramponi, R.} } @Article { HohlsKGHKW2019, subid = {1126}, title = {Quantum dot state initialization by control of tunneling rates}, journal = {Physical Review B}, year = {2019}, month = {5}, day = {20}, volume = {99}, number = {20}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {201409(R)}, keywords = {quantum dot, single-electron, quantum state, electron quantum optics}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/physrevb.99.201409}, stag_bib_extends_levelofaccess = {NA}, author = {Wenz, T. and Klochan, J. and Hohls, F. and Gerster, T. and Kashcheyevs, V. and Schumacher, H. W.} } @Article { , title = {Universal Equation for Argon Gas Cluster Sputtering Yields}, journal = {Journal of Physical Chemistry C}, year = {2019}, month = {5}, day = {13}, volume = {117}, number = {(24),}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {pp 12622–12632}, keywords = {gold, Irganox1010, OLED, polymers, silicon, silicon dioxide.}, web_url = {http://pubs.acs.org/doi/abs/10.1021/jp402684c}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ACS Publications}, address = {Washington DC}, language = {30}, ISSN = {1932-7447}, DOI = {10.1021/jp402684c}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-5-29}, author = {Seah, M.P} } @Article { SkalnikSLZ2019, title = {Mathematical approach to evaluate involute gear profile and helix deviations without using special gear software}, journal = {Mechanism and Machine Theory}, year = {2019}, month = {5}, volume = {135}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {150-164}, keywords = {Coordinate measurementCylindrical gearProfile deviationHelix deviationGear measurement standardCAD model}, web_url = {https://www.sciencedirect.com/science/article/pii/S0094114X18306323?via\%3Dihub}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0094-114X}, DOI = {10.1016/j.mechmachtheory.2019.01.030}, stag_bib_extends_levelofaccess = {NA}, author = {Skaln{\'i}k, P. and S{\'y}kora, J. and Linkeov{\'a}, I. and Zelen{\'y}, V.} } @Article { HeinrichPSDKFA2019, subid = {1067}, title = {Influence of Microwave Probes on Calibrated On-Wafer Measurements}, journal = {IEEE Transactions on Microwave Theory and Techniques}, year = {2019}, month = {5}, volume = {67}, number = {5}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1892-1900}, keywords = {Calibration, coplanar waveguide, electromagnetic field simulation, multiline-thru-reflect-line, on-wafer probing, probes}, web_url = {https://www.fbh-berlin.de/fileadmin/downloads/Publications/2019/FINAL_VERSION_repository.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9480, 1557-9670}, DOI = {10.1109/TMTT.2019.2903400}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Kahne, B. and Fritzsch, T. and Arz, U. and Heinrich, W.} } @Proceedings { SignorinoCLFGGL2019, subid = {1452}, title = {Phantom Power Generator for DC Railway Metrology}, journal = {2019 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2019}, month = {5}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {DC railway system, power and energy measurement, voltage and current transducer, stationary and dynamic metrological characterization}, web_url = {https://doi.org/10.5281/zenodo.3597387}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, event_place = {Auckland (New Zeland)}, event_name = {2019 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {20-05-2019 to 23-05-2019}, language = {30}, DOI = {10.1109/I2MTC.2019.8826995}, stag_bib_extends_levelofaccess = {NA}, author = {Signorino, D. and Crotti, G. and Delle Femine, A. and Gallo, D. and Giordano, D. and Landi, C. and Luiso, M.} } @Proceedings { SchulerREL2019, subid = {1247}, title = {Zur Bestimmung des ILRS-Referenzpunktes am Satellite Observing System Wettzell}, journal = {Photogrammetrie - Laserscanning - Optische 3D-Messtechnik}, year = {2019}, month = {4}, day = {30}, volume = {2019}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {162-175}, keywords = {geometric reference points, VLBI, SLR, ILRS, geodesy, satellite, local tie vectors}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Wichmann Verlag}, event_place = {Oldenburg}, event_name = {18. Oldenburger 3D-Tage 2019}, event_date = {06-02-2019 to 07-02-2019}, language = {43}, ISBN = {978-3-87907-660-4}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3515831}, author = {Sch{\"u}ler, T. and Riepl, S. and Eschelbach, C. and L{\"o}sler, M.} } @Manual { SchmucklePASHL2019, subid = {1084}, title = {Guidelines for the design of calibration substrates, including the suppression of parasitic modes for frequencies up to and including 325 GHz}, year = {2019}, month = {4}, day = {24}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Calibration, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), on-wafer probing, probes}, web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424A}, misc2 = {EMPIR 2014: Industry}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, language = {30}, DOI = {10.7795/530.20190424A}, stag_bib_extends_levelofaccess = {NA}, author = {Schmuckle, F.J. and Phung, G.N. and Arz, U. and Spirito, M. and Heinrich, W. and Lozar, R.} } @Manual { HaddadiDLHGLHPZWHMSRKPASC2019, subid = {1085}, title = {Best Practice Guide for Planar S-Parameter Measurements using Vector Network Analysers}, year = {2019}, month = {4}, day = {24}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), microwave probes, extreme impedance measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise, vector network analyzer (VNA)}, web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424B}, misc2 = {EMPIR 2014: Industry}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, language = {30}, DOI = {10.7795/530.20190424B}, stag_bib_extends_levelofaccess = {NA}, author = {Haddadi, K. and Dambrine, G. and Lozar, R. and Helmreich, K. and Gold, G. and Lomakin, K. and Heinrich, W. and Phung, G.N. and Zeier, M. and Wollensack, M. and Hoffmann, J. and Mubarak, F. and Shang, X. and Ridler, N. and Kuhlmann, K. and Probst, T. and Arz, U. and Spirito, M. and Clarke, R.} } @Article { WiekhorstSPLW2019, subid = {941}, title = {Probing particle-matrix interactions during magnetic particle spectroscopy}, journal = {Journal of Magnetism and Magnetic Materials}, year = {2019}, month = {4}, volume = {475}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {421-428}, keywords = {magnetic hyperthermia, magnetic nanoparticles}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-8853}, DOI = {10.1016/j.jmmm.2018.11.109}, stag_bib_extends_levelofaccess = {NA}, author = {Wells, J. and L{\"o}wa, N. and Paysen, H. and Steinhoff, U. and Wiekhorst, F.} } @Article { BergstenSSM2019, subid = {1076}, title = {Four-Terminal Pair Digital Sampling Impedance Bridge up to 1MHz}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {4}, volume = {68}, number = {6}, number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements}, pages = {1860 - 1869}, keywords = {Bridge circuits, Impedance, Topology, Uncertainty, Standards, Calibration, Multiplexing, impedance measurement, phase comparators, sampling methods, shunts (electrical)}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2019.2908649}, stag_bib_extends_levelofaccess = {NA}, author = {Maslan, S. and Š{\'i}ra, M. and Skalicka, T. and Bergsten, T.} } @Article { XuLLALAGMWTLATSPDA2019, subid = {1116}, title = {High-precision methanol spectroscopy with a widely tunable SI-traceable frequency-comb-based mid-infrared QCL}, journal = {Optica}, year = {2019}, month = {4}, volume = {6}, number = {4}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {411}, keywords = {Diode lasers; Laser beams; Laser sources; Optical components; Saturation spectroscopy; Tunable lasers;}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.6.000411}, stag_bib_extends_levelofaccess = {NA}, author = {Santagata, R. and Tran, D.B.A. and Argence, B. and Lopez, O. and Tokunaga, S.K. and Wiotte, F. and Mouhamad, H. and Goncharov, A. and Abgrall, M. and Le Coq, Y. and Alvarez-Martinez, H. and Le Targat, R. and Lee, W.K. and Xu, D. and Pottie, P.E. and Darqui{\'e}, B. and Amy-Klein, A.} } @Article { DarquieSPXATAWTLMAGLLAL2019, subid = {1116}, title = {High-precision methanol spectroscopy with a widely tunable SI-traceable frequency-comb-based mid-infrared QCL}, journal = {Optica}, year = {2019}, month = {4}, volume = {6}, number = {4}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {411}, keywords = {optical Fiber, optical frequency transfer}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.6.000411}, stag_bib_extends_levelofaccess = {NA}, author = {Santagata, R. and Tran, D.B.A. and Argence, B. and Lopez, O. and Tokunaga, S.K. and Wiotte, F. and Mouhamad, H. and Goncharov, A. and Abgrall, M. and Le Coq, Y. and Alvarez-Martinez, H. and Le Targat, R. and Lee, W.K. and Xu, D. and Pottie, P.E. and Darqui{\'e}, B. and Amy-Klein, A.} } @Article { BuechelerTSALWCW2019, subid = {1241}, title = {Time-resolved photoluminescence on double graded Cu(In,Ga)Se2 – Impact of front surface recombination and its temperature dependence}, journal = {Science and Technology of Advanced Materials}, year = {2019}, month = {4}, volume = {20}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {313-323}, keywords = {time-resolved photoluminescence}, misc2 = {EMPIR 2016: Energy}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1468-6996, 1878-5514}, DOI = {10.1080/14686996.2019.1586583}, stag_bib_extends_levelofaccess = {NA}, author = {Weiss, T.P. and Carron, R. and Wolter, M.H. and L{\"o}ckinger, J. and Avancini, E. and Siebentritt, S. and Buecheler, S. and Tiwari, A.N.} } @Article { RosendahlBBKSKS2019, subid = {1550}, title = {CT beam dosimetric characterization procedure for personalized dosimetry}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {3}, day = {29}, volume = {64}, number = {7}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, pages = {075009}, keywords = {CT beam dosimetric characterization procedure for personalized dosimetry}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab0e97}, stag_bib_extends_levelofaccess = {NA}, author = {Rosendahl, S. and B{\"u}ermann, L. and Borowski, M. and Kortesniemi, M. and Sundell, V-M. and Kosunen, A. and Siiskonen, T.} } @Article { KoellenspergerNST2019, subid = {1195}, title = {FI-ICP-TOFMS for high-throughput and low volume multi-element analysis in environmental and biological matrices}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2019}, month = {3}, day = {28}, volume = {34}, number = {6}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {1272-1278}, keywords = {low volume multi-element analysis, FI-ICP-TOFMS, analysis in environmental and biological matrices}, web_url = {https://pubs.rsc.org/en/Content/ArticleLanding/2019/JA/C9JA00022D\#!divAbstract}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/C9JA00022D}, stag_bib_extends_levelofaccess = {NA}, author = {Theiner, S. and Schoeberl, A. and Neumayer, S. and Koellensperger, G.} } @Article { MeesSF2019, subid = {1026}, title = {Traceability of form measurements of freeform surfaces: metrological reference surfaces}, journal = {Optical Engineering}, year = {2019}, month = {3}, day = {26}, volume = {58}, number = {9}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {092602-1-7}, keywords = {metrology; freeform; reference artifact; traceability; interferometry; measurement comparison}, misc2 = {EMPIR 2015: SI Broader Scope}, language = {30}, DOI = {10.1117/1.OE.58.9.092602}, stag_bib_extends_levelofaccess = {NA}, author = {Fortmeier, I. and Schulz, M. and Mee{\ss}, R.} } @Proceedings { BurgerZHS2019, subid = {1217}, title = {Using Gaussian process regression for efficient parameter reconstruction}, journal = {Metrology, Inspection, and Process Control for Microlithography XXXIII}, year = {2019}, month = {3}, day = {26}, volume = {10959}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1095911}, keywords = {computational metrology, optical metrology, computational lithography, Bayesian optimization,machine learning, finite-element methods, nanooptics}, web_url = {https://arxiv.org/abs/1903.12128}, misc2 = {EMPIR 2017: Fundamental}, publisher = {SPIE}, event_place = {San Jose, USA}, event_name = {Metrology, Inspection, and Process Control for Microlithography XXXIII}, event_date = {24-02-2019 to 28-02-2019}, language = {30}, DOI = {10.1117/12.2513268}, stag_bib_extends_levelofaccess = {NA}, author = {Schneider, P-I. and Hammerschmidt, M. and Zschiedrich, L. and Burger, S.} } @Article { MinelliBPRUSSGS2019, subid = {1543}, title = {Sticky Measurement Problem: Number Concentration of Agglomerated Nanoparticles}, journal = {Langmuir}, year = {2019}, month = {3}, day = {14}, volume = {35}, number = {14}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {4927-4935}, keywords = {Sticky Measurement Problem: Number Concentration of Agglomerated Nanoparticles}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0743-7463, 1520-5827}, DOI = {10.1021/acs.langmuir.8b04209}, stag_bib_extends_levelofaccess = {NA}, author = {Minelli, C. and Bartczak, D. and Peters, R. and Rissler, J. and Undas, A. and Sikora, A. and Sj{\"o}str{\"o}m, E. and Goenaga-Infante, H. and Shard, A.G.} } @Article { BraunBRSB2019, subid = {1033}, title = {Measurement and Analysis of PMU Reporting Latency for Smart Grid Protection and Control Applications}, journal = {IEEE Access}, year = {2019}, month = {3}, day = {12}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-1}, keywords = {Phasor measurement units, Ethernet, Hardware, Real-time systems, Synchronization, Task analysis}, misc2 = {EMPIR 2017: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2169-3536}, DOI = {10.1109/ACCESS.2019.2903929}, stag_bib_extends_levelofaccess = {NA}, author = {Blair, S.M. and Syed, M.H. and Roscoe, A.J. and Burt, G.M. and Braun, J.P.} } @Article { KurlyandskayaSCMBACT2019, subid = {944}, title = {Specific loss power measurements by calorimetric and thermal methods on \(\gamma\)-Fe2O3 nanoparticles for magnetic hyperthermia}, journal = {Journal of Magnetism and Magnetic Materials}, year = {2019}, month = {3}, volume = {473}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {403-409}, keywords = {Magnetic hyperthermia, Fe-oxide, Magnetic nanoparticles}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-8853}, DOI = {10.1016/j.jmmm.2018.10.107}, stag_bib_extends_levelofaccess = {NA}, author = {Co{\"i}sson, M. and Barrera, G. and Appino, C. and Celegato, F. and Martino, L. and Safronov, A.P. and Kurlyandskaya, G.V. and Tiberto, P.} } @Article { SafronovaPTLSHP2019, subid = {1051}, title = {Optical clock comparison for Lorentz symmetry testing}, journal = {Nature}, year = {2019}, month = {3}, volume = {567}, number = {7747}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {204-208}, keywords = {optical clock, Lorentz symmetry violation, ytterbium, ion trap}, web_url = {https://arxiv.org/abs/1809.10742\#}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0028-0836, 1476-4687}, DOI = {10.1038/s41586-019-0972-2}, stag_bib_extends_levelofaccess = {NA}, author = {Sanner, C. and Huntemann, N. and Lange, R. and Tamm, C. and Peik, E. and Safronova, M.S. and Porsev, S.G.} } @Proceedings { SchulzFDSPH2019, subid = {1064}, title = {Crosstalk Effects of Differential Thin-Film Microstrip Lines in Multilayer Motherboards}, journal = {2019 12th German Microwave Conference (GeMiC)}, year = {2019}, month = {3}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {178-181}, keywords = {crosstalk effects, discontinuities, microstrip}, web_url = {https://www.fbh-berlin.com/fileadmin/downloads/Publications/2019/2019_02_20_GeMiC_GNP_repository.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, event_place = {Stuttgart}, event_name = {2019 12th German Microwave Conference (GeMiC)}, event_date = {25-03-2019 to 27-03-2019}, language = {30}, DOI = {10.23919/GEMIC.2019.8698163}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G. N. and Schmuckle, F. J. and Doerner, R. and Fritzsch, T. and Schulz, S. and Heinrich, W.} } @Article { PitreLHHCSPCGLZ2019, subid = {1167}, title = {A high-stability quasi-spherical resonator in SPRIGT for microwave frequency measurements at low temperatures}, journal = {Science Bulletin}, year = {2019}, month = {3}, volume = {64}, number = {5}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {286-288}, keywords = {Refractive Index, Primary Thermometry, resonance frequencies}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2095-9273}, DOI = {10.1016/j.scib.2019.01.018}, stag_bib_extends_levelofaccess = {NA}, author = {Zhang, H. and Liu, W. and Gao, B. and Chen, Y. and Chen, H. and Pan, C. and Song, Y. and Han, D. and Hu, J. and Luo, E. and Pitre, L.} } @Article { GessnerSP2019, subid = {1917}, title = {Metrological Nonlinear Squeezing Parameter}, journal = {Physical Review Letters}, year = {2019}, month = {3}, volume = {122}, number = {9}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {squeezing, complex quantum states}, web_url = {https://arxiv.org/pdf/1811.12443.pdf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.122.090503}, stag_bib_extends_levelofaccess = {NA}, author = {Gessner, M. and Smerzi, A. and Pezz{\`e}, L.} } @Article { SchulzFSSE2019, subid = {1027}, title = {SimOptDevice: a library for virtual optical experiments}, journal = {Journal of Sensors and Sensor Systems}, year = {2019}, month = {2}, day = {27}, volume = {8}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {105 - 110}, keywords = {SimOptDevice, opto-mechanical virtual experiments,}, web_url = {https://www.j-sens-sens-syst.net/8/105/2019/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Copernicus Publications}, language = {30}, DOI = {10.5194/jsss-8-105-2019}, stag_bib_extends_levelofaccess = {NA}, author = {Schachtschneider, R. and Stavridis, M. and Fortmeier, I. and Schulz, M. and Elster, C.} } @Article { PezzeSGS2019, subid = {1091}, title = {Fast and optimal generation of entanglement in bosonic Josephson junctions}, journal = {Physical Review A}, year = {2019}, month = {2}, day = {25}, volume = {99}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {Entanglement, Bose Einstein condensate,}, web_url = {https://arxiv.org/abs/1511.01835}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, DOI = {10.1103/PhysRevA.99.022329}, stag_bib_extends_levelofaccess = {NA}, author = {Sorelli, G. and Gessner, M. and Smerzi, A. and Pezz{\`e}, L.} } @Article { SorelliGSP2019, subid = {2726}, title = {Fast and optimal generation of entanglement in bosonic Josephson junctions}, journal = {Physical Review A}, year = {2019}, month = {2}, day = {25}, volume = {99}, number = {2}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {entanlement, Josephson junctions, BEC}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1511.01835}, author = {Sorelli, G. and Gessner, M. and Smerzi, A. and Pezz{\`e}, L.} } @Inbook { SanderTK2019, subid = {1131}, title = {Optically Pumped Magnetometers for MEG}, year = {2019}, month = {2}, day = {21}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {1-12}, keywords = {Optically pumped magnetometer, Magnetoencephalography, Superconducting quantum interference device, Magnetocardiography, Multichannel, Electron spin resonance, Microelectromechanical system, Alkali-metal vapor cell, Atomic magnetometer, Optical magnetometer}, misc2 = {EMPIR 2015: Health}, publisher = {Springer International Publishing}, booktitle = {Magnetoencephalography}, language = {30}, ISBN = {978-3-319-62657-4}, DOI = {10.1007/978-3-319-62657-4_49-1}, stag_bib_extends_levelofaccess = {NA}, author = {Knappe, S. and Sander, T. and Trahms, L.} } @Article { BurgerRRHS2019, subid = {1520}, title = {Numerical Investigation of Light Emission from Quantum Dots Embedded into On‐Chip, Low‐Index‐Contrast Optical Waveguides}, journal = {physica status solidi (b)}, year = {2019}, month = {2}, day = {15}, volume = {256}, number = {7}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1800437}, keywords = {single photon emitters, coherent light matter interaction, numerical simulations, finite element methods}, web_url = {https://arxiv.org/abs/2006.10466}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {0370-1972, 1521-3951}, DOI = {10.1002/pssb.201800437}, stag_bib_extends_levelofaccess = {NA}, author = {Hoehne, T. and Schnauber, P. and Rodt, S. and Reitzenstein, S. and Burger, S.} } @Article { MendezSBCKSD2019, subid = {1021}, title = {Characterization of an analog-to-digital converter frequency response by a Josephson arbitrary waveform synthesizer}, journal = {Measurement Science and Technology}, year = {2019}, month = {2}, day = {11}, volume = {30}, number = {3}, number2 = {15RPT04: TracePQM: Traceability routes for electrical power quality measurements}, pages = {035006}, keywords = {quantum standard, digital converter, Josephson arbitrary waveform synthesizer, programmable Josephson voltage standard, Monte Carlo method, Sine fitting algorithms, artificial neural network (ANN)}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6501/aafb27/meta}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aafb27}, stag_bib_extends_levelofaccess = {NA}, author = {Diaz de Aguilar, J. and Salinas, J.R. and Kieler, O. and Caballero, R. and Behr, R. and Sanmamed, Y.A. and M{\'e}ndez, A.} } @Article { KargerSM2019, subid = {1044}, title = {Absolute dosimetry with polymer gels—a TLD reference system}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {2}, day = {11}, volume = {64}, number = {4}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {045010}, keywords = {radiation dosimeters, absolute dosimetry, 3D dosimetry, polymer gel, thermoluminescence dosimetry, TLD}, web_url = {https://doi.org/10.1088/1361-6560/aafd41}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aafd41}, stag_bib_extends_levelofaccess = {NA}, author = {Mann, P. and Schwahofer, A. and Karger, C.P.} } @Article { SiasDPDD2019, subid = {998}, title = {A compact radiofrequency drive based on interdependent resonant circuits for precise control of ion traps}, journal = {Review of Scientific Instruments}, year = {2019}, month = {2}, volume = {90}, number = {2}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {023201}, keywords = {RF drive, Resonant circuits}, web_url = {https://arxiv.org/abs/1812.02018}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5063305}, stag_bib_extends_levelofaccess = {NA}, author = {Detti, A. and De Pas, M. and Duca, L. and Perego, E. and Sias, C.} } @Article { DittmannFHGBHKWPSDM2019, subid = {1001}, title = {Results of four European round-robins on short-circuit current temperature coefficient measurements of photovoltaic devices of different size}, journal = {Solar Energy}, year = {2019}, month = {2}, volume = {179}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {424-436}, keywords = {Photovoltaics, Short-circuit current temperature coefficient intercomparisons, Spectral temperature coefficients, Bare cells to full-size modules}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2018.10.051}, stag_bib_extends_levelofaccess = {NA}, author = {Salis, E. and Pavanello, D. and Kr{\"o}ger, I. and Winter, S. and Bothe, K. and Hinken, D. and Gandy, T. and Hohl-Ebinger, J. and Friesen, G. and Dittmann, S. and Dubard, J. and M{\"u}llejans, H.} } @Article { SchumacherS2019, subid = {1107}, title = {Single-Electron Pumps and Quantum Current Metrology in the Revised SI}, journal = {Annalen der Physik}, year = {2019}, month = {1}, day = {30}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {1800371}, keywords = {electrical metrology, low current measurements, quantum metrological triangle, SI units, single-electron pumps}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Wiley-VCH}, language = {30}, DOI = {10.1002/andp.201800371}, stag_bib_extends_levelofaccess = {NA}, author = {Scherer, H. and Schumacher, H.W.} } @Article { HarrisDBSKDS2019, subid = {1160}, title = {Children With Cystic Fibrosis Are Infected With Multiple Subpopulations of Mycobacterium abscessus With Different Antimicrobial Resistance Profiles}, journal = {Clinical Infectious Diseases}, year = {2019}, month = {1}, day = {26}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, keywords = {lung transplant, whole-genome sequencing, within-patient diversity, macrolides, physiological niches}, misc2 = {EMPIR 2015: Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {1058-4838, 1537-6591}, DOI = {10.1093/cid/ciz069}, stag_bib_extends_levelofaccess = {NA}, author = {Shaw, L.P. and Doyle, R.M. and Kavaliunaite, E. and Spencer, H. and Balloux, F. and Dixon, G. and Harris, K.A.} } @Article { KochKBWHBISIK2019, title = {Does airborne ultrasound lead to activation of the auditory cortex?}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2019}, month = {1}, day = {18}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, keywords = {airborne ultrasound; brain imaging; hearingthreshold}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {1862-278X, 0013-5585}, DOI = {10.1515/bmt-2018-0048}, stag_bib_extends_levelofaccess = {NA}, author = {Koch, C. and K{\"u}hler, R. and Bauer, M. and Weichenberger, M. and Hensel, J. and Br{\"u}hl, R. and Ihlenfeld, A. and Sander, T. and Ittermann, B. and K{\"u}hn, S.} } @Proceedings { SavinA2019, subid = {977}, title = {On-Wafer Residual Error Correction Through Adaptive Filtering of Verification Line Measurements}, journal = {2018 International Workshop on Computing, Electromagnetics, and Machine Intelligence (CEMi)}, year = {2019}, month = {1}, day = {14}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {79-80}, keywords = {uncertainty,calibration,standards,measurement uncertainty,coplanar waveguides,scattering, parameters,microwave measurement}, web_url = {https://doi.org/10.1109/CEMI.2018.8610566}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Stellenbosch, South Africa}, event_name = {2018 International Workshop on Computing, Electromagnetics, and Machine Intelligence (CEMi)}, event_date = {21-11-2018 to 24-11-2018}, language = {30}, ISBN = {978-1-5386-7845-9}, DOI = {10.7795/EMPIR.14IND02.CA.20190403F}, stag_bib_extends_levelofaccess = {NA}, author = {Savin, A. and Arz, U.} } @Article { SchererGDK2019, subid = {1106}, title = {Noise-optimized ultrastable low-noise current amplifier}, journal = {Review of Scientific Instruments}, year = {2019}, month = {1}, day = {11}, volume = {90}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {014706}, keywords = {Transimpedance amplifier, noise, metrology}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.5078572}, stag_bib_extends_levelofaccess = {NA}, author = {Krause, C. and Drung, D. and G{\"o}tz, M. and Scherer, H.} } @Article { HashadEJS2019, subid = {805}, title = {Characterization of a force-balanced piston gauge as a primary pressure standard}, journal = {Measurement}, year = {2019}, month = {1}, volume = {131}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {723-729}, keywords = {Primary pressure standard, Effective area, FPG characterization, Rarefied gas flow,}, web_url = {https://www.sciencedirect.com/science/article/pii/S0263224118308443}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2018.09.016}, stag_bib_extends_levelofaccess = {NA}, author = {Hashad, A.S. and Ehlers, S. and Jusko, O. and Sabuga, W.} } @Article { SampleCL2019, subid = {972}, title = {Electrical performance of bifacial silicon PV modules under different indoor mounting configurations affecting the rear reflected irradiance}, journal = {Solar Energy}, year = {2019}, month = {1}, volume = {177}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {471-482}, keywords = {Bifacial, PV performance, Silicon modules}, web_url = {https://ac.els-cdn.com/S0038092X18311514/1-s2.0-S0038092X18311514-main.pdf?_tid=b01e03f6-6af8-4d95-84c6-97f340a4e315\&acdnat=1548743260_0bede7742e05c52fb725fc5b521b678c}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2018.11.051}, stag_bib_extends_levelofaccess = {NA}, author = {Lopez-Garcia, J. and Casado, A. and Sample, T.} } @Article { PintoSP2019, subid = {1139}, title = {Calculation of kQ factors for Farmer-type ionization chambers following the recent recommendations on new key dosimetry data}, journal = {Physica Medica}, year = {2019}, month = {1}, volume = {57}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {221-230}, keywords = {kQ factors, Monte Carlo, Farmer Chambers, IAEA TRS398}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2018.12.006}, stag_bib_extends_levelofaccess = {NA}, author = {Pimpinella, M. and Silvi, L. and Pinto, M.} } @Article { ThevenotSDP2019, subid = {1143}, title = {The ampere and the electrical units in the quantum era}, journal = {Comptes Rendus Physique}, year = {2019}, month = {1}, volume = {20}, number = {1-2}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {92-128}, keywords = {Quantum electrical standards, Quantum hall devices, Small current traceability, Cryogenic Current Comparators, Quantum metrology triangle, SI redefinition, Ampere, base units, programmable quantum current generator, quantum calibrator}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Elsevier BV}, language = {30}, ISSN = {1631-0705}, DOI = {10.1016/j.crhy.2019.02.003}, stag_bib_extends_levelofaccess = {NA}, author = {Poirier, W. and Djordjevic, S. and Schopfer, F. and Thevenot, O.} } @Article { PlimmerLHCLGCSZCSP2019, subid = {1168}, title = {Thermal response characteristics of a SPRIGT primary thermometry system}, journal = {Cryogenics}, year = {2019}, month = {1}, volume = {97}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {1-6}, keywords = {Cryogenics, Cryogen-free cryostat, Pulse-tube cooler, Single-pressure refractive index gas thermometry, Thermal switch, Temperature, Metrology, Primary thermometry}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0011-2275}, DOI = {10.1016/j.cryogenics.2018.10.015}, stag_bib_extends_levelofaccess = {NA}, author = {Chen, H. and Chen, Y. and Zhang, H. and Song, Y. and Changzhao, P. and Gao, B. and Liu, W. and Han, D. and Luo, E. and Plimmer, M. and Sparasci, F. and Pitre, L.} } @Article { HimbertSPP2019, subid = {1179}, title = {Determinations of the Boltzmann constant}, journal = {Comptes Rendus Physique}, year = {2019}, month = {1}, volume = {20}, number = {1-2}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {129-139}, keywords = {Boltzmann constant, Primary thermometry, International System of Units (SI)}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {1631-0705}, DOI = {10.1016/j.crhy.2018.11.007}, stag_bib_extends_levelofaccess = {NA}, author = {Pitre, L. and Plimmer, M.D. and Sparasci, F. and Himbert, M.E.} } @Article { ThevenotSDP20190, subid = {1143}, title = {The ampere and the electrical units in the quantum era}, journal = {Comptes Rendus Physique}, year = {2019}, month = {1}, volume = {20}, number = {1-2}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {92-128}, keywords = {Quantum electrical standards, Quantum hall devices, Small current traceability, Cryogenic Current Comparators, Quantum metrology triangle, SI redefinition, Ampere, base units, programmable quantum current generator, quantum calibrator}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {1631-0705}, DOI = {10.1016/j.crhy.2019.02.003}, stag_bib_extends_levelofaccess = {NA}, author = {Poirier, W. and Djordjevic, S. and Schopfer, F. and Thevenot, O.} } @Techreport { Sutton2019, subid = {1209}, title = {The NPL Standard Flame: Operating Instructions}, journal = {NPL Report}, year = {2019}, month = {1}, volume = {N/A}, number = {N/A}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, keywords = {Flame thermometry, combustion thermometry, portable standard flame}, misc2 = {EMPIR 2017: Industry}, publisher = {NPL}, language = {30}, ISSN = {1754-2987}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://eprintspublications.npl.co.uk/8259/}, author = {Sutton, G.} } @Article { ElsterSCWKL2019, subid = {1324}, title = {Large-Scale Bayesian Spatial-Temporal Regression with Application to Cardiac MR-Perfusion Imaging}, journal = {SIAM Journal on Imaging Sciences}, year = {2019}, month = {1}, volume = {12}, number = {4}, number2 = {15HLT05: PerfusImaging: Metrology for multi-modality imaging of impaired tissue perfusion}, pages = {2035-2062}, keywords = {Bayesian spatial-temporal regression, cardiac MR, uncertainty quantification}, misc2 = {EMPIR 2015: Health}, publisher = {Society for Industrial \& Applied Mathematics (SIAM)}, language = {30}, ISSN = {1936-4954}, DOI = {10.1137/19M1246274}, stag_bib_extends_levelofaccess = {NA}, author = {Lehnert, J. and Kolbitsch, C. and W{\"u}bbeler, G. and Chiribiri, A. and Schaeffter, T. and Elster, C.} } @Article { HashadVVNS2019, subid = {1020}, title = {Computation of the effective area and associated uncertainties of non-rotating piston gauges FPG and FRS}, journal = {Metrologia}, year = {2019}, volume = {56}, number = {015004}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {1-10}, keywords = {primary pressure standard, effective area, rarefied gas dynamics, FPG and FRS characterization}, web_url = {https://doi.org/10.1088/1681-7575/aaee18}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {1681-7575/19/015004+10$33.00}, DOI = {10.1088/1681-7575/aaee18}, stag_bib_extends_levelofaccess = {NA}, author = {Naris, S. and Vasileiadis, N. and Valougeorgis, D. and Hashad, A.S. and Sabuga, W.} } @Article { SerazioPMZ2019, subid = {1071}, title = {1 kV Wideband Voltage Transducer, a Novel Method for Calibration and a Voltage Measurement Chain}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, volume = {Online}, number = {Early Acce}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-12}, keywords = {Voltage measurement, Calibration, Probes, Transducers, Measurement uncertainty}, web_url = {https://ieeexplore.ieee.org/abstract/document/8703141/authors\#authors}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, language = {30}, ISSN = {Print ISSN: 0018-9456 Electron}, DOI = {10.1109/TIM.2019.2912589}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Modarres, M. and Pogliano, U. and Serazio, D.} } @Inbook { PriceRBSW2019, subid = {1192}, title = {Standardisation of magnetic nanomaterials: Steps towards magnetic reference particles}, year = {2019}, volume = {PTB-Berich}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {200-208}, keywords = {standardisation, magnetic nanomaterials, reference materials,}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Fachverlag NW in Carl Ed. Sch{\"u}nemann KG}, address = {Bremen}, booktitle = {NanoWorkshop 2018: Workshop on Reference Nanomaterials}, language = {30}, ISBN = {978-3-95606-440-1}, ISSN = {0179-0609}, DOI = {10.7795/110.20190412}, stag_bib_extends_levelofaccess = {NA}, author = {Price, A. and R{\"u}ttinger, R. and Bleul, R. and Steinhoff, U. and Wiekhorst, F.} } @Article { VavassoriASCGPRCC2019, subid = {1307}, title = {Magnetic imaging using geometrically constrained nano-domain walls}, journal = {Nanoscale}, year = {2019}, volume = {11}, number = {10}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {4478-4488}, keywords = {MFM}, web_url = {https://pubs.rsc.org/en/content/articlelanding/2019/NR/C8NR07729K\#!divAbstract}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/C8NR07729K}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Corte-Le{\'o}n, H. and Rodr{\'i}guez, L A. and Pancaldi, M. and Gatel, C. and Cox, D. and Snoeck, E. and Antonov, V. and Vavassori, P.} } @Article { TorresSLU, subid = {1396}, title = {Temperature-Controlled Entangled-Photon Absorption Spectroscopy}, journal = {ArXiv quantum physics}, year = {2019}, volume = {arxiv1902.}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1-8}, keywords = {Spectroscopy, entangled photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Cornell University}, language = {1}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1901.02605}, author = {Torres, J. and Svozilik, J. and Leon-Montiels, R. and U'Ren, A.} } @Proceedings { SPINELLICTVDKWMDDD2019, subid = {1405}, title = {EURAMET EMPIR 18HLT06 RaCHy Project: Radiotherapy coupled with Hyperthermia (Induced by HITU)}, journal = {unavailable}, year = {2019}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {1032-1036}, keywords = {External beam radiotherapy, EBRT, HITU, Ultrasound, Hyperthermia}, web_url = {http://publications.rwth-aachen.de/record/767416}, misc2 = {EMPIR 2018: Health}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik}, event_place = {Aachen, Germany}, event_name = {23rd International Congress on Acoustics : integrating 4th EAA Euroregio}, event_date = {09-09-2019 to 13-09-2019}, language = {30}, ISBN = {978-3-939296-15-7}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.18154/RWTH-CONV-238838}, author = {SPINELLI, A. and CACCIA, B. and TER HAAR, G. and VAN RHOON, G. and de Pooter, J. and Karab{\"o}ce, B. and Wilkens, V. and MILORO, P. and Durando, G. and DENKOWA, A. and DIJKEMA, R.} } @Proceedings { SpasovaBNOSCTHZSAV2019, subid = {1490}, title = {A new EMPIR Project “MetForTC” for Developing Traceable Measurement Capabilities for Monitoring Thermocouple Performance}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, volume = {-}, number = {2019}, number2 = {18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance}, pages = {5/18006}, keywords = {EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple}, misc2 = {EMPIR 2018: Research Potential}, publisher = {EDP Sciences}, event_place = {Paris, France}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201918006}, stag_bib_extends_levelofaccess = {NA}, author = {Arifovic, N. and Sestan, D. and Zvizdić, D. and Hozic, N. and Turz{\'o}-Andr{\'a}s, E. and Čohodarević, S. and Strnad, R. and Opel, K. and Neagu, D. and Bordianu, C. and Spasova, S. and Vukičević, T.} } @Proceedings { SmithFAHP2019, subid = {1515}, title = {Risk calculations for conformity assessment in practice}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, number2 = {17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty}, keywords = {Conformity assessmentRiskCAsoftUncertainty}, tags = {MAT}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201916001}, stag_bib_extends_levelofaccess = {NA}, author = {Allard, A. and Fischer, N. and Smith, I. and Harris, P. and Pendrill, L.} } @Proceedings { GiordanoCRMGLFRSBD2019, subid = {1945}, title = {Pantograph-Catenary Arc Detection Technique based on Conducted Effects Measurement on Railway Supply System}, journal = {WCRR Papers}, year = {2019}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, keywords = {arc discharge; electric arc; Power quality; rail transportation system;}, misc2 = {EMPIR 2016: Energy}, event_place = {Tokyo, Japan}, event_name = {WORLD CONGRESS OF RAIL RESEARCH (WCRR), Tokyo, Japan, 28 October - 1 November 2019}, event_date = {28-10-2019 to 01-11-2019}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4587794}, author = {Giordano, D. and Crotti, G. and Roccato, P. and Mariscotti, A. and Gallo, D. and Luiso, M. and Filippini, N. and Rossetta, I. and Spalvieri, C. and Biancucci, A. and Domandio, L.} } @Proceedings { RojoS2019, subid = {2006}, title = {Preparation of hydrogen chloride in hydrogen standard gas mixtures for hydrogen purity requirements}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, keywords = {Hydrogen, HCl, purity}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {EDP Sciences}, event_place = {France}, event_name = {CIM 2019 19th INTERNATIONAL METROLOGY CONGRESS}, event_date = {01-09-2019 to 05-09-2019}, language = {30}, DOI = {10.1051/metrology/201920002}, stag_bib_extends_levelofaccess = {NA}, author = {Rojo, A. and Santamar{\'i}a, E.} } @Article { OraliS2019, subid = {2364}, title = {Simulation of Motion of Many Ions in a Linear Paul Trap}, journal = {International Journal of Modern Physics A}, year = {2019}, volume = {34}, number = {36}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {1942003}, keywords = {Linear ion traps, atomic clock, electric RF fields, simulation of electrostatic fields, finite element method, multipole field expansion, ion trajectories, particle tracing,Coulomb crystals}, web_url = {https://www.worldscientific.com/doi/abs/10.1142/S0217751X1942003X}, misc2 = {EMPIR 2017: Fundamental}, publisher = {World Scientific Publishing Company}, language = {30}, ISSN = {1793-656X}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2112.02203}, author = {Oral, M. and Č{\'i}p, O. and Slodička, L.} } @Article { SchererBKDG2018, subid = {1105}, title = {Calibrating Ultrastable Low-Noise Current Amplifiers of the Second Generation With a Cryogenic Current Comparator}, journal = {IEEE TRANSACTIONS ON INSTRUMENTATION AND MEASUREMENT}, year = {2018}, month = {12}, day = {21}, volume = {68}, number = {6}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {2027-2033}, keywords = {Calibration, current comparator, current measurement, low-noise amplifiers, measurement uncertainty.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2018.2884060}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}tz, M. and Drung, D. and Krause, C. and Becker, U. and Scherer, H.} } @Article { SchumacherPMWHMRFMGHU2018, subid = {1127}, title = {Robust formation of quantum dots in GaAs/AlGaAs heterostructures for single-electron metrology}, journal = {Metrologia}, year = {2018}, month = {12}, day = {21}, volume = {56}, number = {1}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {014002}, keywords = {quantum dot, single-electron, GaAs/AlGaAs, fabrication}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aaf4aa}, stag_bib_extends_levelofaccess = {NA}, author = {Gerster, T. and M{\"u}ller, A. and Freise, L. and Reifert, D. and Maradan, D. and Hinze, P. and Weimann, T. and Marx, H. and Pierz, K. and Schumacher, H.W. and Hohls, F. and Ubbelohde, N.} } @Article { SchioppoNMMLLIHCFBBBBAWSLWZZZ2018, subid = {958}, title = {New bounds on dark matter coupling from a global network of optical atomic clocks}, journal = {Science Advances}, year = {2018}, month = {12}, volume = {4}, number = {12}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {eaau4869}, keywords = {optical atomic clocks, sensor network, dark matter}, web_url = {http://advances.sciencemag.org/content/4/12/eaau4869.full}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Association for the Advancement of Science (AAAS)}, language = {30}, ISSN = {2375-2548}, DOI = {10.1126/sciadv.aau4869}, stag_bib_extends_levelofaccess = {NA}, author = {Wcisło, P. and Ablewski, P. and Beloy, K. and Bilicki, S. and Bober, M. and Brown, R. and Fasano, R. and Ciuryło, R. and Hachisu, H. and Ido, T. and Lodewyck, J. and Ludlow, A. and McGrew, W. and Morzyński, P. and Nicolodi, D. and Schioppo, M. and Sekido, M. and Le Targat, R. and Wolf, P. and Zhang, X. and Zjawin, B. and Zawada, M.} } @Article { MubarakRGMRS2018, subid = {984}, title = {Noise Behavior and Implementation of Interferometer-Based Broadband VNA}, journal = {IEEE Transactions on Microwave Theory and Techniques}, year = {2018}, month = {12}, volume = {67}, number = {1}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {249-260}, keywords = {extreme impedance measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise, vector network analyzer}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=8566175}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9480, 1557-9670}, DOI = {10.1109/TMTT.2018.2874667}, stag_bib_extends_levelofaccess = {NA}, author = {Mubarak, F.A. and Romano, R. and Galatro, L. and Mascolo, V. and Rietveld, G. and Spirito, M.} } @Article { CrespoLopezUrrutiaKSS2018, subid = {980}, title = {Highly charged ions: Optical clocks and applications in fundamental physics}, journal = {Reviews of Modern Physics}, year = {2018}, month = {12}, volume = {90}, number = {4}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {optical clocks}, web_url = {https://arxiv.org/abs/1803.06532}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {0034-6861, 1539-0756}, DOI = {10.1103/RevModPhys.90.045005}, stag_bib_extends_levelofaccess = {NA}, author = {Kozlov, M.G. and Safronova, M.S. and Crespo L{\'o}pez-Urrutia, J.R. and Schmidt, P. O.} } @Proceedings { FateevPDJAWSSHSLAS2018, subid = {1022}, title = {Development of measurement and calibration techniques for dynamic pressures and temperatures (DynPT): background and objectives of the 17IND07 DynPT project in the European Metrology Programme for Innovation and Research (EMPIR)}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {12}, volume = {1065}, number = {2018}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {162015}, keywords = {dynamic pressure, dynamic temperature, traceability, measurement standard, calibration method, calibration procedure, measurement uncertainty, validation, reliability, pressure measurement, temperature measurement}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, event_place = {Belfast}, event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/16/162015}, stag_bib_extends_levelofaccess = {NA}, author = {Saxholm, S. and Saxholm, S. and H{\"o}gstr{\"o}m, R. and Sarraf, C. and Sutton, G. and Wynands, R. and Arrh{\'e}n, F. and J{\"o}nsson, G. and Durgut, Y. and Peruzzi, A. and Fateev, A. and Liverts, M. and Adolfse, C.} } @Article { LuoLYHLSPZGCGHP2018, subid = {1170}, title = {Ultra-stable pressure is realized for Chinese single pressure refractive index gas thermometry in the range 30–90 kPa}, journal = {Science Bulletin}, year = {2018}, month = {12}, volume = {63}, number = {24}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {1601-1603}, keywords = {primary thermometry, low temperature, refractive index, microwave resonator}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2095-9273}, DOI = {10.1016/j.scib.2018.12.001}, stag_bib_extends_levelofaccess = {NA}, author = {Han, D. and Gao, B. and Chen, H. and Gambette, P. and Zhang, H. and Pan, C. and Song, Y. and Liu, W. and Liu, Y. and Hu, J. and Yu, B. and Luo, E. and Pitre, L.} } @Article { DorscherASBSSPOHHSL2018, subid = {1054}, title = {Towards an optical clock for space: Compact, high-performance optical lattice clock based on bosonic atoms}, journal = {Physical Review A}, year = {2018}, month = {11}, day = {29}, volume = {98}, number = {5}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {053443}, keywords = {optical clocks, optical lattice clock, isotope shift, clock comparisons}, web_url = {https://www.ptb.de/cms/fileadmin/internet/fachabteilungen/abteilung_4/4.3_quantenoptik_und_laengeneinheit/4.32/ori18.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.98.053443}, stag_bib_extends_levelofaccess = {NA}, author = {Origlia, S. and Pramod, M.S. and Schiller, S. and Singh, Y. and Bongs, K. and Schwarz, R. and Al-Masoudi, A. and D{\"o}rscher, S. and Herbers, S. and H{\"a}fner, S. and Sterr, U. and Lisdat, C.} } @Proceedings { SiboldTH2018, subid = {1049}, title = {Delayed authentication and delayed measurement application in one-way synchronization}, journal = {Proceedings of: 2018 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, year = {2018}, month = {11}, day = {22}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-6}, keywords = {time synchronization, Network Time Security (NTS), Time Security, security, authentication, integrity, Network Time Protocol (NTP)}, web_url = {https://doi.org/10.1109/ISPCS.2018.8543083}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, event_place = {Geneva, Switzerland}, event_name = {2018 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control, and Communication (ISPCS)}, event_date = {30-09-2018 to 05-10-2018}, language = {30}, ISBN = {978-1-5386-4263-4}, ISSN = {1949-0313}, DOI = {10.7795/EMPIR.17IND06.CA.20190410A}, stag_bib_extends_levelofaccess = {NA}, author = {Sibold, D. and Teichel, K. and Hildermeier, G.} } @Article { JaksiMODPCMTSSKDHLDGF2018, subid = {1009}, title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond}, journal = {ACS Photonics}, year = {2018}, month = {11}, day = {12}, volume = {5}, number = {12}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4864-4871}, keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.8b01013}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Herzig, T. and K{\"u}pper, J. and Damin, A. and Santonocito, S. and Signorile, M. and Traina, P. and Moreva, E. and Celegato, F. and Pezzagna, S. and Degiovanni, I. P. and Olivero, P. and Jakšić, M. and Meijer, J. and Genovese, P. M. and Forneris, J.} } @Article { JaksiMODPCMTSSKDHLDGF20180, subid = {1009}, title = {Single-Photon Emitters in Lead-Implanted Single-Crystal Diamond}, journal = {ACS Photonics}, year = {2018}, month = {11}, day = {12}, volume = {5}, number = {12}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {4864-4871}, keywords = {color centers; diamond; ion implantation; lead; photoluminescence; single-photon source}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.8b01013}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Herzig, T. and K{\"u}pper, J. and Damin, A. and Santonocito, S. and Signorile, M. and Traina, P. and Moreva, E. and Celegato, F. and Pezzagna, S. and Degiovanni, I. P. and Olivero, P. and Jakšić, M. and Meijer, J. and Genovese, P. M. and Forneris, J.} } @Article { CalossoPDPDS2018, subid = {997}, title = {A scalable hardware and software control apparatus for experiments with hybrid quantum systems}, journal = {Review of Scientific Instruments}, year = {2018}, month = {11}, volume = {89}, number = {11}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, pages = {113116}, keywords = {Experiment control system, experiment control program, FPGA}, web_url = {https://doi.org/10.1063/1.5049120}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1901.04851}, author = {Calosso, C.E. and Pomponio, M. and Detti, A. and Perego, E. and Duca, L. and Sias, C.} } @Article { JakubowskiLKNPTRES2018, subid = {937}, title = {Gadolinium in human brain sections and colocalization with other elements}, journal = {Neurology - Neuroimmunology Neuroinflammation}, year = {2018}, month = {10}, day = {19}, volume = {6}, number = {1}, number2 = {15HLT02: ReMIND: Role of metals and metal containing biomolecules in neurodegenerative diseases such as Alzheimer’s disease}, pages = {e515}, keywords = {Gadolinium, Gadolinium-based contrast agents, Human brain, MRI, LA-ICP-MS, Iron, Copper, Phosphorus}, web_url = {http://nn.neurology.org/content/6/1/e515/}, misc2 = {EMPIR 2015: Health}, publisher = {Ovid Technologies (Wolters Kluwer Health)}, language = {30}, ISSN = {2332-7812}, DOI = {10.1212/NXI.0000000000000515}, stag_bib_extends_levelofaccess = {NA}, author = {El-Khatib, A.H. and Radbruch, H. and Trog, S. and Neumann, B. and Paul, F. and Koch, A. and Linscheid, M.W. and Jakubowski, N. and Schellenberger, E.} } @Thesis { Spiess2018, subid = {1366}, title = {Setup of a vibration-suppressed}, year = {2018}, month = {10}, day = {17}, number2 = {17FUN07: CC4C: Coulomb Crystals for Clocks}, keywords = {Optical ClockTrapped Ions}, web_url = {https://pure.mpg.de/rest/items/item_3005557_2/component/file_3005558/content}, misc2 = {EMPIR 2017: Fundamental}, school = {University of Heidelberg}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/21.11116/0000-0002-5FDF-A}, author = {Spiess, L.J.} } @Article { Smith2018, subid = {1436}, title = {Modelling a quality assurance standard for emission monitoring in order to assess overall uncertainty}, journal = {Advanced Mathematical and Computational Tools in Metrology and Testing XI}, year = {2018}, month = {10}, day = {17}, number2 = {16ENV08: IMPRESS 2: Metrology for air pollutant emissions}, pages = {341-348}, keywords = {Monte-Carlo simulation, Emission monitoring, Process uncertainty assessment, EN 14181:2014}, web_url = {https://www.worldscientific.com/doi/10.1142/9789813274303_0034}, misc2 = {EMPIR 2016: Environment}, publisher = {WORLD SCIENTIFIC}, language = {30}, ISSN = {1793-0901}, DOI = {10.1142/9789813274303_0034}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, T.O.M.} } @Article { ClarkPLPBDMSSS2018, subid = {883}, title = {Crystallographic texture can be rapidly determined by electrochemical surface analytics}, journal = {Acta Materialia}, year = {2018}, month = {10}, day = {15}, volume = {159}, number = {1}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {89-101}, keywords = {Orientation mapping, Crystallographic characterisation, Electrochemical jet processing,}, web_url = {https://www.sciencedirect.com/science/article/pii/S1359645418305998}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {1359-6454}, DOI = {10.1016/j.actamat.2018.07.059}, stag_bib_extends_levelofaccess = {NA}, author = {Speidel, A. and Su, R. and Su, R. and Mitchell-Smith, J. and Dryburgh, P. and Bisterov, I. and Pieris, D. and Li, W. and Patel, R. and Clark, M.} } @Article { HuldSBGD2018, title = {Energy-based metric for analysis of organic PV devices in comparison with conventional industrial technologies}, journal = {Renewable and Sustainable Energy Reviews}, year = {2018}, month = {10}, volume = {93}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {76-89}, keywords = {Energy, Transport and Climate}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {1364-0321}, DOI = {10.1016/j.rser.2018.04.029}, stag_bib_extends_levelofaccess = {NA}, author = {Huld, T. and Salis, E. and Bardizza, G. and Gracia-Amillo, A.M. and Dunlop, E.D.} } @Article { SymmondsDLLFDWL2018, subid = {1079}, title = {Measurements of ultrasonic deterrents and an acoustically branded hairdryer: Ambiguities in guideline compliance}, journal = {The Journal of the Acoustical Society of America}, year = {2018}, month = {10}, volume = {144}, number = {4}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {2565-2574}, keywords = {ultrasound public sources}, misc2 = {EMPIR 2015: Health}, publisher = {Acoustical Society of America (ASA)}, language = {30}, ISSN = {0001-4966}, DOI = {10.1121/1.5064279}, stag_bib_extends_levelofaccess = {NA}, author = {Dolder, C.N. and Fletcher, M.D. and Lloyd Jones, S. and Lineton, B. and Dennison, S.R. and Symmonds, M. and White, P.R. and Leighton, T.G.} } @Article { SimonsenMO2018, subid = {1273}, title = {An investigation into a calibration scheme for a light pipe based temperature probe}, journal = {Measurement Science and Technology}, year = {2018}, month = {10}, volume = {29}, number = {11}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {115004}, keywords = {pyrometry, optical thermometry, uncertainty, temperature, traceability, light piping}, misc2 = {EMPIR 2017: Industry}, publisher = {Institute of Physics}, address = {London}, language = {30}, ISSN = {1361-6501}, DOI = {10.1088/1361-6501/aade6f}, stag_bib_extends_levelofaccess = {NA}, author = {Olsen, A.A.F. and Mathisen, H. and Simonsen, S.} } @Article { PepperRFJGFSSREJJK2018, subid = {1113}, title = {LO-Phonon Emission Rate of Hot Electrons from an On-Demand Single-Electron Source in a GaAs/AlGaAs Heterostructure}, journal = {Physical Review Letters}, year = {2018}, month = {9}, day = {26}, volume = {121}, number = {13}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Single electron pumps, hot electron transport, phonon emission, phonon relaxation, optical phonons, edge states, electron optics, electron quantum optics}, web_url = {https://arxiv.org/abs/1712.09031}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.121.137703}, stag_bib_extends_levelofaccess = {NA}, author = {Johnson, N. and Emary, C. and Ryu, S. and Sim, H.S. and See, P. and Fletcher, J.D. and Griffiths, J.P. and Jones, G.A.C. and Farrer, I. and Ritchie, D.A. and Pepper, M. and Janssen, T.J.B.M. and Kataoka, M.} } @Article { RuttTTHLHILS2018, subid = {1122}, title = {Manipulation of random telegraph signals in a silicon nanowire transistor with a triple gate}, journal = {Nanotechnology}, year = {2018}, month = {9}, day = {25}, volume = {29}, number = {47}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {475201}, keywords = {random telegraph signal, silicon nanowire, quantum dot, MOSFET}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6528/aadfa6/meta\#back-to-top-target}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/aadfa6}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, F. and Ibukuro, K. and Husain, M.H. and Li, Z. and Hillier, J. and Tomita, I. and Tsuchiya, Y. and Rutt, H. and Saito, S.} } @Article { ChebenVMOHLSWH2018, subid = {873}, title = {Tilted subwavelength gratings: controlling anisotropy in metamaterial nanophotonic waveguides}, journal = {Optics Letters}, year = {2018}, month = {9}, day = {21}, volume = {43}, number = {19}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {4691}, keywords = {Subwavelength, anisotropy, silicon, waveguides}, web_url = {https://riuma.uma.es/xmlui/handle/10630/16695}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.43.004691}, stag_bib_extends_levelofaccess = {NA}, author = {Luque-Gonz{\'a}lez, J.M. and Herrero-Bermello, A. and Ortega-Monux, A. and Molina-Fernandez, I. and Velasco, A.V. and Cheben, P. and Schmid, J.H. and Wang, S. and Halir, R.} } @Article { BurianovaVS2018, subid = {810}, title = {Tissue-equivalence of 3D-printed plastics for medical phantoms in radiology}, journal = {Journal of Instrumentation}, year = {2018}, month = {9}, day = {20}, volume = {13}, number = {09}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {P09018-P09018}, keywords = {Medical phantom; radiology; ionizing radiation; 3D print; linear attenuation coefficient; Hounsfield unit}, web_url = {http://mrtdosimetry-empir.eu/?page_id=1166}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/13/09/P09018}, stag_bib_extends_levelofaccess = {NA}, author = {Solc, J. and Vrba, T. and Burianov{\'a}, L.} } @Article { HisamotoRHLASTYTLSK2018, subid = {595}, title = {Quantum Dipole Effects in a Silicon Transistor under High Electric Fields}, journal = {Journal of the Physical Society of Japan}, year = {2018}, month = {9}, day = {15}, volume = {87}, number = {9}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {094801}, keywords = {Si, CMOS, transistor, quantum dipole, Heisenberg model}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Physical Society of Japan}, language = {30}, ISSN = {0031-9015, 1347-4073}, DOI = {10.7566/jpsJ.87.094801}, stag_bib_extends_levelofaccess = {NA}, author = {Saito, S. and Li, Z. and Yoshimoto, H, and Tomita, I. and Tsuchiya, Y. and Sasago, Y. and Arimoto, H. and Liu, F. and Husain, M.K. and Hisamoto, D. and Rutt, H.N. and Kurihara, S.} } @Article { FlueggeNFSHDS2018, subid = {709}, title = {Metrological large range magnetic force microscopy}, journal = {Review of Scientific Instruments}, year = {2018}, month = {9}, volume = {89}, number = {9}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {093703}, keywords = {metrological magnetic force microscopy, large range, stray field}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5035175}, stag_bib_extends_levelofaccess = {NA}, author = {Dai, G. and Hu, X. and Sievers, S. and Fern{\'a}ndez Scarioni, A. and Neu, V. and Fluegge, J. and Schumacher, H.W.} } @Article { KonemannOWESFS2018, subid = {806}, title = {Selection and Characterization of Liquids for a Low Pressure Interferometric Liquid Column Manometer}, journal = {Measurement}, year = {2018}, month = {9}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, keywords = {primary pressure standard, low pressure, liquid column manometer, vacuum oil, gas saturation}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2018.09.017}, stag_bib_extends_levelofaccess = {NA}, author = {Ehlers, S. and K{\"o}nemann, J. and Ott, O. and Wolf, H. and Šetina, J. and Furtado, A. and Sabuga, W.} } @Proceedings { ProbstHDSPA2018_2, subid = {939}, title = {Impact of Substrate Modes on mTRL-Calibrated CPW Measurements in G Band}, journal = {2018 48th European Microwave Conference (EuMC)}, year = {2018}, month = {9}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {on-wafer probes, coplanar waveguides (CPW), substrate modes, calibration}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/impact-of-substrate-modes-on-mtrl-calibrated-cpw-measurements-in-g-band}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Madrid}, event_name = {2018 48th European Microwave Conference}, event_date = {23-09-2018 to 28-09-2018}, language = {30}, DOI = {10.23919/EuMC.2018.8541813}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Heinrich, W. and Probst, T. and Arz, U.} } @Proceedings { SteinhoffWMW2018, subid = {952}, title = {Metrology and Standardisation of Magnetic Nanoparticles for Biomedical Applications}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2018}, month = {9}, volume = {63}, number = {s1}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {S261}, keywords = {Magnetic nanoparticles, standardisation}, web_url = {https://www.degruyter.com/downloadpdf/j/bmte.2018.63.issue-s1/bmt-2018-6048/bmt-2018-6048.xml}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Walter de Gruyter GmbH}, event_place = {Aachen}, event_name = {2018 Annual Meeting of the German Society of Biomedical Engineering}, event_date = {26-09-2018 to 28-09-2018}, language = {30}, ISSN = {1862-278X, 0013-5585}, DOI = {10.1515/bmt-2018-6048}, stag_bib_extends_levelofaccess = {NA}, author = {Steinhoff, U. and Wells, J. and Marks, G. and Wiekhorst, F.} } @Article { YangBJCJTS2018, title = {Individualized magnetoencephalography using optically pumped magnetometers with an anatomy derived sensor holder}, journal = {Biomedical Engineering / Biomedizinische Technik}, year = {2018}, month = {9}, volume = {63}, number = {s1}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {240}, keywords = {OPM, SQUID, SQUID-MEG, signal-to-noise ratio}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Walter de Gruyter GmbH}, address = {Berlin}, language = {30}, ISSN = {1862-278X, 0013-5585}, DOI = {10.1515/bmt-2018-6045}, stag_bib_extends_levelofaccess = {NA}, author = {Yang, T. and Br{\"u}hl, R. and Jodko-Władzińska, A. and Cotic Smole, P. and Jazbinšek, V. and Trahms, L. and Sander-Th{\"o}mmes, T.} } @Proceedings { SenC2018, subid = {836}, title = {Improved Just-Before-Test Verification Methods with VNA for Conducted EMC Tests}, journal = {2018 International Symposium on Electromagnetic Compatibility (EMC EUROPE)}, year = {2018}, month = {8}, day = {30}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-6}, keywords = {Conducted Emission, Conducted Immunity, EMC, Verification}, web_url = {http://rfmw.cmi.cz/documents/papers/Sen_EMCEurope2018OA.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Amsterdam, The Netherlands}, event_name = {2018 International Symposium on Electromagnetic Compatibility (EMC EUROPE)}, event_date = {27-08-2018 to 30-08-2018}, language = {30}, ISBN = {978-1-4673-9698-1}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2018.8485179}, stag_bib_extends_levelofaccess = {NA}, author = {Şen, O. and \c{C}akır, S.} } @Article { HaasSSRBH2018, title = {A gravitational telescope deformation model for geodetic VLBI}, journal = {Journal of Geodesy}, year = {2018}, month = {8}, day = {29}, volume = {93}, number = {5}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {669-680}, keywords = {VLBI, Telescope deformation, Systematic errors, Terrestrial reference frames}, web_url = {http://link.springer.com/article/10.1007/s00190-018-1188-1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-7714, 1432-1394}, DOI = {10.1007/s00190-018-1188-1}, stag_bib_extends_levelofaccess = {NA}, author = {Haas, R. and Svantesson, C.G. and Spetz, J. and Rieck, C. and Bergstrand, S. and Herbertsson, M.} } @Article { StrupinskiUOGPMPMPWKB2018, subid = {992}, title = {Electrical Homogeneity Mapping of Epitaxial Graphene on Silicon Carbide}, journal = {ACS Applied Materials \& Interfaces}, year = {2018}, month = {8}, day = {21}, volume = {10}, number = {37}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, pages = {31641-31647}, keywords = {conductivity; graphene; metrology; micro four-point probe; SiC; terahertz spectroscopy}, web_url = {https://pubs.acs.org/doi/10.1021/acsami.8b11428}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {1944-8244, 1944-8252}, DOI = {10.1021/acsami.8b11428}, stag_bib_extends_levelofaccess = {NA}, author = {Whelan, P.R. and Panchal, V. and Petersen, D.H. and Mackenzie, D.M.A. and Melios, C. and Pasternak, I. and Gallop, J. and {\O}sterberg, F.W. and U. Jepsen, P. and Strupinski, W. and Kazakova, O. and B{\o}ggild, P.} } @Article { IldayCEHe2018, subid = {1075}, title = {Tailored Design of Mode-Locking Dynamics for Low-Noise Frequency-Comb Generation}, journal = {Physical Review Applied}, year = {2018}, month = {8}, day = {20}, volume = {10}, number = {2}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {024027}, keywords = {frequency comb, low-noise}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1905.01116}, author = {Ilday, F.O. and \c{C}elik, M. and Erdoğan, C. and Hamid, R. and Şenel, C.} } @Article { SieversYSHGBTCBF2018, subid = {996}, title = {Excitation and coherent control of magnetization dynamics in magnetic tunnel junctions using acoustic pulses}, journal = {Applied Physics Letters}, year = {2018}, month = {8}, day = {13}, volume = {113}, number = {7}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, keywords = {Excitation, Coherent control, Magnetization dynamics, magnetic tunnel junctions, acoustic pulses}, web_url = {https://arxiv.org/abs/1804.10503}, misc2 = {EMPIR 2015: SI Broader Scope}, language = {30}, DOI = {10.1063/1.5037780}, stag_bib_extends_levelofaccess = {NA}, author = {Yang, H.F. and Garcia-Sanchez, F. and Hu, X.K. and Sievers, S. and B{\"o}hnert, T. and Costa, J.D. and Tarequzzaman, M. and Ferreira, R. and Bieler, M. and Schumacher, H.W.} } @Article { YooSWWIAKR2018, subid = {842}, title = {Extrusion 3D Printing of Paracetamol Tablets from a Single Formulation with Tunable Release Profiles Through Control of Tablet Geometry}, journal = {AAPS PharmSciTech}, year = {2018}, month = {8}, day = {10}, volume = {19}, number = {11}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, keywords = {3D printing; paracetamol; sustained release; immediate release; personalised medicine; geometry}, web_url = {https://link.springer.com/article/10.1208/s12249-018-1107-z}, misc2 = {EMPIR 2015: Health}, publisher = {American Association of Pharmaceutical Scientists (AAPS)}, language = {30}, ISSN = {1530-9932}, DOI = {10.1208/s12249-018-1107-z}, stag_bib_extends_levelofaccess = {NA}, author = {Khaled, S.A. and Alexander, M.R. and Irvine, D.J. and Wildman, R.D. and Wallace, M.J. and Sharpe, S. and Yoo, J. and Roberts, C.J.} } @Article { MullejansTPS2018, title = {Uncertainty budget assessment of temperature coefficient measurements performed via intra-laboratory comparison between various facilities for PV device calibration}, journal = {Solar Energy}, year = {2018}, month = {8}, volume = {170}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {293-300}, keywords = {Temperature coefficients uncertainty, Temperature-dependent spectral mismatch, Photovoltaics, Intercomparison}, web_url = {https://reader.elsevier.com/reader/sd/F3B29C1ED5EA17BAFB18D68D072A007E7E1838829B884A59F5C7E5535FACF846A0BBB5E76DB2DBC50641745278F0FF2E\#pf1}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2018.04.062}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}llejans, H. and Trentadue, G. and Pavanello, D. and Salis, E.} } @Article { SaxholmSHHSK2018, title = {Low-Pressure and Low-Temperature Dew/Frost-Point Generator}, journal = {International Journal of Thermophysics}, year = {2018}, month = {8}, volume = {39}, number = {9}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Dew-point generator, Frost-point generator, Humidity, Low pressure, Uncertainty}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-018-2425-9}, stag_bib_extends_levelofaccess = {NA}, author = {Saxholm, S. and Salminen, J. and H{\"o}gstr{\"o}m, R. and Heinonen, M. and Sairanen, H. and Kajastie, H.} } @Proceedings { WiekhorstSM2018, subid = {940}, title = {A model for uncertainty influences on static magnetisation measurements on magnetic nanoparticles}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {072030}, keywords = {uncertainty budget, static magnetization measurement, standardization}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, event_place = {Belfast, UK}, event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/7/072030}, stag_bib_extends_levelofaccess = {NA}, author = {Marks, G. and Steinhoff, U. and Wiekhorst, F.} } @Article { DurandettoS2018, subid = {945}, title = {Experimental analysis of the thermal behavior of a GM cryocooler based on linear system theory}, journal = {International Journal of Refrigeration}, year = {2018}, month = {8}, volume = {92}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {125-132}, keywords = {Cryocoolers, Thermal analysis, Thermal control, Linear systems, Thermal impedance, Dynamic load}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0140-7007}, DOI = {10.1016/j.ijrefrig.2018.04.016}, stag_bib_extends_levelofaccess = {NA}, author = {Sosso, A. and Durandetto, P.} } @Proceedings { HodoroabaKHS2018, subid = {954}, title = {Analysis of Mesoporous Iridium Oxide Thin Films by the Combined Methodical Approach SEM/EDS/STRATAGem}, journal = {Proceedings of Microscopy \& Microanalysis 2018}, year = {2018}, month = {8}, volume = {24}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {762-763}, keywords = {Electron probe microanalysis (EPMA); Iridium oxide; Porous thin films; Spectroscopic ellipsometry}, misc2 = {EMPIR 2016: Energy}, publisher = {Cambridge University Press (CUP)}, event_place = {Baltimore, Maryland, USA}, event_name = {Microscopy \& Microanalysis 2018}, event_date = {05-08-2018 to 09-08-2018}, language = {30}, ISSN = {1431-9276, 1435-8115}, DOI = {10.1017/S1431927618004300}, stag_bib_extends_levelofaccess = {NA}, author = {Sachse, R. and Hertwig, A. and Kraehnert, R. and Hodoroaba, V.D.} } @Article { LuisoLGGDS2018, subid = {989}, title = {Synchronized Measurement System for Railway Application}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {16ENG04: MyRailS: Metrology for smart energy management in electric railway systems}, pages = {052040}, keywords = {Electric power system control, Electric power systems, Global positioning system, Quality control,Railroad transportation, Synchronization}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/5/052040}, stag_bib_extends_levelofaccess = {NA}, author = {Delle Femine, A. and Gallo, D. and Giordano, D. and Landi, C. and Luiso, M. and Signorino, D.} } @Article { NeuvonenAALBBPMSPFWSBL2018, subid = {1062}, title = {Establishing traceability for liquid density measurements in Europe: 17RPT02-rhoLiq a new EMPIR joint research project}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number = {8}, number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements}, pages = {082013}, keywords = {density of liquids; hydrostatic weighing; oscillation-type density meters}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/8/082013/pdf}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IOP Publishing}, address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/8/082013}, stag_bib_extends_levelofaccess = {NA}, author = {Furtado, A. and Pereira, J. and Schiebl, M. and Mares, G. and Popa, G. and Bartos, P. and Bebic, J. and Lenard, E. and Alic, A. and Alisic, S. and Neuvonen, P. and Wolf, H. and Sariyerli, G. and Bescupschii, A. and Laky, B.} } @Article { OguzAytekinKMSISFSZSJoHBHPV2018, subid = {1086}, title = {Improving emerging European NMIs’ capabilities in humidity measurement}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {122019}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122019}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/12/122019}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Zvizdić, D. and Sestan, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Article { ZvizdiFSIRSSH2018, subid = {1087}, title = {Development and preliminary investigation of a modular chamber for calibration of relative humidity instruments}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {122017}, keywords = {Humidity, Relative humidity, Calibration chamber}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/12/122017}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/12/122017}, stag_bib_extends_levelofaccess = {NA}, author = {Sestan, D. and Smorgon, D. and Rothmund, P. and Iacomini, L. and Šariri, K. and Fernicola, V. and Zvizdić, D. and Hodzic, N.} } @Article { PendrillSFMCW2018, subid = {1150}, title = {Patient-centred cognition metrology}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number = {7}, number2 = {15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases}, pages = {072033}, keywords = {Patient-centred cognition metrology}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/7/072033}, stag_bib_extends_levelofaccess = {NA}, author = {Cano, S.J and Melin, J. and Fisher, W.P and Stenner, A.J and Pendrill, L.R} } @Article { BehrHDBIIWBS2018, subid = {1153}, title = {Towards a Metrology class ADC based on Josephson junction devices}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {052044}, keywords = {Metrology, Josephson, ADC, DC Voltage, AC Voltage}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/5/052044}, stag_bib_extends_levelofaccess = {NA}, author = {Belcher, A. and Williams, J. and Ireland, J. and Iuzzolino, R. and Bierzychudek, M.E. and Dekker, R. and Herick, J. and Behr, R. and Schaapman, K.} } @Article { SolcS2018, subid = {1317}, title = {Characterization of the new free-air primary standard for medium-energy X-rays at CMI}, journal = {Journal of Instrumentation}, year = {2018}, month = {8}, volume = {13}, number = {08}, number2 = {14RPT04: Absorb: Absorbed dose in water and air}, pages = {P08008-P08008}, keywords = {Free-air ionization chamber, FAC corrections, X-rays, air kerma, MCNPX, Monte Carlo simulation, radiation transport.}, web_url = {https://arxiv.org/abs/1912.04404}, misc2 = {EMPIR 2014: Research Potential}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, stag_bib_extends_levelofaccess = {NA}, author = {Solc, J. and Sochor, V.} } @Article { OlbrichSROBS2018, subid = {1626}, title = {Validation of simulations in multiphase flow metrology by comparison with experimental video observations}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number2 = {16ENG07: MultiFlowMet II: Multiphase flow reference metrology}, pages = {092015}, keywords = {Multiphase flow, slug flow, CFD, liquid level extraction, frequency analysis}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/9/092015}, stag_bib_extends_levelofaccess = {NA}, author = {Olbrich, M. and Schmeyer, E. and Riazy, L. and Oberleithner, K. and B{\"a}r, M. and Schmelter, S.} } @Article { McKennaGSBCHGP2018, subid = {608}, title = {Exposure of mass-selected bimetallic Pt–Ti nanoalloys to oxygen explored using scanning transmission electron microscopy and density functional theory}, journal = {RSC Advances}, year = {2018}, month = {7}, day = {31}, volume = {8}, number = {52}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {27276–27282}, keywords = {Nanoparticles, nanotechnology, nanoalloys, platinum, bimetallic, electron microscopy}, web_url = {http://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra02449a}, misc2 = {EMPIR 2014: Industry}, publisher = {The Royal Society of Chemistry}, language = {30}, ISSN = {2046-2069}, DOI = {10.1039/C8RA02449A}, stag_bib_extends_levelofaccess = {NA}, author = {Gholhaki, S. and Hung, S. and Cant, D. and Blackmore, C. and Shard, A. and Guo, Q. and McKenna, K. and Palmer, R.} } @Proceedings { OzturkSC2018, subid = {888}, title = {Investigation of Ripple Voltage Across Capacitor in Military CS101 Test by Using FFT-Based Time Domain Solution}, journal = {2018 IEEE Symposium on Electromagnetic Compatibility, Signal Integrity and Power Integrity (EMC, SI \& PI)}, year = {2018}, month = {7}, day = {30}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {82-87}, keywords = {Aerospace, Capacitor, CS101, DFT, EMC, FFT, Immunity, Military, Susceptibility, Time Domain}, web_url = {http://rfmw.cmi.cz/documents/papers/Cakir_CS101.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Long Beach, CA, USA}, event_name = {2018 IEEE Symposium on Electromagnetic Compatibility, Signal Integrity and Power Integrity}, event_date = {30-07-2018 to 02-08-2018}, language = {30}, ISBN = {978-1-5386-6619-7}, DOI = {10.1109/EMCSI.2018.8495307}, stag_bib_extends_levelofaccess = {NA}, author = {\c{C}akır, S. and Şen, O. and Ozturk, M.} } @Article { BoarinoRDSPDGFMC2018, subid = {846}, title = {Influence of the long-range ordering of gold-coated Si nanowires on SERS}, journal = {Scientific Reports}, year = {2018}, month = {7}, day = {27}, volume = {8}, number = {1}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, keywords = {surface-enhanced Raman spectroscopy; substrates for bio-analytical applications; flexible gold-coated Si nanowires}, web_url = {https://www.nature.com/articles/s41598-018-29641-x.pdf}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-29641-x}, stag_bib_extends_levelofaccess = {NA}, author = {Cara, E. and Mandrile, L. and Ferrarese Lupi, F. and Giovannozzi, A.M. and Dialameh, M. and Portesi, C. and Sparnacci, K. and De Leo, N. and Rossi, A.M. and Boarino, L.} } @Article { HoflingSBBHSGLFSKRS2018_2, subid = {696}, title = {Photon-Number-Resolved Measurement of an Exciton-Polariton Condensate}, journal = {Physical Review Letters}, year = {2018}, month = {7}, day = {25}, volume = {121}, number = {4}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {047401}, keywords = {Exciton Polariton, Photon Statistics}, web_url = {https://arxiv.org/abs/1805.02959}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.121.047401}, stag_bib_extends_levelofaccess = {NA}, author = {Klaas, M. and Schlottmann, E. and Flayac, H. and Laussy, F. P. and Gericke, F. and Schmidt, M. and Helversen, M. v. and Beyer, J. and Brodbeck, S. and Suchomel, H. and H{\"o}fling, S. and Reitzenstein, S. and Schneider, C.} } @Article { JelezkoDNAEBGJSMTFDGO2018, subid = {1010}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept}, journal = {Physical Review Applied}, year = {2018}, month = {7}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance}, web_url = {https://arxiv.org/abs/1706.07935}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.10.014024}, stag_bib_extends_levelofaccess = {NA}, author = {Forneris, J. and Ditalia Tchernij, S. and Traina, P. and Moreva, E. and Skukan, N. and Jakšić, M. and Grilj, V. and Bosia, F. and Enrico, E. and Amato, G. and Degiovanni, I.P. and Naydenov, B. and Jelezko, F. and Genovese, M. and Olivero, P.} } @Article { JelezkoDNAEBGJSMTFDGO20180, subid = {1010}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept}, journal = {Physical Review Applied}, year = {2018}, month = {7}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.10.014024}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1706.07935}, author = {Forneris, J. and Ditalia Tchernij, S. and Traina, P. and Moreva, E. and Skukan, N. and Jakšić, M. and Grilj, V. and Bosia, F. and Enrico, E. and Amato, G. and Degiovanni, I.P. and Naydenov, B. and Jelezko, F. and Genovese, M. and Olivero, P.} } @Article { UngerDTSK2018, subid = {560}, title = {Surface characterisation of Escherichia coli under various conditions by near-ambient pressure XPS}, journal = {Surface and Interface Analysis}, year = {2018}, month = {7}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {1-5}, keywords = {bacteria, E.coli, NAP-XPS}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/sia.6480}, misc2 = {EMPIR 2015: Health}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.6480}, stag_bib_extends_levelofaccess = {NA}, author = {Kjaervik, M. and Schwibbert, K. and Dietrich, P. and Thissen, A. and Unger, W.E.S.} } @Article { SigrayLCBMBBAHRGCBD2018, subid = {904}, title = {Calibration standards for hydrophones and autonomous underwater noise recorders for frequencies below 1 kHz: current activities of EMPIR “UNAC-LOW” project}, journal = {ACTA IMEKO}, year = {2018}, month = {7}, volume = {7}, number = {2}, number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz}, pages = {32}, keywords = {low frequency hydrophone calibration; low frequency underwater noise recorders; underwater acoustics; calibration}, web_url = {http://dx.doi.org/10.21014/acta_imeko.v7i2.542}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v7i2.542}, stag_bib_extends_levelofaccess = {NA}, author = {Biber, A. and \c{C}orak\c{c}ı, A.C. and Golick, A. and Robinson, S. and Hayman, G. and Ablitt, J. and Barrera-Figueroa, S. and Buogo, S. and Mauro, S. and Borsani, F. and Curcuruto, S. and Linn{\'e}, M. and Sigray, P. and Davidsson, P.} } @Proceedings { DaffeSRMMH2018, subid = {893}, title = {Parameterization Models for Traceable Characterization of Planar CPW SOL Calibration Standards}, journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Uncertainty, Calibration, Coplanar waveguides, Standards, Frequency measurement, Measurement Uncertainty, Probes}, web_url = {https://hal.archives-ouvertes.fr/hal-02085776/document}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Paris, France}, event_name = {CPEM}, event_date = {08-07-2018 to 13-07-2018}, language = {30}, ISBN = {978-1-5386-0974-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2018.8500810}, stag_bib_extends_levelofaccess = {NA}, author = {Mubarak, F. and Mascolo, V. and Rietveld, G. and Spirito, M. and Daff{\'e}, K. and Haddadi, K.} } @Article { SchaeffterTFSKWPW2018, subid = {942}, title = {Improved sensitivity and limit-of-detection using a receive-only coil in magnetic particle imaging}, journal = {Physics in Medicine \& Biology}, year = {2018}, month = {7}, volume = {63}, number = {13}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {13NT02}, keywords = {magnetic nanoparticles, magnetic particle imaging, magnetic measurements}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aacb87}, stag_bib_extends_levelofaccess = {NA}, author = {Paysen, H. and Wells, J. and Kosch, O. and Steinhoff, U. and Franke, J. and Trahms, L. and Schaeffter, T. and Wiekhorst, F.} } @Proceedings { ZuccaPMGCS2018, subid = {1082}, title = {A Voltage Calibration Chain for Meters Used in Measurements of EV Inductive Power Charging}, journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, volume = {Online}, number = {Unique}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-2}, keywords = {Voltage measurement, Calibration, Probes, Windings, Frequency measurement, Power measurement}, web_url = {http://arxiv.org/abs/1905.08046}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Paris (France)}, event_name = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, event_date = {08-07-2018 to 13-07-2018}, language = {30}, ISBN = {978-1-5386-0974-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2018.8500831}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Pogliano, U. and Modarres, M. and Giordano, D. and Crotti, G. and Serazio, D.} } @Proceedings { FemiaPS2018, subid = {1108}, title = {Behavioral Switching Loss Modeling of Inverter Modules}, journal = {2018 15th International Conference on Synthesis, Modeling, Analysis and Simulation Methods and Applications to Circuit Design (SMACD)}, year = {2018}, month = {7}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-4}, note = {Hidden - DOI not open access (KP updated -2/01/2020)}, keywords = {Full-Bridge Power Module; Loss Modeling; Genetic Programming; Multi-Objective Optimization}, web_url = {https://arxiv.org/abs/1906.04428}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Prague}, event_name = {15th International Conference on Synthesis, Modeling, Analysis and Simulation Methods and Applications to Circuit Design (SMACD)}, event_date = {02-07-2019 to 05-07-2019}, language = {30}, DOI = {10.1109/SMACD.2018.8434850}, stag_bib_extends_levelofaccess = {NA}, author = {Stoyka, K. and Pessinatti Ohashi, R.A. and Femia, N.} } @Article { EllingsbergBAVLRWPS2018, subid = {1376}, title = {Evaluation of EMI Effects on Static Electricity Meters}, journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters.}, web_url = {https://zenodo.org/record/3587786\#.XiGxp3u7KUn}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/CPEM.2018.8500945}, stag_bib_extends_levelofaccess = {NA}, author = {Wright, P.S. and Rietveld, G. and Leferink, F. and van den Brom, H.E. and Alonso, F.R.I and Braun, J.P. and Ellingsberg, K. and Pous, M. and Svoboda, M.} } @Article { LudwigSKSDGTNPFJBPKRI2018, subid = {900}, title = {Development of white LED illuminants for colorimetry and recommendation of white LED reference spectrum for photometry}, journal = {Metrologia}, year = {2018}, month = {6}, day = {28}, volume = {55}, number = {4}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {526-534}, keywords = {Photometry, colorimetry, illuminant, reference spectrum, photometer, calibration, uncertainty}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aacae7}, stag_bib_extends_levelofaccess = {NA}, author = {Kokka, A. and Poikonen, T. and Blattner, P. and Jost, S. and Ferrero, A. and Pulli, T. and Ngo, M. and Thorseth, A. and Gerloff, T. and Dekker, P. and Stuker, F. and Klej, A. and Ludwig, K. and Schneider, M. and Reiners, T. and Ikonen, E.} } @Article { WubbelerRPKHUHSKZ2018, subid = {1114}, title = {Compressed sensing FTIR nano-spectroscopy and nano-imaging}, journal = {Optics Express}, year = {2018}, month = {6}, day = {28}, volume = {26}, number = {14}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {18115}, keywords = {Infrared scattering scanning near-field optical microscopy, Optical spectroscopy, Compressed sensing}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-14-18115}, misc2 = {EMPIR 2016: Energy}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.018115}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}stner, Bernd and Schm{\"a}hling, Franko and Hornemann, Andrea and Ulrich, Georg and Hoehl, Arne and Kruskopf, Mattias and Pierz, Klaus and Raschke, Markus B. and W{\"u}bbeler, Gerd and Elster, C.} } @Proceedings { SteinhoffESM2018, subid = {943}, title = {Uncertainty Analyses of Static Measurements of Induced Magnetisation}, journal = {Publications of the Institute of Geophysics, Polish Academy of Sciences; Geophysical Data Bases, Processing and Instrumentation}, year = {2018}, month = {6}, day = {27}, volume = {423}, number = {C-112}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {145-146}, keywords = {DC-magnetometry, uncertainty budget, magnetic hysteresis, magnetic nanoparticles.}, web_url = {https://pub.igf.edu.pl/files/Pdf/Pubs/26.pdf}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Institute of Geophysics Polish Academy of Sciences}, address = {64 Ksiecia Janusza Warsaw 01-452 Poland}, event_place = {Chęciny, Poland}, event_name = {16th Castle Meeting New Trends on Paleo, Rock and Environmental Magnetism}, event_date = {10-06-2018 to 16-06-2018}, language = {30}, ISSN = {2299-8020}, DOI = {10.25171/InstGeoph_PAS_Publs-2018-074}, stag_bib_extends_levelofaccess = {NA}, author = {Spassov, S. and Egli, R. and Marks, G. and Steinhoff, U.} } @Article { DorscherSFASL2018, subid = {567}, title = {Lattice-induced photon scattering in an optical lattice clock}, journal = {Physical Review A}, year = {2018}, month = {6}, day = {25}, volume = {97}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {063419}, keywords = {Optical lattice clocks, light-matter interaction, electronic transitions,}, web_url = {https://arxiv.org/abs/1802.02945}, misc2 = {EMPIR 2015: SI Broader Scope}, language = {30}, DOI = {10.1103/PhysRevA.97.063419}, stag_bib_extends_levelofaccess = {NA}, author = {D{\"o}rscher, S{\"o}ren and Schwarz, Roman and Al-Masoudi, Ali and Falke, Stephan and Sterr, Uwe and Lisdat, Christian} } @Manual { KielerBWMRCSBSSCDOB2018, subid = {719}, title = {Good Practice Guide on the operation of AC quantum voltage standards}, year = {2018}, month = {6}, day = {21}, volume = {1}, number2 = {14RPT01: ACQ-PRO: Towards the propagation of ac quantum voltage standards}, note = {ISBN ok https://grp.isbn-international.org/search/piid_cineca_solr/978-80-905619\%2B\%2528ISBNPrefix\%2529?keys=978-80-905619\%2B\%2528ISBNPrefix\%2529}, keywords = {Good Practice Guide, quantum standards, alternating voltage, Josephson effect, measurement techniques, uncertainty estimation, software tools, safe operation, cryogenic equipment}, misc2 = {EMPIR 2014: Research Potential}, publisher = {Czech Metrology Institute}, address = {Brno}, language = {30}, ISBN = {978-80-905619-2-2}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://acqpro.cmi.cz/index.php/results/28-good-practice-guide}, author = {Kieler, O. and Behr, R. and Williams, J.M. and Malmbekk, H. and Ribeiro, L. and Cabral, V. and Sosso, A. and Bruszewski, P. and Š{\'i}ra, M. and Sanmamed, Y.A. and Caballero, R. and Diaz de Aguilar, J. and Orhan, R. and Bonfait, G.} } @Article { RadivojeviTSD2018, subid = {756}, title = {An in situ temperature calibration of a guarded hot plate apparatus}, journal = {Thermal Science International Scientific Journal}, year = {2018}, month = {6}, day = {17}, volume = {On line fi}, number2 = {14RPT05: Eura-Thermal: Developing traceable capabilities in thermal metrology}, pages = {176-186}, keywords = {Thermal Conductivity, Guarded Hot Plate Method, Metrology, in situ temperature calibration}, misc2 = {EMPIR 2014: Research Potential}, publisher = {Dr. Vukman Bakić}, language = {30}, ISSN = {2334-7163}, DOI = {10.2298/TSCI180425176S}, stag_bib_extends_levelofaccess = {NA}, author = {Stepanic, N. and Terzic, M. and Radivojević, D. and Raković, D.} } @Article { GoenagaInfanteBWSSSM2018, subid = {575}, title = {Measuring the relative concentration of particle populations using differential centrifugal sedimentation}, journal = {Analytical Methods}, year = {2018}, month = {6}, day = {14}, volume = {10}, number = {22}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {2539 - 2660}, keywords = {Relative, concentration, particle, populations, differential centrifugal sedimentation, DCS, spherical particles}, web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ay/c8ay00491a}, misc2 = {EMPIR 2014: Industry}, publisher = {The Royal Society of Chemistry}, language = {30}, ISSN = {1759-9679}, DOI = {10.1039/c8ay00491a}, stag_bib_extends_levelofaccess = {NA}, author = {Shard, A. and Sparnacci, K. and Sikora, A. and Wright, L. and Bartczak, D. and Goenaga-Infante, H. and Minelli, C.} } @Article { elGawharyLWNSRBF2018, title = {Sensitivity study of the instrumental temperature corrections on Brewer total ozone column measurements}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {6}, day = {11}, volume = {11}, number = {6}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {3323-3337}, keywords = {Brewer, instrumental temperature}, web_url = {https://www.atmos-meas-tech.net/11/3323/2018/amt-11-3323-2018.html}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-3323-2018}, stag_bib_extends_levelofaccess = {NA}, author = {El Gawhary, O. and Le{\'o}n-Luis, S.F. and Wilson, K. and Nevas, S. and Sildoja, M.M. and Redondas, A. and Berjon, A. and Fountoulakis, I.} } @Article { CorrederaSPGdV2018, subid = {569}, title = {Experimental Demonstration of Low-Uncertainty Calibration Methods for Bragg Grating Interrogators}, journal = {Sensors}, year = {2018}, month = {6}, day = {10}, volume = {18}, number = {6}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1895}, keywords = {fiber-optic sensors; fiber Bragg gratings interrogators; absolute calibration}, misc2 = {EMPIR 2014: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s18061895}, stag_bib_extends_levelofaccess = {NA}, author = {de Miguel, J. and Galindo-Santos, J. and Pulido de Torres, C. and Salgado, P. and Velasco, A.V. and Corredera, P.} } @Article { EbertWBSLW2018, title = {High-resolution Fourier transform measurements of air-induced broadening and shift coefficients in the 00 0 2–00 0 0 main isotopologue band of nitrous oxide}, journal = {Journal of Molecular Spectroscopy}, year = {2018}, month = {6}, volume = {348}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {68-78}, keywords = {Nitrous oxide, Fourier transform infrared spectroscopy, Spectral line parameters, Air-broadening, Air-shift, Gas metrology}, web_url = {https://www.sciencedirect.com/science/article/pii/S0022285217302059?via\%3Dihub}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0022-2852}, DOI = {10.1016/j.jms.2017.07.002}, stag_bib_extends_levelofaccess = {NA}, author = {Ebert, V. and Werhahn, O. and Brunzendorf, J. and Serdyukov, A. and Li, G. and Werwein, V.} } @Proceedings { ProbstHDSPA2018, subid = {752}, title = {Effects Degrading Accuracy of CPW mTRL Calibration at W Band}, journal = {2018 IEEE/MTT-S International Microwave Symposium - IMS}, year = {2018}, month = {6}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1296-1299}, keywords = {Calibration, measurement accuracy, on-wafer measurement, probe}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/effects-degrading-accuracy-of-cpw-mtrl-calibration-at-w-band}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, event_place = {Philadelphia}, event_name = {2018 IEEE/MTT-S International Microwave Symposium - IMS}, event_date = {10-06-2018 to 15-06-2018}, language = {30}, DOI = {10.1109/MWSYM.2018.8439837}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Heinrich, W. and Probst, T. and Arz, U.} } @Article { MaheSHDMPLOC2018, subid = {896}, title = {Investigation of new volumetric non-destructive techniques to characterise additive manufacturing parts}, journal = {Welding in the World}, year = {2018}, month = {6}, volume = {62}, number = {5}, number2 = {15HLT09: MetAMMI: Metrology for additively manufactured medical implants}, pages = {1049-1057}, keywords = {Additive manufacturing, Volumetric non-destructive techniques (NDTs), Archimedes’ method, Gas pycnometric method, Multi-frequency eddy current method, C-scan ultrasound method}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature America, Inc}, language = {30}, ISSN = {0043-2288, 1878-6669}, DOI = {10.1007/s40194-018-0593-7}, stag_bib_extends_levelofaccess = {NA}, author = {Obaton, A.F. and Le, M.Q. and Prezza, V. and Marlot, D. and Delvart, P. and Huskic, A. and Senck, S. and Mah{\'e}, E. and Cayron, C.} } @Article { LuoHLCSZCPPG2018, subid = {1169}, title = {Chinese SPRIGT realizes high temperature stability in the range of 5–25 K}, journal = {Science Bulletin}, year = {2018}, month = {6}, volume = {63}, number = {12}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {733-734}, keywords = {low-temperature, cryogenic temperature, primary thermometry, refractive-index gas thermometry, microwave resonator}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2095-9273}, DOI = {10.1016/j.scib.2018.05.023}, stag_bib_extends_levelofaccess = {NA}, author = {Gao, B. and Pan, C. and Pitre, L. and Chen, H. and Chen, Y. and Zhang, H. and Song, Y. and Liu, W. and Han, D. and Luo, E.} } @Article { DebogovicISAPdM2018, title = {3D printed microwave cavity for atomic clock applications: proof of concept}, journal = {Electronics Letters}, year = {2018}, month = {5}, day = {31}, volume = {54}, number = {11}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {691-693}, keywords = {three-dimensional printing, rapid prototyping (industrial), atomic clocks, microwave resonators, polymers, coatings, 3D printed microwave cavity, additively manufactured microwave resonator cavity, AM microwave resonator cavity, double-resonance vapour-cell atomic clock application, DR vapour-cell atomic clock application, loop-gap resonator approach, conventionally-machined aluminium component, metal-coated polymer, clock short-term stability}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Institution of Engineering and Technology (IET)}, language = {30}, ISSN = {0013-5194, 1350-911X}, DOI = {10.1049/el.2017.4176}, stag_bib_extends_levelofaccess = {NA}, author = {Debogovic, T. and Ivanov, A.E. and Skrivervik, A.K. and Affolderbach, C. and Pellaton, M. and de Rijk, E. and Mileti, G.} } @Proceedings { BymanLHBSS2018, subid = {870}, title = {Online measurement of optical fibre geometry during manufacturing}, journal = {Proc. SPIE}, year = {2018}, month = {5}, day = {17}, volume = {10683}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {1068318}, keywords = {fibre, manufacturing, concentricity, scatterometry, modelling}, web_url = {https://arxiv.org/abs/1806.07596}, misc2 = {EMPIR 2014: Industry}, publisher = {SPIE}, event_place = {Strasbourg}, event_name = {Fiber Lasers and Glass Photonics: Materials through Applications}, event_date = {22-04-2018 to 26-04-2018}, language = {30}, DOI = {10.1117/12.2314762}, stag_bib_extends_levelofaccess = {NA}, author = {Shpak, M. and Burger, S. and Haapalainen, M. and Lassila, A. and Byman, V. and Saastamoinen, K.} } @Article { LiuHSFB2018, subid = {822}, title = {Fast and cost-effective in-process defect inspection for printed electronics based on coherent optical processing}, journal = {Optics Express}, year = {2018}, month = {5}, day = {16}, volume = {26}, number = {11}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {13927}, keywords = {all-optical difference engine, defects, detection, printed electronics, roll-to-roll, Fourier optics and signal processing, Spatial filtering, Imaging systems, Optical inspection, Optical sensing and sensors}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-26-11-13927}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.013927}, stag_bib_extends_levelofaccess = {NA}, author = {Feng, X. and Su, R. and Happonen, T. and Liu, J. and Leach, Richard} } @Proceedings { PousASTOC2018, subid = {765}, title = {FFT-based time domain solution to power frequency issue of CS101 testing for military and aerospace equipment}, journal = {2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility (EMC/APEMC)}, year = {2018}, month = {5}, day = {14}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {177-182}, keywords = {Aerospace, CS101, EMC, Immunity, Military, Time Domain}, web_url = {http://rfmw.cmi.cz/documents/papers/Cakir_FFT_TDS_CS101.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Singapore}, event_name = {2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility}, event_date = {14-05-2018 to 18-05-2018}, language = {30}, ISBN = {978-1-5090-5997-3}, DOI = {10.1109/ISEMC.2018.8393762}, stag_bib_extends_levelofaccess = {NA}, author = {\c{C}akır, S. and Ozturk, M. and Tektas, B. and Şen, O. and Acak, S. and Pous, M.} } @Article { SparnacciSMU2018, subid = {551}, title = {Shell thickness determination for PTFE-PS core-shell nanoparticles using scanning transmission X-ray microscopy (STXM)}, journal = {Surface and Interface Analysis}, year = {2018}, month = {5}, day = {10}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, keywords = {core-shell nanoparticles, polymers, PS, PTFE, SEM, STXM}, web_url = {https://opus4.kobv.de/opus4-bam/frontdoor/index/index/docId/44970}, misc2 = {EMPIR 2014: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.6464}, stag_bib_extends_levelofaccess = {NA}, author = {M{\"u}ller, A. and Swaraj, S. and Sparnacci, K. and Unger, W.E.S.} } @Article { WangXSLXG2018, subid = {795}, title = {Single Layer PCB Broadband Circular Polarisation Millimetre Wave Massive MIMO Array}, journal = {EuCAP}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {circular polarisation, millimetre wave, antenna, MIMO.}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1809.07818}, author = {Wang, M. and Xing, L. and Stanley, M. and Loh, T. H. and Xu, Q. and Gan, H.} } @Article { BuismanSSN2018, subid = {798}, title = {An Inter-Laboratory Comparison of NVNA Measurements}, journal = {INMMIC}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Nonlinear microwave measurements, NVNA, measurement comparison}, web_url = {http://arxiv.org/abs/1809.07301}, misc2 = {EMPIR 2014: Industry}, language = {30}, DOI = {10.1109/INMMIC.2018.8430012}, stag_bib_extends_levelofaccess = {NA}, author = {Salter, M and Stant, L and Buisman, K and Nielsen, T} } @Article { AxnerZHS2018, subid = {804}, title = {Gas modulation refractometry for high-precision assessment of pressure under non-temperature-stabilized conditions}, journal = {Journal of Vacuum Science \& Technology A: Vacuum, Surfaces, and Films}, year = {2018}, month = {5}, volume = {36}, number = {3}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {03E105}, keywords = {GAs modulation refractometry, Fabry Perot cavity refractometry}, misc2 = {EMPIR 2014: Industry}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5022244}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Hausmaninger, T. and Zelan, M. and Axner, O.} } @Article { SavioLSSCM2018, subid = {824}, title = {Fusion of photogrammetry and coherence scanning interferometry data for all-optical coordinate measurement}, journal = {CIRP Annals}, year = {2018}, month = {5}, volume = {67}, number = {1}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {599-602}, keywords = {Data fusion, Surface topography, Interferometry, Photogrammetry, Coordinate measurement}, web_url = {https://www.sciencedirect.com/science/article/pii/S0007850618300672?via\%3Dihub}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0007-8506}, DOI = {10.1016/j.cirp.2018.04.043}, stag_bib_extends_levelofaccess = {NA}, author = {Leach, R. and Sims-Waterhouse, D. and Medeossi, F. and Savio, E. and Carmignato, S. and Su, R.} } @Miscellaneous { BastuckKS, subid = {1019}, title = {Condition monitoring of hydraulic systems Data Set}, journal = {Zenodo Community}, year = {2018}, month = {4}, day = {26}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {sensor network, condition monitoring, hydraulic}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.1323610}, stag_bib_extends_levelofaccess = {NA}, author = {Bastuck, M. and Klein, S. and Schneider, T.} } @Article { HeinrichSPHDKA2018, subid = {1053}, title = {Traceable Coplanar Waveguide Calibrations on Fused Silica Substrates up to 110 GHz}, journal = {IEEE TRANSACTIONS ON MICROWAVE THEORY AND TECHNIQUES}, year = {2018}, month = {4}, day = {19}, volume = {t.b.d.}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1-10}, keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=8693763}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TMTT.2019.2908857}, stag_bib_extends_levelofaccess = {NA}, author = {Arz, U. and Kuhlmann, K. and Dziomba, T. and Hechtfischer, G. and Phung, G. and Schm{\"u}ckle, F. and Heinrich, W.} } @Article { SchmidtLGMD2018, subid = {587}, title = {Atomic clocks for geodesy}, journal = {Reports on Progress in Physics}, year = {2018}, month = {4}, day = {18}, volume = {81}, number = {6}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {064401}, keywords = {Atomic Clocks, Geodesy, Optical Frequency Standard}, web_url = {https://arxiv.org/abs/1803.01585}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0034-4885, 1361-6633}, DOI = {10.1088/1361-6633/aab409}, stag_bib_extends_levelofaccess = {NA}, author = {Mehlst{\"a}ubler, T.E. and Grosche, G. and Lisdat, C. and Schmidt, P.O. and Denker, H.} } @Article { SchmidtLGMD2018_2, subid = {587}, title = {Atomic clocks for geodesy}, journal = {Reports on Progress in Physics}, year = {2018}, month = {4}, day = {18}, volume = {81}, number = {6}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {064401}, keywords = {optical clocks, chronometric levelling, optical frequency transfer, atomic clocks,geoid mapping, gravity field modelling}, web_url = {https://arxiv.org/abs/1803.01585}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0034-4885, 1361-6633}, DOI = {10.1088/1361-6633/aab409}, stag_bib_extends_levelofaccess = {NA}, author = {Mehlst{\"a}ubler, T.E. and Grosche, G. and Lisdat, C. and Schmidt, P.O. and Denker, H.} } @Article { RedondasSSEMNKS2018, title = {Optical characterisation of three reference Dobsons in the ATMOZ Project – verification of G. M. B. Dobson's original specifications}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {4}, volume = {11}, number = {4}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {1989-1999}, keywords = {Total Ozone Column, spectrophotometers, Dobson, slit function, effective absorption coefficents}, web_url = {https://www.atmos-meas-tech.net/11/1989/2018/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-1989-2018}, stag_bib_extends_levelofaccess = {NA}, author = {Redondas, A. and Stanek, M. and Smid, M. and Evans, R. and McConville, G. and Nevas, S. and K{\"o}hler, U. and Sch{\"o}nenborn, F.} } @Article { MarquesBMHIPSGS2018_2, subid = {520}, title = {Theoretical and experimental determination of K- and L-shell x-ray relaxation parameters in Ni}, journal = {Physical Review A}, year = {2018}, month = {4}, volume = {97}, number = {4}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {042501}, keywords = {Electronic Structure, X-ray Fluorescence, Fundamental Parameters, Fluorescence Yields, Condensed matter}, web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.97.042501}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.97.042501}, stag_bib_extends_levelofaccess = {NA}, author = {Guerra, M. and Sampaio, J. M. and Parente, F. and Indelicato, P. and Honicke, P. and Muller, M. and Beckhoff, B. and Marques, J. P. and Santos, J. P.} } @Article { LassilaNS2018, subid = {549}, title = {Metrological characterization methods for confocal chromatic line sensors and optical topography sensors}, journal = {Measurement Science and Technology}, year = {2018}, month = {4}, volume = {29}, number = {054008}, number2 = {14IND09: MetHPM: Metrology for highly-parallel manufacturing}, pages = {054008}, keywords = {optical sensors, calibration, metrology, optical scanners}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, address = {Bristol?}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/1361-6501/aaad2b}, stag_bib_extends_levelofaccess = {NA}, author = {Sepp{\"a}, J. and Niemel{\"a}, K. and Lassila, A.} } @Article { KovaS2018, title = {Subtraction of natural radiation contribution from gamma-ray spectra measured by HPGe detector}, journal = {Applied Radiation and Isotopes}, year = {2018}, month = {4}, volume = {134}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {167-171}, keywords = {HPGe detectors, Monte Carlo simulations, Airborne radioactivity measurement, Early warning networks,, Natural radionuclides subtraction}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.07.024}, stag_bib_extends_levelofaccess = {NA}, author = {Kov{\'a}ř, P. and Solc, J.} } @Article { KajastieOPSSPH2018, title = {Effects of Sample Handling and Transportation on the Moisture Content of Biomass Samples}, journal = {International Journal of Thermophysics}, year = {2018}, month = {4}, volume = {39}, number = {5}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Biomass, Moisture content, Sample handling, Transportation}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-018-2382-3}, stag_bib_extends_levelofaccess = {NA}, author = {Kajastie, H. and Ojanen-Saloranta, M. and Patel, S. and Sairanen, H. and Salminen, J. and Palkova, Z. and Heinonen, M.} } @Article { LopezASLXP2018, subid = {1099}, title = {Studying the fundamental limit of optical fiber links to the 10−21 level}, journal = {Optics Express}, year = {2018}, month = {4}, volume = {26}, number = {8}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {9515}, keywords = {Fiber optics links and subsystems; Metrological instrumentation; Metrology; Phase measurement}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.009515}, stag_bib_extends_levelofaccess = {NA}, author = {Lopez, O. and Amy-Klein, A. and Stefani, F. and Lee, W.K. and Xu, D. and Pottie, P.E.} } @Article { LopezASLXP20180, subid = {837}, title = {Studying the fundamental limit of optical fiber links to the 10−21 level}, journal = {Optics Express}, year = {2018}, month = {4}, volume = {26}, number = {8}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {9515}, keywords = {Fiber optics links and subsystems; Metrological instrumentation; Metrology; Phase measurement}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.009515}, stag_bib_extends_levelofaccess = {NA}, author = {Xu, D. and Lee, W.K. and Stefani, F. and Lopez, O. and Amy-Klein, A. and Pottie, P.E.} } @Article { ShardKGSGSM2018, subid = {568}, title = {Measuring the size and density of nanoparticles by centrifugal sedimentation and flotation}, journal = {Analytical Methods}, year = {2018}, month = {3}, day = {29}, volume = {2018}, number = {10}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {1725-1732}, keywords = {nanoparticles, centrifugal, sedimentation, flotation, SAXS, measurement, characterisation}, web_url = {http://pubs.rsc.org/en/content/articlelanding/2018/ay/c8ay00237a\#!divAbstract}, misc2 = {EMPIR 2014: Industry}, publisher = {Royal Society of Chemistry}, language = {30}, ISSN = {ISSN 1759-9679}, DOI = {10.1039/c8ay00237a}, stag_bib_extends_levelofaccess = {NA}, author = {Minelli, C. and Sikora, A. and Garcia-Diez, R. and Sparnacci, K. and Gollwitzer, C. and Krumrey, M. and Shard, A.} } @Article { TabandehBSRCM2018, title = {Development of a low frost-point generator operating at sub-atmospheric pressure}, journal = {Measurement Science and Technology}, year = {2018}, month = {3}, day = {16}, volume = {29}, number = {5}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {054002}, keywords = {hygrometry, humidity generator, frost point, upper-air sensors}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aaa785}, stag_bib_extends_levelofaccess = {NA}, author = {Tabandeh, S. and Beltramino, G. and Smorgon, D. and Rosso, L. and Cuccaro, R. and Mana, G.} } @Article { RawsonHAS2018, subid = {841}, title = {Electrochemically stimulating developments in bioelectronic medicine}, journal = {Bioelectronic Medicine}, year = {2018}, month = {3}, day = {15}, volume = {4}, number = {1}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, keywords = {Bioelectronic interfaces, Bioelectrochemistry, Nanobioelectronics, Cellular signalling}, web_url = {https://link.springer.com/content/pdf/10.1186\%2Fs42234-018-0001-z.pdf}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature}, language = {30}, ISSN = {2332-8886}, DOI = {10.1186/s42234-018-0001-z}, stag_bib_extends_levelofaccess = {NA}, author = {Sanjuan-Alberte, P. and Alexander, M.R. and Hague, R.J.M. and Rawson, F.J.} } @Article { deRijkSPDIMAM2018, title = {Study of additive manufactured microwave cavities for pulsed optically pumped atomic clock applications}, journal = {Applied Physics Letters}, year = {2018}, month = {3}, day = {12}, volume = {112}, number = {11}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {113502}, keywords = {gap resonator, frequency stability, frequency standard}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/1.5019444}, stag_bib_extends_levelofaccess = {NA}, author = {de Rijk, E. and Skrivervik, A.K. and Pellaton, M. and Debogovic, T. and Ivanov, A.E. and Moreno, W. and Affolderbach, C. and Mileti, G.} } @Article { GilmoreTSH2018, subid = {559}, title = {SIMS of Organic Materials—Interface Location in Argon Gas Cluster Depth Profiles Using Negative Secondary Ions}, journal = {Journal of The American Society for Mass Spectrometry}, year = {2018}, month = {2}, day = {21}, volume = {29}, number = {4}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {774-785}, keywords = {SIMS}, web_url = {https://link.springer.com/article/10.1007\%2Fs13361-018-1905-2}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer US}, language = {30}, ISSN = {1044-0305, 1879-1123}, DOI = {10.1007/s13361-018-1905-2}, stag_bib_extends_levelofaccess = {NA}, author = {Havelund, R. and Seah, M. P. and Tiddia, M. and Gilmore, I. S.} } @Proceedings { TunnermannESLW2018, subid = {906}, title = {Measurement and removal of cladding light in high power fiber systems}, journal = {Proceeding of the SPIE}, year = {2018}, month = {2}, day = {20}, volume = {10513}, number2 = {waveguides and applications}, pages = {105130U}, keywords = {Fiber laser, high power laser, cladding light, fiber characterization, fiber system measurement, fiber laser measurement, double clad fiber}, web_url = {https://www.spiedigitallibrary.org/conference-proceedings-of-spie/10513/2288266/Measurement-and-removal-of-cladding-light-in-high-power-fiber/10.1117/12.2288266.full?SSO=1}, misc2 = {EMPIR 2014: Industry}, publisher = {SPIE}, event_place = {San Francisco}, event_name = {Components and Packaging for Laser Systems IV}, event_date = {30-01-2018 to 01-02-2018}, language = {30}, DOI = {10.1117/12.2288266}, stag_bib_extends_levelofaccess = {NA}, author = {Walbaum, T. and Liem, A. and Schreiber, T. and Eberhardt, R. and T{\"u}nnermann, A.} } @Article { SylvainCHF2018, title = {Exploitation of a novel thermo-invariant multi-feature bar for high-precision CMMs and machine tool testing}, journal = {The International Journal of Advanced Manufacturing Technology}, year = {2018}, month = {2}, day = {18}, volume = {96}, number = {1-4}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {947–961}, keywords = {Material standard; Calibration; Geometric errors; Intercomparison; Traceability}, web_url = {https://link.springer.com/article/10.1007/s00170-017-1572-7\#enumeration}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Springer London}, language = {30}, ISSN = {1433-3015}, DOI = {10.1007/s00170-017-1572-7}, stag_bib_extends_levelofaccess = {NA}, author = {Sylvain, L. and Christophe, T. and Hichem, N. and Fabien, V.} } @Article { EhlersSPPODBS2018, subid = {808}, title = {Calibration methods for negative gauge pressure down to  −100 kPa}, journal = {Measurement Science and Technology}, year = {2018}, month = {2}, day = {17}, volume = {29}, number = {3}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {035007}, keywords = {negative gauge pressure, piston pressure gauge, differential pressure, pressure, calibration, barometer, manometer calibration}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa92ea}, stag_bib_extends_levelofaccess = {NA}, author = {Bentouati, D. and Durgut, Y. and Otal, P. and Plimmer, M. and Praž{\'a}k, D. and Sabuga, W. and Ehlers, S. and Sınır, E.} } @Article { CostanzoZBTBRPTMZRBTDVLHSVKGCLC2018, subid = {812}, title = {Geodesy and metrology with a transportable optical clock}, journal = {Nature Physics}, year = {2018}, month = {2}, day = {12}, volume = {14}, number = {5}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {437-441}, keywords = {optical fiber, optical frequency transfer}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-017-0042-3}, stag_bib_extends_levelofaccess = {NA}, author = {Costanzo, G.A. and Zucco, M. and Barbieri, P. and Tampellini, A. and Bregolin, F. and Rauf, B. and Pizzocaro, M. and Thoumany, P. and Margolis, H.S. and Zampaolo, M. and Rolland, A. and Baynes, F.N. and Timmen, L. and Denker, H. and Voigt, C. and Lisdat, C. and H{\"a}fner, S. and Sterr, U. and Vogt, S. and Koller, S. and Grotti, J. and Clivati, C. and Levi, F. and Calonico, D.} } @Article { StevenSRPGGGHPTB2018, title = {A calibration procedure for a traceable contamination analysis on medical devices by combined X-ray spectrometry and ambient spectroscopic techniques}, journal = {Journal of Pharmaceutical and Biomedical Analysis}, year = {2018}, month = {2}, volume = {150}, number = {1}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {308-317}, keywords = {XRF; Reference-free; N,N’-ethylene-bis (stearamide); Vibrational spectroscopy; Medical device}, web_url = {https://www.sciencedirect.com/science/article/abs/pii/S0731708517310609}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0731-7085}, DOI = {10.1016/j.jpba.2017.12.007}, stag_bib_extends_levelofaccess = {NA}, author = {Steven, R. and Seim, C. and Rossi, A. and Portesi, C. and Gunning, P. and Green, F. and Giovannozzi, A.M. and Hornemann, A. and Pollakowski-Herrmann, B. and Tyler, B. and Beckhoff, B.} } @Article { HudlickaPOPAS2018, subid = {597}, title = {Waveform Approach for Assessing Conformity of CISPR 16-1-1 Measuring Receivers}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2018}, month = {2}, volume = {67}, number = {5}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1187-1198}, keywords = {Receivers, Electromagnetic interference, Calibration, Current measurement, Standards, Real-time systems, Frequency measurement}, misc2 = {EMPIR 2015: Research Potential}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2794941}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://upcommons.upc.edu/handle/2117/116447}, author = {Azpurua, M.A. and Pous, M. and Oliva, J.A. and Pinter, B. and Hudlicka, M. and Silva, F.} } @Proceedings { SaverioPavoneCCGV2018, subid = {849}, title = {Optimization of Highly Inclined Optical Sheet Illumination for Super-Resolution Microscopy}, journal = {Biophysical Journal}, year = {2018}, month = {2}, volume = {114}, number = {3}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {14a}, keywords = {Highly Inclined and Laminated Optical sheet (HILO) microscopy, dSTORM}, web_url = {https://www.biophysics.org/Portals/0/EasyDNNnews/Uploads/2131/2018\%20Program-WEB.pdf}, misc2 = {EMPIR 2015: Health}, publisher = {Elsevier BV}, event_place = {Moscone Center}, event_name = {Biophysical Society 62nd Annual Meeting}, event_date = {17-02-2018 to 21-02-2018}, language = {30}, ISSN = {0006-3495}, DOI = {10.1016/j.bpj.2017.11.121}, stag_bib_extends_levelofaccess = {NA}, author = {Vignolini, T. and Gardini, L. and Curcio, V. and Capitanio, M. and Saverio Pavone, F.} } @Article { HauerSQK2018, subid = {1016}, title = {Polarization properties and microfacet-based modelling of white, grey and coloured matte diffuse reflection standards}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {2}, volume = {972}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {012024}, keywords = {Polarization, BRDF, Microfacet model, diffuse reflection Standards, BiRD-Project}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/972/1/012024}, stag_bib_extends_levelofaccess = {NA}, author = {Quast, T. and Schirmacher, A. and Hauer, K.O. and Koo, A.} } @Article { BarlowKGAWIOS2018, subid = {830}, title = {Development of large-area high-temperature fixed-point blackbodies for photometry and radiometry}, journal = {Metrologia}, year = {2018}, month = {2}, volume = {55}, number = {2}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {S43-S51}, keywords = {large-area high-temperature fixed point, blackbody, rhenium–carbon,tungsten carbide–carbon, photometry}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://link.springer.com/article/10.1007\%2Fs10765-017-2273-z}, author = {Barlow, C. and Khlevnoy, B. and Grigoryeva, I. and Anhalt, K. and Waehmer, M. and Ivashin, E. and Otryaskin, D. and Solodilov, M.} } @Article { PeikTLHS2018, subid = {558}, title = {Autobalanced Ramsey Spectroscopy}, journal = {Physical Review Letters}, year = {2018}, month = {1}, day = {30}, volume = {120}, number = {5}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {053602}, keywords = {atomic clock, atomic spectroscopy, light shift}, web_url = {https://www.ptb.de/cms/en/ptb/fachabteilungen/abt4/fb-44/44-literatur.html\#c8360}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.120.053602}, stag_bib_extends_levelofaccess = {NA}, author = {Sanner, C. and Huntemann, N. and Lange, R. and Tamm, C. and Peik, E.} } @Article { NovotnyDSKV2018, subid = {987}, title = {Characterization of the Si(Li) detector for Monte Carlo calculations of beta spectra}, journal = {Journal of Instrumentation}, year = {2018}, month = {1}, day = {24}, volume = {13}, number = {01}, number2 = {15SIB10: MetroBeta: Radionuclide beta spectra metrology}, pages = {P01021-P01021}, keywords = {Si(Li) detector, beta spectrometry, beta spectra, Monte Carlo simulations}, web_url = {https://arxiv.org/abs/1904.01294}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/13/01/P01021}, stag_bib_extends_levelofaccess = {NA}, author = {Novotny, P. and Dry{\'a}k, P. and Solc, J. and Kov{\'a}ř, P. and Vykydal, Z.} } @Article { ReitzensteinHRSKSFS2018_2, subid = {695}, title = {A stand-alone fiber-coupled single-photon source}, journal = {Scientific Reports}, year = {2018}, month = {1}, day = {22}, volume = {8}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1340}, keywords = {quantum-light source, semiconductor quantum dots}, web_url = {https://www.nature.com/articles/s41598-017-19049-4}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-19049-4}, stag_bib_extends_levelofaccess = {NA}, author = {Schlehahn, A. and Fischbach, S. and Schmidt, R. and Kaganskiy, A. and Strittmatter, A. and Rodt, S. and Heindel, T. and Reitzenstein, S.} } @Article { SaitoTTHSYHLSL2018, subid = {596}, title = {Random telegraph noise from resonant tunnelling at low temperatures}, journal = {Scientific Reports}, year = {2018}, month = {1}, day = {10}, volume = {8}, number = {1}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Random telegraph noise, Quantum dot, transistor}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-18579-1}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Yoshimoto, H. and Sasago, Y. and Hisamoto, D. and Tomita, I. and Tsuchiya, Y. and Saito, S.} } @Article { VermesseSLDBROGDDPDSGCP2018, title = {Feasibility of using a dose-area product ratio as beam quality specifier for photon beams with small field sizes}, journal = {Physica Medica}, year = {2018}, month = {1}, volume = {45}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {106-116}, keywords = {Dose-area product, Beam quality, DAP ratio, Small photon beams}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2017.12.012}, stag_bib_extends_levelofaccess = {NA}, author = {Vermesse, D. and Sommier, L. and Le Roy, M. and Daures, J. and Bordy, J.M. and Rapp, B. and Ostrowsky, A. and Gouriou, J. and Dufreneix, S. and Delaunay, F. and Petrucci, A. and De Coste, V. and Silvi, L. and Guerra, A.S. and Caporali, C. and Pimpinella, M.} } @Article { ScholzePEKHSB2018, subid = {478}, title = {Element sensitive reconstruction of nanostructured surfaces with finite elements and grazing incidence soft X-ray fluorescence}, journal = {Nanoscale}, year = {2018}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, keywords = {GIXRF, nanostructure characterization, FEM}, web_url = {https://arxiv.org/abs/1801.04157}, misc2 = {EMPIR 2014: Industry}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/C8NR00328A}, stag_bib_extends_levelofaccess = {NA}, author = {Soltwisch, V. and Honicke, P. and Kayser, Y. and Eilbracht, J. and Probst, J. and Scholze, F. and Beckhoff, B.} } @Article { SliwczynskiKT2018, subid = {527}, title = {Long haul time and frequency distribution in different DWDM systems}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2018}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {1-1}, keywords = {time and frequency transfer, DWDM network, optical fiber, alien wavelength}, web_url = {https://ieeexplore.ieee.org/document/8340172/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2018.2827178}, stag_bib_extends_levelofaccess = {NA}, author = {Turza, K. and Krehlik, P. and Śliwczyński, L.} } @Article { PortesiGISR2018, subid = {847}, title = {Development of a candidate reference sample for the characterization of tip-enhanced Raman spectroscopy spatial resolution}, journal = {RSC Advances}, year = {2018}, volume = {8}, number = {49}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {27863-27869}, keywords = {Tip-Enhanced Raman Spectroscopy (TERS); Scanning Probe Microscopy (SPM); Localized Surface Plasmon Resonance (LSPR); Electron Beam Lithography (EBL); STM-TERS imaging}, web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra03762k}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2046-2069}, DOI = {10.1039/c8ra03762k}, stag_bib_extends_levelofaccess = {NA}, author = {Sacco, A. and Imbraguglio, D. and Giovannozzi, A.M. and Portesi, C. and Rossi, A.M.} } @Proceedings { SebastianPerezSML2018, subid = {881}, title = {Study of influences in CEM’s new transfer standard for torque measurements in the MN·m range}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {transfer standard, torque measurements, influence quantities, force-lever system, nacelle test benches}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042039}, stag_bib_extends_levelofaccess = {NA}, author = {Lorente-Pedreille, R.M. and Medina-Mart{\'i}n, N. and S{\'a}enz-Nu{\~n}o, M.A. and Sebasti{\'a}n-P{\'e}rez, M.A.} } @Proceedings { StrangfeldBJK2018, subid = {880}, title = {Simulation method for the characterisation of the torque transducers in MN·m range}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {wind turbine test benches, torque measurement, multi-axial operation, rotational speed}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042014}, stag_bib_extends_levelofaccess = {NA}, author = {Kock, S. and Jacobs, G. and Bosse, D. and Strangfeld, F.} } @Proceedings { KummeSAFW2018, subid = {882}, title = {Investigations towards extrapolation approaches for torque transducer characteristics}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {torque transducers, traceable measurement, extrapolation, partial full range measurement, 20kN}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042057}, stag_bib_extends_levelofaccess = {NA}, author = {Weidinger, P. and Foyer, G. and Ala-Hiiro, J. and Schlegel, C. and Kumme, R.} } @Article { LohSZZZQ2018, subid = {892}, title = {Understanding the Temporal Fading in Wireless Industrial Networks: Measurements and Analyses}, journal = {Electrical Engineering and Systems Science - Signal Processing}, year = {2018}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Multipath fading, wireless industrial network, channel measurement ,impulse response ,Rician distribution}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1809.10871}, author = {Loh, T. H. and Shen, F. and Zhang, W. and Zhang, Q . and Zhang, Q. and Qin, F.} } @Article { StoicaTS2018, subid = {1103}, title = {Biphasic pKa Values}, journal = {Croatica Chemica Acta}, year = {2018}, volume = {91}, number = {4}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {599-602}, keywords = {acid strength, base strength, nonaqueous solvents, membranes, two-phase equilibria.}, web_url = {https://hrcak.srce.hr/215675}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Croatian Chemical Society}, language = {30}, ISSN = {0011-1643, 1334-417X}, DOI = {10.5562/cca3405}, stag_bib_extends_levelofaccess = {NA}, author = {Selberg, S. and Tshepelevitsh, S. and Leito, I.} } @Article { KoblarFSJPH2018, subid = {1156}, title = {Distribution and Accumulation of Major and Trace Elements in Gypsum Samples from Lignite Combustion Power Plant}, journal = {American Journal of Analytical Chemistry}, year = {2018}, volume = {09}, number = {12}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {602-621}, keywords = {Trace and Major Elements, Wet Flue Gas Desulphurization Gypsum, Particle Size Fractions, Mercury and Selenium, Sample Preparation}, misc2 = {EMPIR 2016: Environment}, publisher = {Scientific Research Publishing, Inc,}, language = {30}, ISSN = {2156-8251, 2156-8278}, DOI = {10.4236/ajac.2018.912044}, stag_bib_extends_levelofaccess = {NA}, author = {Pavlin, M. and Jaćimović, R. and Stergaršek, A. and Frkal, P. and Koblar, M. and Horvat, M.} } @Article { CouplandLTS2017, subid = {420}, title = {Effects of defocus on the transfer function of coherence scanning interferometry}, journal = {Optics Letters}, year = {2017}, month = {12}, day = {21}, volume = {43}, number = {1}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {82}, keywords = {Imaging systems , Interferometry, Metrology , Calibration , Microscopy, Aberrations}, web_url = {https://www.osapublishing.org/ol/fulltext.cfm?uri=ol-43-1-82}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.43.000082}, stag_bib_extends_levelofaccess = {NA}, author = {Su, R. and Thomas, M. and Leach, R. and Coupland, J.} } @Article { MeschkeFMSPB2017, subid = {506}, title = {On-and-off chip cooling of a Coulomb blockade thermometer down to 2.8 mK}, journal = {Applied Physics Letters}, year = {2017}, month = {12}, day = {18}, volume = {111}, number = {25}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {253105}, keywords = {nanoelectronic devices, thermometry}, web_url = {https://aip.scitation.org/doi/10.1063/1.5002565}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1708.09491}, author = {Meschke, M. and Feshchenko, A.V. and Maradan, D. and Scheller, C.P. and Palma, M. and Barlow, C.} } @Article { NeumaierDCBDS2017, title = {Recommendations to harmonize European early warning dosimetry network systems}, journal = {Journal of Instrumentation}, year = {2017}, month = {12}, day = {18}, volume = {12}, number = {12}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {P12024-P12024}, keywords = {data acquisition concepts, dosimetry concepts and apparatus, overall mechanics, design (support structures and materials, vibration analysis etc), radiation monitoring}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/12/12/P12024}, stag_bib_extends_levelofaccess = {NA}, author = {Neumaier, S. and Dabrowski, R. and Cort, M.D. and Bleher, M. and Dombrowski, H. and St{\"o}hlker, U.} } @Article { SterrRZSOBHLYMR2017, subid = {720}, title = {Ultrastable Silicon Cavity in a Continuously Operating Closed-Cycle Cryostat at 4 K}, journal = {Physical Review Letters}, year = {2017}, month = {12}, day = {15}, volume = {119}, number = {24}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, keywords = {ultrastable laser, silicon cavity, 4K cryocooler, time and frequency standards}, web_url = {https://arxiv.org/abs/1708.05161}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.119.243601}, stag_bib_extends_levelofaccess = {NA}, author = {Zhang, W. and Robinson, J. M. and Sonderhouse, L. and Oelker, E. and Benko, C. and Hall, J. L. and Legero, T. and Matei, D. G. and Riehle, F. and Sterr, U. and Ye, J.} } @Article { SliwczynskiSK2017, subid = {417}, title = {A Hybrid Solution for Simultaneous Transfer of Ultrastable Optical Frequency, RF Frequency, and UTC Time-Tags Over Optical Fiber}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2017}, month = {12}, volume = {64}, number = {12}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {1884-1890}, keywords = {Optical fibers, Optical variables control, Atom optics, Optical filters, Optical fiber communication, Time-frequency analysis}, web_url = {http://ieeexplore.ieee.org/document/8066317/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-3010}, DOI = {10.1109/TUFFC.2017.2759001}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Schnatz, H. and Śliwczyński, L.} } @Article { PivacPSDVFWKBHFDDB2017, subid = {544}, title = {Development and Synchrotron-Based Characterization of Al and Cr Nanostructures as Potential Calibration Samples for 3D Analytical Techniques}, journal = {physica status solidi (a)}, year = {2017}, month = {12}, volume = {215}, number = {6}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {1700866}, keywords = {SIMS, APT, GISAXS, 3D nanostructures, di-block copolymers}, misc2 = {EMPIR 2014: Industry}, publisher = {Wiley}, language = {30}, ISSN = {1862-6300}, DOI = {10.1002/pssa.201700866}, stag_bib_extends_levelofaccess = {NA}, author = {Dialameh, M. and Ferrarese Lupi, F. and Honicke, P. and Kayser, Y. and Beckhoff, B. and Weimann, T. and Fleischmann, C. and Vandervorst, W. and Dubček, P. and Pivac, B. and Perego, M. and Seguini, G. and De Leo, N. and Boarino, L.} } @Article { NielsenAKKIIHGFCCBHOOSS2017, title = {New Primary Standards for Establishing SI Traceability for Moisture Measurements in Solid Materials}, journal = {International Journal of Thermophysics}, year = {2017}, month = {12}, volume = {39}, number = {1}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Karl Fischer, Loss-on-drying, Moisture, Oven drying, Traceability}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2340-5}, stag_bib_extends_levelofaccess = {NA}, author = {Nielsen, J. and Aro, R. and Krasheninina, M. and Keawprasert, T. and Ismail, N. and Ionescu, G.V. and Hudoklin, D. and Georgin, E. and Fernicola, V. and Cortellessa, G. and Choi, B.I. and Bell, S. and Heinonen, M. and Oguz Aytekin, S. and {\"O}sterberg, P. and Skabar, J. and Strnad, R.} } @Proceedings { SchmuckleHPAZH2017, subid = {521}, title = {Establishing traceability for on-wafer S-parameter measurements of membrane technology devices up to 110 GHz}, journal = {2017 90th ARFTG Microwave Measurement Symposium (ARFTG)}, year = {2017}, month = {11}, day = {30}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {on-wafer, calibration, S-parameters, traceability,uncertainty budget}, web_url = {https://doi.org/10.1109/ARFTG.2017.8255874}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Boulder, Colorado}, event_name = {ARFTG Microwave Measurement Symposium}, event_date = {28-11-2017 to 01-12-2017}, language = {30}, ISBN = {978-1-5386-4356-3}, DOI = {10.7795/EMPIR.14IND02.CA.20190403}, stag_bib_extends_levelofaccess = {NA}, author = {Schmuckle, Franz-Josef and Heinrich, Wolfgang and Probst, Thorsten and Arz, Uwe and Zinal, Sherko and Hechtfischer, Gerd} } @Article { SassiLGWTMPLBPDCESK2017, title = {Preparation and analysis of zero gases for the measurement of trace VOCs in air monitoring}, journal = {Atmospheric Measurement Techniques Discussions}, year = {2017}, month = {11}, day = {28}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {1-17}, keywords = {zero gas, VOC measurements}, web_url = {https://www.atmos-meas-tech-discuss.net/amt-2017-412/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8610}, DOI = {10.5194/amt-2017-412}, stag_bib_extends_levelofaccess = {NA}, author = {Sassi, G. and Lecuna, M. and Ghorafi, Y. and Wortmann, R. and Tensing, E. and Michl, K. and Plass-Duelmer, C. and Li, J. and Baldan, A. and Persijn, S. and Demichelis, A. and Claude, A. and Englert, J. and Sassi, M.P. and Kubistin, D.} } @Article { EppingaDSNMKdKTPvWWMHBdvKGBJRKKTBPWL2017, subid = {602}, title = {First patients treated with a 1.5 T MRI-Linac: clinical proof of concept of a high-precision, high-field MRI guided radiotherapy treatment}, journal = {Physics in Medicine \& Biology}, year = {2017}, month = {11}, day = {14}, volume = {62}, number = {23}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {L41-L50}, keywords = {MRgRT, Radiotherapy, MRI}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aa9517}, stag_bib_extends_levelofaccess = {NA}, author = {Raaymakers, B W and J{\"u}rgenliemk-Schulz, I M and Bol, G H and Glitzner, M and Kotte, A N T J and van Asselen, B and de Boer, J C J and Bluemink, J J and Hackett, S L and Moerland, M A and Woodings, S J and Wolthaus, J W H and van Zijp, H M and Philippens, M E P and Tijssen, R and Kok, J G M and de Groot-van Breugel, E N and Kiekebosch, I and Meijers, L T C and Nomden, C N and Sikkes, G G and Doornaert, P A H and Eppinga, W S C and Kasperts, N and Kerkmeijer, L G W and Tersteeg, J H A and Brown, K J and Pais, B and Woodhead, P and Lagendijk, J J W} } @Article { SindelarovaSSSRdROdPNNMMLKKHHHHGGGGGGFEDDCCCCCdBBBBBSMSSSVUM2017, title = {The MeteoMet2 project – Highlights and results}, journal = {Measurement Science and Technology}, year = {2017}, month = {11}, day = {13}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Metrology for meteorology and climatology; atmospheric air temperature, humidity and pressuremeasurements; sea temperature and salinity measurements; albedo, soil moisture and permafrost; weatherstation; interlaboratory comparison}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa99fc/meta}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa99fc}, stag_bib_extends_levelofaccess = {NA}, author = {Šindel{\'a}rov{\'a}, L. and Sestan, D. and Salminen, J. and Sairanen, H. and Rosso, L. and del Rio, J. and Rasmussen, M.K. and Oguz Aytekin, S. and de Podesta, M. and Pavlasek, P. and Nogueras Cervera, M. and Nielsen, J. and Musacchio, C. and Miao, P. and Lanza, L.G. and Kowal, A. and Kalemci, M. and Hudoklin, D. and H{\"o}gstr{\"o}m, R. and Hernandez de la Villa, S. and Heinonen, M. and Groselj, D. and Gonzalez Calvo, A. and Georgin, E. and Gardiner, T. and Garc{\'i}a Izquierdo, C. and Garcia-Benad{\'i}, A. and Fernicola, V and Ebert, V. and Drnovsek, J. and Dobre, M. and Cuccaro, R. and Coppa, G. and Colli, M. and Chiodo, N. and Castrillo, A. and del Campo, D. and Brunet, M. and Bojkovski, J. and Beltramino, G. and Bell, S.A. and Beges, G. and Sanna, F. and Merlone, A. and Smorgon, D. and Sparasci, F. and Strnad, R. and Vold{\'a}n, M. and Underwood, R.J. and Mana, G.} } @Proceedings { SalterCR2017, subid = {528}, title = {'Mind the Gap'... Establishing Measurement Capability in the Terahertz Gap Region - from 0.1 THz to 1.1 THz}, journal = {ARMMS RF \& Microwave Society Conference, 13-14 Nov, 2017, Wyboston, Bedfordshire}, year = {2017}, month = {11}, day = {13}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {measurement, state-of-the-art of measurements, 0.1 THz to 1.1 THz frequency range, rectangular metallic waveguides, on-wafer planar circuits, bult material characterisations, Terahertz Gap}, web_url = {http://eprints.whiterose.ac.uk/125335/}, misc2 = {EMPIR 2014: Industry}, publisher = {ARMMS}, event_place = {Wyboston, Bedfordshire, UK}, event_name = {ARMMS RF \& Microwave Society Conference}, event_date = {13-11-2017 to 14-11-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://eprints.whiterose.ac.uk/125335/}, author = {Salter, M J and Clarke, R G and Ridler, N M} } @Article { CapogniDS2017_2, title = {A new approach in evaluating the surface beta contamination using the direct method of measurement}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {11}, volume = {129}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {135-141}, keywords = {Surface contamination, Method of measurement, Uncertainty of measurement}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804317303913?via\%3Dihub}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.018}, stag_bib_extends_levelofaccess = {NA}, author = {Capogni, M. and De Felice, P. and Stanga, D.} } @Proceedings { FieldSS2017, title = {Feasibility Study for PV Measurements at Varying Irradiances on a Large-Area Steady- State Solar Simulator}, journal = {EU PVSEC}, year = {2017}, month = {11}, volume = {33rd}, number = {33rd}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {1548-1553}, keywords = {Characterisation, Energy Rating, Irradiance Non-uniformity, Performance, Solar Simulator}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {WIP}, address = {Munich}, event_place = {Amsterdam}, event_name = {EU PVSEC}, event_date = {25-09-2017 to 29-09-2017}, language = {30}, ISBN = {3-936338-47-7}, DOI = {10.4229/EUPVSEC20172017-5BV.4.6}, stag_bib_extends_levelofaccess = {NA}, author = {Field, M and Sharlandzhiev, I and Salis, E} } @Proceedings { PavanelloZKMSG2017, title = {Comparison of Traceable Calibrations for Filtered Reference Cells}, journal = {EUPVSEC}, year = {2017}, month = {11}, volume = {33rd}, number = {33rd}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {1354-1358}, keywords = {Calibration, Reference Cell, Traceability, World Photovoltaic Scale (WPVS)}, web_url = {https://www.eupvsec-proceedings.com/proceedings?fulltext=Comparison+of+Traceable+Calibrations+for+Filtered+Reference+Cells\&paper=40434}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {WIP}, event_place = {Amsterdam}, event_name = {EU PVSEC}, event_date = {25-09-2017 to 29-09-2017}, language = {30}, ISBN = {3-936338-47-7}, DOI = {10.4229/EUPVSEC20172017-5BO.6.1}, stag_bib_extends_levelofaccess = {NA}, author = {Pavanello, D. and Zaaiman, W. and Kr{\"o}ger, I. and M{\"u}llejans, H. and Salis, E. and Galleano, R.} } @Article { GustavssonLSGHEF2017, subid = {319}, title = {Prediction of Nonlinear Distortion in Wideband Active Antenna Arrays}, journal = {IEEE}, year = {2017}, month = {11}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Active antenna array, antenna crosstalk, mismatch, multiple-input multiple-output (MIMO) transmitter (TX), power-amplifier (PA) modeling}, web_url = {https://research.chalmers.se/publication/252917/file/252917_Fulltext.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TMTT.2017.2699962}, stag_bib_extends_levelofaccess = {NA}, author = {Hausmair, K. and Gustafsson, S. and Sanchez-Perez, C. and Landin, P.N. and Gustavsson, U. and Eriksson, T. and Fager, C.} } @Article { UlmKECCSHFB2017, subid = {450}, title = {A pilot study on fingerprinting Leishmania species from the Old World using Fourier transform infrared spectroscopy}, journal = {Analytical \& Bioanalytical Chemistry}, year = {2017}, month = {10}, day = {28}, volume = {409}, number = {29}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {6907-6923}, keywords = {Fourier transforminfrared spectroscopy, Hierarchical cluster analysis (HCA), Principal componentsanalysis (PCA), Leishmania, DNA, Multivariate differentiation}, misc2 = {EMPIR 2015: Health}, publisher = {Springer}, language = {30}, ISSN = {1618-2642}, DOI = {10.1007/s00216-017-0655-5}, stag_bib_extends_levelofaccess = {NA}, author = {Hornemann, A. and Sinning, D. and Cortes, S. and Campino, L. and Emmer, P. and Kuhls, K. and Ulm, G. and Frohme, M. and Beckhoff, B.} } @Article { GilmoreHS2017, subid = {64}, title = {SIMS of Delta Layers in Organic Materials: Amount of Substance, Secondary Ion Species, Matrix Effects, and Anomalous Structures in Argon Gas Cluster Depth Profiles}, journal = {The Journal of Physical Chemistry C}, year = {2017}, month = {10}, day = {26}, volume = {120}, number = {46}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {26328–26335}, keywords = {mass-spectrometry, sputtering yields, response function, impurity layers, semiconductors, suppression, interfaces, emission, beams}, web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcc.6b08646}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society}, address = {Washington}, language = {30}, ISSN = {1932-7455}, DOI = {10.1021/acs.jpcc.6b08646}, stag_bib_extends_levelofaccess = {NA}, author = {Seah, M.P. and Havelund, R. and Gilmore, I.S.} } @Article { QuinceyVTSPMMHWBWWSN2017, subid = {956}, title = {Mobility particle size spectrometers: Calibration procedures and measurement uncertainties}, journal = {Aerosol Science and Technology}, year = {2017}, month = {10}, day = {26}, volume = {52}, number = {2}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {146-164}, keywords = {aerosol metrology , mobility particle size spectrometers , calibration, measurement uncertainties}, misc2 = {EMPIR 2016: Environment}, publisher = {Informa UK Limited}, language = {30}, ISSN = {0278-6826, 1521-7388}, DOI = {10.1080/02786826.2017.1387229}, stag_bib_extends_levelofaccess = {NA}, author = {Wiedensohler, A. and Wiesner, A. and Weinhold, K. and Birmili, W. and Hermann, M. and Merkel, M. and M{\"u}ller, T. and Pfeifer, S. and Schmidt, A. and Tuch, T. and Velarde, F. and Quincey, P. and Seeger, S. and Nowak, A.} } @Article { TunnermannESHLWSSPB2017, subid = {388}, title = {Measuring thermal load in fiber amplifiers in the presence of transversal mode instabilities}, journal = {Optics Letters}, year = {2017}, month = {10}, day = {18}, volume = {42}, number = {21}, number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {4311-4314}, keywords = {Fiber optics amplifiers and oscillators, Thermal effects, Fiber properties, High power lasers}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-42-21-4311}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society of America}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.42.004311}, stag_bib_extends_levelofaccess = {NA}, author = {Beier, F. and Pl{\"o}tner, M. and Sattler, B. and Stutzki, F. and Walbaum, T. and Liem, A. and Haarlammert, N. and Schreiber, T. and Eberhardt, R. and T{\"u}nnermann, A.} } @Article { WehmannLSTVASFNLZSHW2017, title = {Study of 3D-growth conditions for selective area MOVPE of high aspect ratio GaN fins with non-polar vertical sidewalls}, journal = {Journal of Crystal Growth}, year = {2017}, month = {10}, volume = {476}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {90-98}, keywords = {Crystal morphology, Metalorganic vapor phase epitaxy, Gallium compounds, Nitrides, Light emitting diodes}, web_url = {http://www.sciencedirect.com/science/article/pii/S0022024817305146}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0022-0248}, DOI = {10.1016/j.jcrysgro.2017.08.021}, stag_bib_extends_levelofaccess = {NA}, author = {Wehmann, H-H and Lugauer, H-J and Stra{\ss}burg, M. and Trampert, A. and Varghese, T. and Avramescu, A. and Schimpke, T. and F{\"u}ndling, S. and Nicolai, L. and Ledig, J. and Zhou, H. and Steib, F. and Hartmann, J. and Waag, A} } @Proceedings { FritzschDSPH2017, subid = {530}, title = {Impact of parasitic coupling on multiline TRL calibration}, journal = {2017 47th European Microwave Conference (EuMC)}, year = {2017}, month = {10}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {835-838}, keywords = {Measurements, probes, coupling, parasitic modes, em simulation}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/impact-of-parasitic-coupling-on-multiline-trl-calibration-1}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Nuremberg}, event_name = {2017 47th European Microwave Conference}, event_date = {10-10-2017 to 12-10-2017}, language = {30}, DOI = {10.23919/EuMC.2017.8230974}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G. N. and Schmuckle, F. J. and Doerner, R. and Fritzsch, T. and Heinrich, W.} } @Proceedings { NelsonNHFSH2017, title = {Optical voltage sensor for MV networks}, journal = {2017 IEEE SENSORS}, year = {2017}, month = {10}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {1-3}, keywords = {Fiber Bragg grating, optical voltage sensor, power system instrumentation, electronic voltage transformer}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Glasgow, UK}, event_name = {IEEE Sensors 2017}, event_date = {30-10-2017 to 01-11-2017}, language = {30}, DOI = {10.1109/ICSENS.2017.8234104}, stag_bib_extends_levelofaccess = {NA}, author = {Nelson, J. and Niewczas, P. and Havunen, J. and Fusiek, G. and Suomalainen, E-P. and H{\"a}llstr{\"o}m, J.} } @Proceedings { RietveldJPS2017, subid = {827}, title = {PMU-based power system analysis of a medium-voltage distribution grid}, journal = {CIRED - Open Access Proceedings Journal}, year = {2017}, month = {10}, volume = {2017}, number = {1}, number2 = {15NRM04: ROCOF: Standard tests and requirements for rate-of-change of frequency (ROCOF) measurements in smart grids}, pages = {1927-1930}, keywords = {phasor measurement, distribution networks, power grids, load flow, data acquisition}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Institution of Engineering and Technology (IET)}, event_place = {Glasgow}, event_name = {CIRED}, event_date = {12-06-2017 to 15-06-2017}, language = {30}, ISSN = {2515-0855}, DOI = {10.1049/oap-cired.2017.1035}, stag_bib_extends_levelofaccess = {NA}, author = {Save, N. and Popov, M. and Jongepier, A. and Rietveld, G.} } @Article { ShawWFZK2017, title = {Improving applied roughness measurement of involute helical gears}, journal = {Measurement Science and Technology}, year = {2017}, month = {9}, day = {20}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, keywords = {roughness measurement, gear surface texture, contact fatigue testing, involute gears, micro pitting}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa8dd6}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa8dd6}, stag_bib_extends_levelofaccess = {NA}, author = {Shaw, B.A. and Wilson, S.J. and Frazer, R. and Zhang, J. and Koulin, G.} } @Article { KabrtSBMRW2017, title = {Production and characterization of a traceable NORM material and its use in proficiency testing of gamma-ray spectrometry laboratories}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, day = {18}, volume = {134}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {45-50}, keywords = {Environmental radioactivity; Gamma-ray spectrometry; NORM; Reference material; Intercomparison; Interlaboratory comparison; Proficiency testing; Quartz sand; Drinking water treatment; Natural radionuclides}, web_url = {https://www.sciencedirect.com/science/article/pii/S0969804317305158}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2017.09.025}, stag_bib_extends_levelofaccess = {NA}, author = {Kabrt, F. and Stietka, M. and Baumgartner, A. and Maringer, F.J. and Riedl, J. and Wiedner, H.} } @Article { DeboliMCS2017, title = {Vineyard diseases detection: a case study on the influence of weather instruments' calibration and positioning}, journal = {Meteorological Applications}, year = {2017}, month = {9}, day = {15}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {weather station; positioning; agriculture; calibration; uncertainty; Metrology for Meteorology}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/met.1685/epdf}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1685}, stag_bib_extends_levelofaccess = {NA}, author = {Deboli, R. and Merlone, A. and Calvo, A. and Sanna, F.} } @Article { RiechelmannHEKGS2017, title = {The high-resolution extraterrestrial solar spectrum (QASUMEFTS) determined from ground-based solar irradiance measurements}, journal = {Atmospheric Measurement Techniques}, year = {2017}, month = {9}, day = {15}, volume = {10}, number = {9}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {3375-3383}, keywords = {extraterrestrail spectrum, QASUMEFTS, QASUME}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-10-3375-2017}, stag_bib_extends_levelofaccess = {NA}, author = {Riechelmann, S. and H{\"u}lsen, G. and Egli, L. and Kr{\"o}ger, I. and Gr{\"o}bner, J. and Sperfeld, P.} } @Article { SeguiniMLZIFDPRDB2017, subid = {480}, title = {Influence of block copolymer feature size on reactive ion etching pattern transfer into silicon}, journal = {Nanotechnology}, year = {2017}, month = {9}, day = {12}, volume = {28}, number = {40}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {404001}, keywords = {block copolymers, reactive ion etching, self-assembly, cryogenic RIE, holey silicon}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6528/aa8144}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-4484, 1361-6528}, DOI = {10.1088/1361-6528/aa8144}, stag_bib_extends_levelofaccess = {NA}, author = {Dialameh, M. and Ferrarese Lupi, F. and Imbraguglio, D. and Zanenga, F. and Lamperti, A. and Martella, D. and Seguini, G. and Perego, M. and Rossi, A.M. and De Leo, N. and Boarino, L.} } @Article { RotellaCMMVIDLNRSN2017, title = {Elemental depth profiling in transparent conducting oxide thin film by X-ray reflectivity and grazing incidence X-ray fluorescence combined analysis}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2017}, month = {9}, volume = {135}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {22-28}, keywords = {Combined >XRR-GIXRF, Depth profiling, thin films, TCO}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2017.06.011}, stag_bib_extends_levelofaccess = {NA}, author = {Rotella, H. and Caby, B. and M{\'e}nesguen, Y. and Mazel, Y. and Valla, A. and Ingerle, D. and Detlefs, B. and L{\'e}py, M.-C. and Novikova, A. and Rodriguez, G. and Streli, C. and Nolot, E.} } @Article { BrodnerHSSMR2017, title = {Reproducibly emitting reference materials for volatile and semi-volatile organic compounds—using finite element modeling for emission predictions}, journal = {Air Quality, Atmosphere \& Health}, year = {2017}, month = {9}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, keywords = {Emitting reference material, Emission test chamber, Micro-chamber, FEM model}, web_url = {https://link.springer.com/article/10.1007/s11869-017-0508-6}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature}, language = {30}, ISSN = {1873-9318, 1873-9326}, DOI = {10.1007/s11869-017-0508-6}, stag_bib_extends_levelofaccess = {NA}, author = {Br{\"o}dner, Doris and Horn, Wolfgang and Schultealbert, Caroline and Sauerwald, Tilman and Mull, Birte and Richter, Matthias} } @Article { FailleauHHPSRBZARGVSSKSPLG2017, title = {Metrology for decommissioning nuclear facilities: Partial outcomes of joint research project within the European Metrology Research Program}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Decommissioning, Sample preparation, Metrology}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.032}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Hay, B. and Holm, P. and Per{\"a}j{\"a}rvi, K. and Sand, J. and Rogiers, B. and Boden, S. and Zapata-Garc{\'i}a, D. and Arnold, D. and Russell, B. and Garcia Miranda, M. and Van Ammel, R. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Plumeri, S. and Laurent Beck, Y. and Grisa, T.} } @Article { BogucarskaPdJASSSKSTv2017, title = {New high-throughput measurement systems for radioactive wastes segregation and free release}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {nuclear decommissioning, radioactive waste, free release, clearance level}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.09.043}, stag_bib_extends_levelofaccess = {NA}, author = {Bogucarska, T. and Pedersen, B. and De Felice, P. and Jerome, S. and Arnold, D. and Skala, L. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Tzika, F. and Van Ammel, R.} } @Proceedings { ClarksonCHRS2017, title = {Validation of Algorithms to Estimate Distribution Network Characteristics Using Power-Hardware-in-the-Loop Configuration}, journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2017}, month = {9}, number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics}, keywords = {Network topology, Topology, Substations, Estimation, Current measurement, voltage measurement, Load flow}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Liverpool, United Kingdom}, event_name = {Applied Measurements for Power Systems}, event_date = {20-09-2017 to 22-09-2017}, language = {30}, ISBN = {978-1-5386-0343-7}, ISSN = {2475-2304}, DOI = {10.1109/AMPS.2017.8078349}, stag_bib_extends_levelofaccess = {NA}, author = {Clarkson, P. and Chretien, S. and Hong, Q. and Rohouma, I. and Segovia, M.} } @Proceedings { PousOAS2017, subid = {434}, title = {Robust extreme value estimation for full time-domain EMI measurements}, journal = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2017}, month = {9}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-6}, keywords = {Statistical signal processing, Extreme value estimation, Electromagnetic interference, Electromagneticmeasurements, Time-domain analysis}, web_url = {https://upcommons.upc.edu/handle/2117/116880}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, event_place = {Angers, France}, event_name = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {04-09-2017 to 07-09-2017}, language = {30}, ISBN = {978-1-5386-0689-6}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2017.8094729}, stag_bib_extends_levelofaccess = {NA}, author = {Azp{\'u}rua, Marco A. and Oliva, Jose A. and Pous, Marc and Silva, Ferran} } @Proceedings { PousAS2017, subid = {433}, title = {APD oudoors time-domain measurements for impulsive noise characterization}, journal = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2017}, month = {9}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-6}, keywords = {Amplitude Probability Distribution, Impulsive noise, In-situ measurements, Electromagnetic interference, Electromagnetic measurements, Time-domain analysis}, web_url = {https://upcommons.upc.edu/handle/2117/116885}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Angers, France}, event_name = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {04-09-2017 to 07-09-2017}, language = {30}, ISBN = {978-1-5386-0689-6}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2017.8094786}, stag_bib_extends_levelofaccess = {NA}, author = {Pous, M. and Azpurua, M.A. and Silva, F.} } @Proceedings { CakirS2017, subid = {598}, title = {Loop antenna calibrations with inclusion of vector network analyser and comparison between calibration methods}, journal = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2017}, month = {9}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-5}, keywords = {Calibration, Comparison, Loop Antenna, Network Analyser, Three Antenna}, web_url = {http://rfmw.cmi.cz/documents/papers/Sen_EMCEurope2017_OA.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Angers, France}, event_name = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {04-09-2017 to 07-09-2017}, language = {30}, ISBN = {978-1-5386-0689-6}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2017.8094694}, stag_bib_extends_levelofaccess = {NA}, author = {Şen, O. and \c{C}akır, S.} } @Proceedings { SauerwaldPKGS2017, title = {Performance Evaluation of Low-Cost BTEX Sensors and Devices within the EURAMET Key-VOCs Project}, journal = {Proceedings}, year = {2017}, month = {8}, day = {29}, volume = {1}, number = {4}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {425}, keywords = {PID based sensors, semiconductor and amperometric sensor, mini GC, portable on-line measuring devices, benzene, volatile organic compounds}, web_url = {http://www.mdpi.com/2504-3900/1/4/425}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {MDPI AG}, event_place = {Paris}, event_name = {Eurosensors2017}, event_date = {03-09-2017 to 06-09-2017}, language = {30}, ISSN = {2504-3900}, DOI = {10.3390/proceedings1040425}, stag_bib_extends_levelofaccess = {NA}, author = {Sauerwald, T. and Persijn, S. and Kok, G. and Gerboles, M. and Spinelle, L.} } @Proceedings { HilbertSKMP2017, subid = {464}, title = {PTB’s new standard impulse voltage divider for traceable calibrations up to 1 MV}, journal = {e-cigre.org}, year = {2017}, month = {8}, day = {28}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, keywords = {reference measuring system, lightning impulse,}, misc2 = {EMPIR 2014: Industry}, event_place = {Buenos Aires, Argentina}, event_name = {International symposium on high-voltage engineering 2017}, event_date = {28-08-2017 to 01-09-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://e-cigre.org/publication/ISH2017_415-ptbs-new-standard-impulse-voltage-divider-for-traceable-calibrations-up-to-1-mv}, author = {Hilbert, M. and Schierding, C. and Kurrat, M. and Meisner, J. and Passon, S.} } @Article { GrigoryevaGUTTKHAWKS2017, subid = {1175}, title = {Thermodynamic Temperature of High-Temperature Fixed Points Traceable to Blackbody Radiation and Synchrotron Radiation}, journal = {International Journal of Thermophysics}, year = {2017}, month = {8}, day = {16}, volume = {38}, number = {10}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, keywords = {Absolute radiometry, Blackbody radiation, Cryogenic substitution radiometer, Filter radiometer, High-temperature fixed points, Irradiance mode, Primary radiation standards, Ratio radiometry, Synchrotron radiation, Thermodynamic temperature}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2273-z}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}hmer, M. and Anhalt, K. and Hollandt, J. and Klein, R. and Taubert, R. D. and Thornagel, R. and Ulm, G. and Gavrilov, V. and Grigoryeva, I. and Khlevnoy, B. and Sapritsky, V.} } @Article { SuterSSPOMKHGFBAKLWS2017, title = {The CLARA/NORSAT-1 solar absolute radiometer: instrument design, characterization and calibration}, journal = {Metrologia}, year = {2017}, month = {8}, day = {10}, volume = {54}, number = {5}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {674-682}, keywords = {solar irradiance, satellite measurements, electrical substitution radiometer, cavity detector, sun}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa7a63}, stag_bib_extends_levelofaccess = {NA}, author = {Suter, M. and Spescha, M. and Soder, R. and Pfiffner, D, and Oliva, A.R. and Mingard, N. and Koller, S. and Heuerman, K. and Gyo, M. and Finsterle, W. and Beck, I. and Andersen, B. and Kopp, G. and Levesque, P.L. and Walter, B. and Schmutz, W.} } @Article { GuardamagnaLINCRCS2017, title = {Accurate particle speed prediction by improved particle speed measurement and 3-dimensional particle size and shape characterization technique}, journal = {Powder Technology}, year = {2017}, month = {8}, volume = {318}, number = {2017}, number2 = {IND61: Metrosion: Metrology to enable high temperature erosion testing}, pages = {95-109}, keywords = {Computed tomography, Particle shape, Particle size, Particle velocity, Shadow imaging, Sphericity}, web_url = {http://findit.dtu.dk/en/catalog/2363396961\&\#10;http://www.sciencedirect.com/science/article/pii/S0032591017304412}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0032-5910}, DOI = {10.1016/j.powtec.2017.05.042}, stag_bib_extends_levelofaccess = {NA}, author = {Guardamagna, C. and Lorenzoni, L. and Illemann, J. and Neuschaefer-Rube, U. and Clausen, S. and Rothleitner, C. and Cernuschi, F. and Skinner, E.} } @Article { GrisaSKS2017, title = {Monte Carlo optimization of shielding for novel industrial free release measurement facility}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, volume = {126}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {73-75}, keywords = {Decommissioning, Free release measurement, Monte Carlo simulations, Low level activity measurement}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804316305322?via\%3Dihub}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.12.032}, stag_bib_extends_levelofaccess = {NA}, author = {Grisa, T. and Šur{\'a}ň, J. and Kov{\'a}ř, P. and Solc, J.} } @Article { CapogniDS2017, title = {Efficiency transfer method applied to surface beta contamination measurements}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Efficiency transfer method, Calibration, Surface contamination measurement}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.009}, stag_bib_extends_levelofaccess = {NA}, author = {Capogni, M. and De Felice, P. and Stanga, D.} } @Article { StangaSBG2017, title = {Determination of the neutron activation profile of core drill samples by gamma-ray spectrometry}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Gamma spectrometry, Activity profile, Core sample, Concrete activation}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.004}, stag_bib_extends_levelofaccess = {NA}, author = {Stanga, D. and Sima, O. and Boden, S. and Gurau, D.} } @Article { NeuVSMSRGCPK2017, subid = {581}, title = {Calibration of multi-layered probes with low/high magnetic moments}, journal = {Scientific Reports}, year = {2017}, month = {8}, volume = {7}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {7224}, keywords = {Magnetic straz field, Magnetic force microscopy, multi-layered probe, Hall sensor.}, web_url = {https://www.nature.com/articles/s41598-017-07327-0}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-07327-0}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, V. and Corte-Le{\'o}n, H. and Gribkov, B. and Rodriguez, L.A. and Snoeck, E. and Manzin, A. and Simonetto, E. and Vock, S. and Neu, V. and Kazakova, O.} } @Article { GreilichKBKBSSP2017, subid = {601}, title = {Radiation dosimetry in magnetic fields with Farmer-type ionization chambers: determination of magnetic field correction factors for different magnetic field strengths and field orientations}, journal = {Physics in Medicine \& Biology}, year = {2017}, month = {8}, volume = {62}, number = {16}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {6708-6728}, keywords = {Dosimetry, MRgRT, Radiotherapy, Magnetic fields}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/aa7ae4}, stag_bib_extends_levelofaccess = {NA}, author = {Spindeldreier, C K and Schrenk, O and Bakenecker, A and Kawrakow, I and Burigo, L and Karger, C P and Greilich, S and Pfaffenberger, A} } @Article { StrohMHSSCSLT2017, title = {A low-energy set-up for gamma-ray spectrometry of NORM tailored to the needs of a secondary smelting facility}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {8}, volume = {126}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {296-299}, keywords = {210Pb, 210Po, Metallurgy, Industry, Gamma-ray spectrometry, Naturally occurring radionuclides}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.12.048}, stag_bib_extends_levelofaccess = {NA}, author = {Stroh, H. and Marissens, G. and Hult, M. and Schreurs, S. and Schroeyers, W. and Croymans, T. and Schreurs, I.V. and Lutter, G. and Tzika, F.} } @Article { DuaneFSBGSBR2017, subid = {429}, title = {Reply to Comment on ‘Development of a primary standard for absorbed dose from unsealed radionuclide solutions’}, journal = {Metrologia}, year = {2017}, month = {7}, day = {27}, volume = {54}, number = {4}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {615-616}, keywords = {dosimetry, radionuclide solution, extrapolation chamber, primary standard,validation of dose calculation}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa78ff/meta}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa78ff}, stag_bib_extends_levelofaccess = {NA}, author = {Billas, I and Shipley, D and Galer, S and Bass, G and Sander, T and Fenwick, A and Duane, S and Smyth, V.} } @Article { SuEL2017, subid = {418}, title = {High-precision lateral distortion measurement and correction in coherence scanning interferometry using an arbitrary surface}, journal = {Optics Express}, year = {2017}, month = {7}, day = {25}, volume = {25}, number = {16}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {18703}, keywords = {Image processing, Pattern recognition, Imaging systems, Metrology, Calibration, Microscopy}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-25-16-18703}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society of America}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.25.018703}, stag_bib_extends_levelofaccess = {NA}, author = {Ekberg, P. and Su, R. and Leach, R.} } @Article { HenriksenCST2017, subid = {404}, title = {Dynamics of bad-cavity-enhanced interaction with cold Sr atoms for laser stabilization}, journal = {Physical Review A}, year = {2017}, month = {7}, day = {24}, volume = {96}, number = {1}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {013847}, keywords = {laser stabilisation, atom-cavity dynamics}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Robert Kelly Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.96.013847}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/pdf/1704.08245.pdf}, author = {Sch{\"a}ffer, S. A. and Christensen, B. T. R. and Henriksen, M. R. and Thomsen, J. W.} } @Article { AntonovSMKCK2017, subid = {583}, title = {Hybrid normal metal/ferromagnetic nanojunctions for domain wall tracking}, journal = {Scientific Reports}, year = {2017}, month = {7}, day = {24}, volume = {7}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {6295}, keywords = {domain wall, magnetoresistance, permalloy}, web_url = {https://www.nature.com/articles/s41598-017-06292-y.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-06292-y}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Krzysteczko, P. and Manzin, A. and Schumacher, H.W. and Antonov, V. and Kazakova, O.} } @Article { LindstromdPSSGP2005_2, title = {Multiplexing Superconducting Qubit Circuit for Single Microwave Photon Generation}, journal = {Journal of Low Temperature Physics}, year = {2017}, month = {7}, day = {17}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {1-16}, keywords = {superconducting qubit, transmon, superconducting resonator, single photon generation}, web_url = {http://link.springer.com/article/10.1007/s10909-017-1787-x}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Verlag GmbH}, language = {30}, DOI = {10.1007/s10909-017-1787-x}, stag_bib_extends_levelofaccess = {NA}, author = {George, R. E. and Senior, J. and Saira, O.-P. and Pekola, J. P. and de Graaf, S. E. and Lindstrom, T. and Pashkin, Y. A.} } @Proceedings { AcakCS2017, subid = {201}, title = {More insight into conducted immunity tests and investigation of support influences}, journal = {2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)}, year = {2017}, month = {7}, day = {13}, volume = {2017}, number = {2017}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {124-126}, keywords = {CDN, Conducted Immunity, EMC, Loop Impedance, Support}, web_url = {http://rfmw.cmi.cz/documents/papers/Sen_APEMC2017_OA.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Seoul}, event_name = {2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)}, event_date = {20-06-2017 to 23-06-2017}, language = {30}, DOI = {10.1109/APEMC.2017.7975442}, stag_bib_extends_levelofaccess = {NA}, author = {Şen, O. and \c{C}akır, S. and Acak, S.} } @Article { FrazerESJCS2017, title = {Effects of profile errors on lubrication performance of helical gears}, journal = {Tribology International}, year = {2017}, month = {7}, volume = {111}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {184-191}, keywords = {gears, lubrication, profile errors, EHL}, web_url = {http://www.sciencedirect.com/science/article/pii/S0301679X17300944?via\%3Dihub}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0301-679X}, DOI = {10.1016/j.triboint.2017.02.034}, stag_bib_extends_levelofaccess = {NA}, author = {Frazer, R. and Evans, H.P. and Sharif, K.J. and Jamali, H.U. and Clarke, A. and Shaw, B.} } @Article { MasowskiLCCBAPMNNlLKBKMZCPBT2017, subid = {402}, title = {Fibre-optic delivery of time and frequency to VLBI station}, journal = {Astronomy \& Astrophysics}, year = {2017}, month = {7}, volume = {603}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {A48}, keywords = {high angular resolution instrumentation, interferometers}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {EDP Sciences}, language = {30}, ISSN = {0004-6361, 1432-0746}, DOI = {10.1051/0004-6361/201730615}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Buczek, L. and Kołodziej, J. and Lipiński, M. and Śliwczyński, Ł. and Nawrocki, J. and Nogaś, P. and Marecki, A. and Pazderski, E. and Ablewski, P. and Bober, M. and Ciuryło, R. and Cygan, A. and Lisak, D. and Masłowski, P. and Morzyński, P. and Zawada, M. and Campbell, R. M. and Pieczerak, J. and Binczewski, A. and Turza, K.} } @Proceedings { CamisardPLACWQCS2017, subid = {445}, title = {Progress on the REFIMEVE+ project for optical frequency standard dissemination}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, web_url2 = {https://www.eftf.org/previous-meetings/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/FCS.2017.8088897}, stag_bib_extends_levelofaccess = {NA}, author = {Cantin, E. and Quintin, N. and Wiotte, F. and Chardonnet, C. and Amy-Klein, A. and Lopez, O. and Pottie, P.E. and Santarelli, G. and Camisard, E.} } @Article { LopezLSPXA2017, subid = {440}, title = {Hybrid optical link for ultra-stable frequency comparison}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/FCS.2017.8088833}, stag_bib_extends_levelofaccess = {NA}, author = {Xu, D. and Lee, W.K. and Stefani, F. and Pottie, P.E. and Amy-Klein, A. and Lopez, O.} } @Proceedings { LeCoqANDTAALTSLXLP2017, subid = {446}, title = {Frequency comb-assisted QCL stabilization for high resolution molecular spectroscopy}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/FCS.2017.8088928}, stag_bib_extends_levelofaccess = {NA}, author = {Santagata, R. and Tran, D.B.A. and Lopez, O. and Argence, B. and Tokunaga, S.K. and Darqui{\'e}, B. and Amy-Klein, A. and Nicolodi, D. and Abgrall, M. and Le Coq, Y. and Le Targat, R. and Xu, D. and Lee, W.K. and Pottie, P.E.} } @Proceedings { SliwczynskiKBBT2017, subid = {443}, title = {Time and frequency transfer in modern DWDM telecommunication networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/fcs.2017.8088894}, stag_bib_extends_levelofaccess = {NA}, author = {Turza, K. and Binczewski, A. and Bogacki, W. and Krehlik, P. and Śliwczyński, L.} } @Proceedings { SliwczynskiKKIPESB2017, subid = {444}, title = {Fiber optic time transfer between PTB and Deutsche Telekom using multi-link redundant topology}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/FCS.2017.8088999}, stag_bib_extends_levelofaccess = {NA}, author = {Śliwczyński, L. and Krehlik, P. and Kolodziej, J. and Imlau, H. and Ender, H. and Schnatz, H. and Piester, D. and Bauch, A.} } @Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017, subid = {477}, title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fibre, network, clock, time, dissemination, service}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/FCS.2017.8089004}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Dostal, J. and Radil, J. and Smotlacha, V. and Velc, R. and Vojtech, J. and Campanella, M. and Calonico, D. and Clivati, C. and Levi, F. and Č{\'i}p, O. and Rerucha, S. and Holzwarth, R. and Lessing, M. and Camargo, F. and Desruelle, B. and Lautier-Gaud, J. and English, E.L. and Kronj{\"a}ger, J. and Whibberley, P. and Pottie, P.E. and Tavares, R. and Tuckey, P. and John, F. and Snajder, M. and Stefl, J. and Nogaś, P. and Urbaniak, R. and Binczewski, A. and Bogacki, W. and Turza, K. and Grosche, G. and Schnatz, H. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.} } @Proceedings { PousOAS2017_2, subid = {599}, title = {Fast and automated verification of multi-channel full time-domain EMI measurement systems}, journal = {2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2017}, month = {7}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-7}, keywords = {electromagnetic compatibility, electromagnetic interference, just-before-test, quality management, standards}, web_url = {https://upcommons.upc.edu/handle/2117/116687}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Turin, Italy}, event_name = {2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {22-05-2017 to 25-05-2017}, language = {30}, ISBN = {978-1-5090-3596-0}, DOI = {10.1109/I2MTC.2017.7969789}, stag_bib_extends_levelofaccess = {NA}, author = {Azpurua, M.A. and Oliva, J.A. and Pous, M. and Silva, F.} } @Article { HudlickaSBFH2017, subid = {769}, title = {Optical and RF metrology for 5G}, journal = {2017 IEEE Photonics Society Summer Topical Meeting Series (SUM)}, year = {2017}, month = {7}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {Optical variables measurement, 5G mobile communication, Transmission line measurements, Photodiodes, Adaptive optics, Optical fiber communication, Oscilloscopes}, web_url = {https://arxiv.org/abs/1809.08934}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/PHOSST.2017.8012717}, stag_bib_extends_levelofaccess = {NA}, author = {Humphreys, D.A. and Fatadin, I. and Bieler, M. and Struszewski, P. and Hudlicka, M.} } @Article { PersijnKGSS2017, title = {Review of Portable and Low-Cost Sensors for the Ambient Air Monitoring of Benzene and Other Volatile Organic Compounds}, journal = {Sensors}, year = {2017}, month = {6}, day = {28}, volume = {17}, number = {7}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {1520}, keywords = {PID based sensors; semiconductor and amperometric sensor; mini GC; portable on-line measuring devices; benzene; volatile organic compounds}, web_url = {http://www.mdpi.com/1424-8220/17/7/1520}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s17071520}, stag_bib_extends_levelofaccess = {NA}, author = {Persijn, S. and Kok, G. and Gerboles, M. and Spinelle, L. and Sauerwald, T.} } @Article { SeidelinGFLPGJGL2017, subid = {399}, title = {Dispersive heterodyne probing method for laser frequency stabilization based on spectral hole burning in rare-earth doped crystals}, journal = {Optics Express}, year = {2017}, month = {6}, day = {23}, volume = {25}, number = {13}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {15539}, keywords = {Metrological instrumentation, Fabry-Perot, Laser stabilization, Rare-earth-doped materials}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.25.015539}, stag_bib_extends_levelofaccess = {NA}, author = {Gobron, O. and Jung, K. and Galland, N. and Predehl, K. and Le Targat, R. and Ferrier, A. and Goldner, P. and Seidelin, S. and Le Coq, Y.} } @Article { HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017, subid = {141}, title = {Test of Special Relativity Using a Fiber Network of Optical Clocks}, journal = {Physical Review Letters}, year = {2017}, month = {6}, volume = {118}, number = {22}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, web_url = {https://arxiv.org/abs/1703.04426}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.118.221102}, stag_bib_extends_levelofaccess = {NA}, author = {Delva, P. and Lodewyck, J. and Bilicki, S. and Bookjans, E. and Vallet, G. and Le Targat, R. and Pottie, P.-E. and Guerlin, C. and Meynadier, F. and Le Poncin-Lafitte, C. and Lopez, O. and Amy-Klein, A. and Lee, W.-K. and Quintin, N. and Lisdat, C. and Al-Masoudi, A. and D{\"o}rscher, S. and Grebing, C. and Grosche, G. and Kuhl, A. and Raupach, S. and Sterr, U. and Hill, I. R. and Hobson, R. and Bowden, W. and Kronj{\"a}ger, J. and Marra, G. and Rolland, A. and Baynes, F. N. and Margolis, H. S. and Gill, P.} } @Article { PoglianoST2017_2, title = {Asynchronous Phase Comparator for Characterization of Devices for PMUs Calibrator}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {6}, volume = {66}, number = {6}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1139-1145}, keywords = {Analog–digital conversion, measurement standards, phase comparators,phasor measurement units (PMUs),resistive voltage dividers (RVDs)}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2648598}, stag_bib_extends_levelofaccess = {NA}, author = {Pogliano, U. and Serazio, D. and Trinchera, B.} } @Proceedings { KummeFSW2017, subid = {246}, title = {D6.2 - Characterisation of a 5 MN·m Torque Transducer by Combining Traditional Calibration and Finite Element Method Simulations}, journal = {Proceedings Sensor 2017}, year = {2017}, month = {6}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, pages = {516 - 521}, keywords = {torque calibration in the MN·m range, torque transfer standard, strain gauge simulation,torque range extension}, misc2 = {EMPIR 2014: Industry}, publisher = {AMA Service GmbH}, event_place = {N{\"u}rnberg, Germany}, event_name = {AMA Conferences 2017}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, ISBN = {978-3-9816876-4-4}, DOI = {10.5162/sensor2017/D6.2}, stag_bib_extends_levelofaccess = {NA}, author = {Weidinger, P. and Foyer, G. and Schlegel, C. and Kumme, R.} } @Article { JongepierPSR2017, title = {Pmu-Based Power System Analysis of A MV Distribution Grid}, journal = {Proceedings of CIRED 2017}, year = {2017}, month = {6}, volume = {1}, number = {1}, number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics}, pages = {1035}, keywords = {Power Systems, PMU, Smart Grids, Analysis}, web_url = {http://cired.net/publications/cired2017/pdfs/CIRED2017_1035_final.pdf;\&\#10;doi: 10.1049/oap-cired.2017.1035}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {CIRED}, address = {Glasgow}, language = {30}, ISBN = {978-178561-483-5}, ISSN = {2032-9644}, stag_bib_extends_levelofaccess = {NA}, author = {Jongepier, A and Popov, M and Save, N and Rietveld, G} } @Article { HerkommerRHSKTRGSTSFGR2017, subid = {412}, title = {Single Quantum Dot with Microlens and 3D-Printed Micro-objective as Integrated Bright Single-Photon Source}, journal = {ACS Photonics}, year = {2017}, month = {6}, volume = {4}, number = {6}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1327-1332}, keywords = {3D direct laser writing; 3D lithography; micro-objective; semiconductor quantum dot; single-photon source}, web_url = {http://pubs.acs.org/doi/ipdf/10.1021/acsphotonics.7b00253}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.7b00253}, stag_bib_extends_levelofaccess = {NA}, author = {Fischbach, S. and Schlehahn, A. and Thoma, A. and Srocka, N. and Gissibl, T. and Ristok, S. and Thiele, S. and Kaganskiy, A. and Strittmatter, A. and Heindel, T. and Rodt, S. and Herkommer, A. and Giessen, H. and Reitzenstein, S.} } @Proceedings { SchutzeKSGRSBL2017, title = {Highly sensitive benzene detection with MOS gas sensors}, journal = {Proceedings Sensor 2017}, year = {2017}, month = {6}, volume = {A4 - Gas S}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {92-97}, keywords = {metal oxide semiconductor, MOS, temperature-cycled operation, TCO, benzene}, web_url = {https://www.ama-science.org/proceedings/details/2498}, misc2 = {EMRP A169: Call 2013 Environment II}, event_place = {Nurember}, event_name = {AMA Conferences 2017 – SENSOR 2017}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, ISBN = {978-3-9816876-4-4}, DOI = {10.5162/sensor2017/A4.3}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}tze, Andreas and Kok, Gertjan and Spinelle, Laurent and Gerboles, Michel and Reimringer, Wolfhard and Sauerwald, Tilman and Baur, Tobias and Leidinger, Martin} } @Article { RollandGSGPF2017, title = {New Generation of Low-Frequency Current Comparators Operated at Room Temperature}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {6}, volume = {66}, number = {6}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {1417-1424}, keywords = {Cryogenic current comparator (CCC), Current comparator, Low-frequency, Resistance measurement, Sensitivity, Quantum Hall resistance}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2652198}, stag_bib_extends_levelofaccess = {NA}, author = {Rolland, B. and Gournay, P. and Satrapinski, A. and G{\"o}tz, M. and Pesel, E. and Fletcher, N.} } @Article { HeinrichSPAPD2017, subid = {516}, title = {Mutual interference in calibration line configurations}, journal = {2017 89th ARFTG Microwave Measurement Conference (ARFTG)}, year = {2017}, month = {6}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Coupling, em simulation, measurements, parasitic modes, probes}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/mutual-interference-in-calibration-line-configurations}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/ARFTG.2017.8000823}, stag_bib_extends_levelofaccess = {NA}, author = {Schmuckle, F.J. and Probst, T. and Arz, U. and Phung, G.N. and Doerner, R. and Heinrich, W.} } @Proceedings { WollensackHSRH2017, subid = {517}, title = {VNA tools II: Calibrations involving eigenvalue problems}, journal = {2017 89th ARFTG Microwave Measurement Conference (ARFTG)}, year = {2017}, month = {6}, volume = {1}, number = {1}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1-4}, keywords = {Vector Network Analyzer, S-parameters, Calibration, Uncertainty, Traceability}, web_url = {http://dx.doi.org/10.1109/ARFTG.2017.8000832}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Honolulu}, event_name = {Wollensack, Michael, et al.}, event_date = {09-06-2017 to 10-06-2017}, language = {30}, ISBN = {978-1-5386-2748-8}, DOI = {10.7795/EMPIR.14IND02.CA.20190404}, stag_bib_extends_levelofaccess = {NA}, author = {Wollensack, M. and Hoffmann, J. and Stalder, D. and Ruefenacht, J. and Hoffmann, J.} } @Article { XuCJSCPVHSC2017, subid = {574}, title = {Temperature dependence mitigation in stationary Fourier-transform on-chip spectrometers}, journal = {Optics Letters}, year = {2017}, month = {6}, volume = {42}, number = {11}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {2239}, keywords = {temperature, silicon on insulator, microspectrometer}, web_url = {https://digital.csic.es/handle/10261/164048}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.42.002239}, stag_bib_extends_levelofaccess = {NA}, author = {Herrero-Bermello, A. and Velasco, A.V. and Podmore, H. and Cheben, P. and Schmid, J.H. and Janz, S. and Calvo, M.L. and Xu, D.X and Scott, A. and Corredera, P.} } @Proceedings { SebastianLMS2017, subid = {245}, title = {Torque Tracebility for Nacelle's test benches: A design proposal}, journal = {IMEKO 23 rd}, year = {2017}, month = {6}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {wind turbine, torque, standard, nacelle test bench}, misc2 = {EMPIR 2014: Industry}, publisher = {International Measurement Confederation}, event_place = {Helsinki, Finland}, event_name = {IMEKO 23 rd TC3, 13 th TC5 and 4 th TC22 International Conference}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-004.pdf}, author = {Sebasti{\'a}n, M.A. and Lorente, R.M. and Medina-Mart{\'i}n, N. and S{\'a}enz, M.A.} } @Article { ClivatiLIDCSDCBI2017, subid = {140}, title = {Measuring molecular frequencies in the 1-10 µm range at 11-digits accuracy}, journal = {Atomic Physics (physics.atom-ph)}, year = {2017}, month = {5}, day = {18}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {molecular frequencies}, misc2 = {EMPIR 2015: SI Broader Scope}, language = {30}, DOI = {10.1038/s41598-017-12891-6}, stag_bib_extends_levelofaccess = {NA}, author = {Insero, G. and Borri, S. and Calonico, D. and Cancio Pastor, P. and Clivati, C. and D’Ambrosio, D. and De Natale, P. and Inguscio, M. and Levi, F. and Santambrogio, G.} } @Article { SchraderKSH2017, title = {Characterization of a 300-GHz Transmission System for Digital Communications}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2017}, month = {5}, day = {17}, volume = {38}, number = {8}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {1004-1018}, keywords = {Error vector magnitude, Waveform metrology, THz communication}, web_url = {https://link.springer.com/article/10.1007/s10762-017-0395-9}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {1866-6892, 1866-6906}, DOI = {10.1007/s10762-017-0395-9}, stag_bib_extends_levelofaccess = {NA}, author = {Schrader, T. and Kleine-Ostmann, T. and Salhi, M. and Hudlicka, M.} } @Article { LopezAPBSL2017, subid = {139}, title = {Hybrid fiber links for accurate optical frequency comparison}, journal = {Applied Physics B}, year = {2017}, month = {5}, volume = {123}, number = {5}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {Hybrid fiber links, accurate optical frequency comparison,}, web_url = {https://link.springer.com/article/10.1007/s00340-017-6736-5}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-017-6736-5}, stag_bib_extends_levelofaccess = {NA}, author = {Lee, W.K. and Stefani, F. and Bercy, A. and Lopez, O. and Amy-Klein, A. and Pottie, P.E.} } @Article { SantarelliLLCCMWKKCSNRQDLBRGGAWGALLPG2017, subid = {138}, title = {First international comparison of fountain primary frequency standards via a long distance optical fiber link}, journal = {Metrologia}, year = {2017}, month = {5}, volume = {54}, number = {3}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {348-354}, keywords = {optical fiber frequency transfer, atomic fountain clocks, international fountain, clock comparison}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa65fe}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa65fe}, stag_bib_extends_levelofaccess = {NA}, author = {Guena, J and Weyers, S and Abgrall, M and Grebing, C and Gerginov, V and Rosenbusch, P and Bize, S and Lipphardt, B and Denker, H and Quintin, N and Raupach, S M F and Nicolodi, D and Stefani, F and Chiodo, N and Koke, S and Kuhl, A and Wiotte, F and Meynadier, F and Camisard, E and Chardonnet, C and Le Coq, Y and Lours, M and Santarelli, G and Amy-Klein, A and Le Targat, R and Lopez, O and Pottie, P E and Grosche, G} } @Article { CowburnMCSFWK2017, subid = {251}, title = {Detection of individual iron-oxide nanoparticles with vertical and lateral sensitivity using domain wall nucleation in CoFeB/Pt nanodevices}, journal = {AIP Advances}, year = {2017}, month = {5}, volume = {7}, number = {5}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {056715}, keywords = {We present new studies of the characteristics and detection ability of nanoscale sensors based on domain wall nucleation within perpendicularly magnetised ultrathin CoFeB/Pt films. A combination of MFM imaging and anomalous Hall effect transport measurements were used to verify and characterise the behaviour of fabricated devices. After initial characterisation, the influence of magnetic nanoparticles on device behaviour was studied using individual iron oxide (FeOx) particles mounted on modified atomic force microscopy probes. We demonstrate the successful detection of particles ranging in diameter between 2.8 \(\mu\)m and 100 nm. In the case of the 2.8 \(\mu\)m particle, we have mapped the signal amplitude produced at a variety of distances from the sensor. We find that the particle’s influence may be detected at separations up to 700 nm. Furthermore, we demonstrate a method for resolving the location of a particle with respect to the centre of the device, providing a lateral sensing ability.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/1.4975357}, stag_bib_extends_levelofaccess = {NA}, author = {Wells, J. and Fern{\'a}ndez Scarioni, A. and Schumacher, H.W. and Cox, D. and Mansell, R. and Cowburn, R. and Kazakova, O.} } @Proceedings { StyblikovaD2017, title = {Magnetic shielding of Rogowski coils}, journal = {2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2017}, month = {5}, volume = {N/A}, number = {N/A}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {1467-1471}, keywords = {Rogowski coil; magnetic shielding; AC current}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Turin, Italy}, event_name = {Instrumentation and Measurement Technology Conference (I2MTC), 2017 IEEE International}, event_date = {22-05-2017 to 25-05-2017}, language = {30}, ISBN = {978-1-5090-3596-0}, DOI = {10.1109/I2MTC.2017.7969952}, stag_bib_extends_levelofaccess = {NA}, author = {Styblikova, R. and Draxler, K.} } @Article { SchmittWJRLSMK2017, subid = {604}, title = {Validation of 4D dose calculation using an independent motion monitoring by the calypso tracking system and 3D polymer gel dosimetry}, journal = {Journal of Physics: Conference Series}, year = {2017}, month = {5}, volume = {847}, number2 = {15HLT08: MRgRT: Metrology for MR guided radiotherapy}, pages = {012040}, keywords = {3D dosimetry, gel dosimeter, radiotherapy, MRgRT}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/847/1/012040}, stag_bib_extends_levelofaccess = {NA}, author = {Mann, P and Saito, N and Lang, C and Runz, A and Johnen, W and Witte, M and Schmitt, D and Karger, C P} } @Article { SchlegelFWK2017, subid = {241}, title = {Extending the Torque Calibration Range – Necessity and Outline of a Mathematical Approach}, journal = {Ukrainian Metrological Journal}, year = {2017}, month = {4}, day = {20}, number = {1A}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, pages = {57-60}, keywords = {Calibration; Measurement; Mathematical methods}, misc2 = {EMPIR 2014: Industry}, publisher = {National Scientific Centre Institute of Metrology}, language = {30}, ISSN = {2306-7039}, DOI = {10.24027/2306-7039.1A.2017.99993}, stag_bib_extends_levelofaccess = {NA}, author = {Weidinger, P. and Foyer, G. and Schlegel, C. and Kumme, R.} } @Article { HogstromGSSLH2017, title = {Characterization of the Humidity Calibration Chamber by Numerical Simulations}, journal = {International Journal of Thermophysics}, year = {2017}, month = {4}, volume = {38}, number = {6}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, keywords = {Calibration, Finite element method Humidity, calibration, Multiphysics, Simulation, Surface chemistry}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Springer Nature}, address = {One New York Plaza, Suite 4500 New York NY 10004-1562 United States}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2221-y}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}gstr{\"o}m, R. and Grahn, P. and Sairanen, H. and Salminen, J. and Lakka, A. and Heinonen, M.} } @Article { CarmeleRBSSSGSSvTHKR2017, subid = {234}, title = {A bright triggered twin-photon source in the solid state}, journal = {Nature Communications}, year = {2017}, month = {4}, volume = {8}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {14870}, keywords = {Quantum dots, Quantum optics, Single photons and quantum effects .}, web_url = {https://www.nature.com/articles/ncomms14870}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms14870}, stag_bib_extends_levelofaccess = {NA}, author = {Heindel, T. and Thoma, A. and von Helversen, M. and Schmidt, M. and Schlehahn, A. and Gschrey, M. and Schnauber, P. and Schulze, J. -H. and Strittmatter, A. and Beyer, J. and Rodt, S. and Carmele, A. and Knorr, A. and Reitzenstein, S.} } @Article { SchmidtSPKHSL2017, subid = {389}, title = {On-line estimation of local oscillator noise and optimisation of servo parameters in atomic clocks}, journal = {Metrologia}, year = {2017}, month = {4}, volume = {54}, number = {3}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {307-321}, keywords = {quantum projection noise, atomic frequency standards, local oscillator noise, servo optimisation}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa66e9}, stag_bib_extends_levelofaccess = {NA}, author = {Leroux, I.D. and Scharnhorst, N. and Hannig, S. and Kramer, J. and Pelzer, L. and Stepanova, M. and Schmidt, P.O.} } @Article { JehlBKCVSHLBKC2017, subid = {369}, title = {Design and Operation of CMOS-Compatible Electron Pumps Fabricated With Optical Lithography}, journal = {IEEE Electron Device Letters}, year = {2017}, month = {4}, volume = {38}, number = {4}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {414-417}, keywords = {Quantum dots, Quantum effect semiconductor devices, Quantization, Current control}, web_url = {https://arxiv.org/abs/1612.09547}, web_url2 = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0741-3106, 1558-0563}, DOI = {10.1109/LED.2017.2670680}, stag_bib_extends_levelofaccess = {NA}, author = {Clapera, P. and Klochan, J. and Lavieville, R. and Barraud, S. and Hutin, L. and Sanquer, M. and Vinet, M. and Cinins, A. and Barinovs, G. and Kashcheyevs, V. and Jehl, X.} } @Article { SpiritoG2017, subid = {522}, title = {Millimeter-Wave on-Wafer TRL Calibration employing 3D EM Simulation-Based Characteristic Impedance Extraction}, journal = {IEEE Transactions on Microwave Theory and Techniques}, year = {2017}, month = {4}, volume = {65}, number = {4}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {9}, keywords = {Calibration, characteristic impedance, measurement, millimeter wave, silicon, TRL, vector network analyzer (VNA)}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7837598}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, address = {Piscataway}, language = {30}, ISSN = {0018-9480}, DOI = {10.1109/TMTT.2016.2609413}, stag_bib_extends_levelofaccess = {NA}, author = {Galatro, Luca and Spirito, Marco} } @Article { VelascoVSVCSP2017, subid = {573}, title = {Demonstration of a compressive-sensing Fourier-transform on-chip spectrometer}, journal = {Optics Letters}, year = {2017}, month = {3}, day = {31}, volume = {42}, number = {7}, number2 = {waveguides and applications}, pages = {1440}, keywords = {Fourier transform, silicon on insulator, compressive sensing}, web_url = {https://digital.csic.es/handle/10261/163371}, misc2 = {EMPIR 2014: Industry}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.42.001440}, stag_bib_extends_levelofaccess = {NA}, author = {Podmore, H. and Scott, A. and Cheben, P. and Velasco, A.V. and Velasco, A.V. and Schmid, J.H. and Vachon, M.} } @Article { HusainLTYBSSTKFH2017, subid = {30}, title = {Single Carrier Trapping and De-trapping in Scaled Silicon Complementary Metal-Oxide-Semiconductor Field-Effect Transistors at Low Temperatures}, journal = {Semiconductor Science and Technology}, year = {2017}, month = {3}, day = {24}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Coulomb blockade, MOSFETs, Carrier Trapping and De-trapping, quantum dots}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0268-1242, 1361-6641}, DOI = {10.1088/1361-6641/aa6910}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Zuo and Husain, Muhammad and Yoshimoto, Hiroyuki and Tani, Kazuki and Sasago, Yoshitaka and Hisamoto, Digh and Fletcher, Jonathan and Kataoka, Masaya and Tsuchiya, Yoshishige and Saito, Shinichi} } @Article { GotzingerVPCLSMIBS2017, title = {Experimental demonstration of a predictable single photon source with variable photon flux}, journal = {Metrologia}, year = {2017}, month = {3}, day = {21}, volume = {54}, number = {2}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {218-223}, keywords = {single photon sources, single photon metrology, silicon vacancy center, low optical flux detector, photon on demand}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa5ba2}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}tzinger, S. and Vaigu, A. and Porrovecchio, G. and Chu, X.L. and Lindner, S. and Smid, M. and Manninen, A. and Ikonen, E. and Becher, C. and Sandoghdar, V.} } @Article { BrunzendorfWSLEW2017, title = {High-resolution Fourier transform measurements of line strengths in the 00\verb=^=02-00\verb=^=00 main isotopologue band of nitrous oxide}, journal = {Applied Optics}, year = {2017}, month = {3}, day = {17}, volume = {56}, number = {11}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {E99-E105}, keywords = {Nitrous oxide, Fourier transform infrared spectroscopy, spectral line parameters, line strengths, gas metrology}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW Washington, DC 20036-1023, USA}, language = {30}, ISSN = {0003-6935, 1539-4522}, DOI = {10.1364/ao.56.000e99}, stag_bib_extends_levelofaccess = {NA}, author = {Brunzendorf, Jens and Werwein, Viktor and Serdyukov, Anton and Li, Gang and Ebert, Volker and Werhahn, Olav} } @Article { ZoladekLemanczykBNKCS2017, title = {Fabrication of air-stable, large-area, PCDTBT:PC70BM polymer solar cell modules using a custom built slot-die coater}, journal = {Solar Energy Materials and Solar Cells}, year = {2017}, month = {3}, volume = {161}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {388-396}, keywords = {Slot-die coating; Polymer Solar Cells (PSC); Large-area; Ambient stability; PCDTBT:PC70BM; Light beam induced current (LBIC); Photoluminescence (PL)}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York, United States}, language = {30}, ISSN = {0927-0248}, DOI = {10.1016/j.solmat.2016.12.019}, stag_bib_extends_levelofaccess = {NA}, author = {Zoladek-Lemanczyk, Alina and Bausi, Francesco and New, Edward and Kutsarov, Dimitar I. and Castro, Fernando A. and Silva, S. Ravi P.} } @Article { MarsteinPHRCDS2017, title = {Surface Passivation Properties of $\{\textbackslashtextrm\{HfO\}\}_\{2\}$ Thin Film on n-Type Crystalline Si}, journal = {IEEE Journal of Photovoltaics}, year = {2017}, month = {3}, volume = {7}, number = {2}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {479-485}, keywords = {Passivation, Hafnium compounds, Silicon, Annealing, Temperature, silicon, atomic layer deposition, carrier lifetime, crystal growth from melt, dielectric thin films, electrical resistivity, hafnium compounds, passivation, refractive index, Si, surface passivation, hafnium oxide thin film, atomic layer deposition, resistivity, low temperature anneal, precleaning, precursors, deposition temperature, postannealing temperature, minority carrier lifetime, surface recombination velocity, Czochralski n-type wafers, light soaking, refractive index, solar cells, HfO2, silicon surface passivation, Atomic layer deposition (ALD), defect density, fixed charges, hafnium oxide (HfO2), photovoltaic cells}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2645399}, stag_bib_extends_levelofaccess = {NA}, author = {Marstein, Erik Stensrud and Perros, Alexander Pyymaki and Halvard, Haug and Repo, Paivikki and Cheng, Xuemei and Di Sabatino, Marisa and Savin, Hele} } @Article { SewellSFZK2017, title = {A new profile roughness measurement approach for involute helical gears}, journal = {Measurement Science and Technology}, year = {2017}, month = {3}, volume = {28}, number = {5}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {055004}, keywords = {involute gear, roughness}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa5d96}, stag_bib_extends_levelofaccess = {NA}, author = {Sewell, I and Shaw, B A and Frazer, R C and Zhang, J and Koulin, G} } @Article { MartinezVerduLAKOGKJFSPSC2017, title = {Multilateral spectral radiance factor scale comparison}, journal = {Applied Optics}, year = {2017}, month = {3}, volume = {56}, number = {7}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1996}, keywords = {BSDF, BRDF, BTDF, Densitometers, reflectometers, Reflection.}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States}, language = {30}, ISSN = {0003-6935, 1539-4522}, DOI = {10.1364/AO.56.001996}, stag_bib_extends_levelofaccess = {NA}, author = {Mart{\'i}nez-Verd{\'u}, F. M. and Leloup, F. B. and Audenaert, J. and K{\"a}llberg, S. and Obein, G. and Ged, G. and Koo, A. and Jaanson, P. and Ferrero, A. and Strothk{\"a}mper, C. and Perales, E. and Schirmacher, A. and Campos, J.} } @Article { SchumacherACMMCKMSCK2017, subid = {252}, title = {Magnetic scanning gate microscopy of CoFeB lateral spin valve}, journal = {AIP Advances}, year = {2017}, month = {3}, volume = {7}, number = {5}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {056808}, keywords = {AbstractDevices comprised of CoFeB nanostructures with perpendicular magnetic anisotropy and non-magnetic Ta channel were operated in thermal lateral spin valve (LSV) mode and studied by magnetotransport measurements and magnetic scanning gate microscopy (SGM). Due to the short spin diffusion length of Ta, the spin diffusion signal was suppressed, allowing the study of the contribution from the anomalous Nernst (ANE) and anomalous Hall effects (AHE). The magnetotransport measurements identified the switching fields of the CoFeB nanostructures and demonstrated a combination of AHE and ANE when the devices were operated in thermally-driven spin-injection mode. Modified scanning probe microscopy probes were fabricated by placing a NdFeB magnetic bead (MB) on the apex of a commercial Si probe. The dipole magnetic field distribution around the MB was characterized by using differential phase contrast technique and direct measurement of the switching field induced by the bead in the CoFeB nanodevices. Using SGM we demonstrate the influence of localized magnetic field on the CoFeB nanostructures near the non-magnetic channel. This approach provides a promising route towards the study of thermal and spin diffusion effects using local magnetic fields.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/1.4977891}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Scarioni, A.F. and Mansell, R. and Krzysteczko, P. and Cox, D. and McGrouther, D. and McVitie, S. and Cowburn, R. and Schumacher, H.W. and Antonov, V. and Kazakova, O.} } @Article { SchaepmanSKDH2017, title = {Field and Airborne Spectroscopy Cross Validation—Some Considerations}, journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing}, year = {2017}, month = {3}, volume = {10}, number = {3}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {1117-1135}, keywords = {Spectroscopy, Atmospheric measurements, Uncertainty, Surface treatment, Vegetation mapping, Measurement uncertainty, Instruments}, web_url = {https://ieeexplore.ieee.org/document/7582439/keywords}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1939-1404, 2151-1535}, DOI = {10.1109/JSTARS.2016.2593984}, stag_bib_extends_levelofaccess = {NA}, author = {Schaepman, M.E. and Schlapfer, D. and Kneubuehler, M. and Damm, A. and Hueni, A.} } @Proceedings { LiSLHZYTSHTFKS2017, subid = {1123}, title = {Random-telegraph-noise by resonant tunnelling at low temperatures}, journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, year = {2017}, month = {2}, day = {28}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {Random-telegraph-noise, charge trap, low temperatures}, web_url = {https://eprints.soton.ac.uk/418401/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Toyama}, event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, event_date = {28-02-2017 to 02-03-2017}, language = {30}, DOI = {10.1109/EDTM.2017.7947569}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Z. and Sotto, M. and Liu, F. and Husain, M.K. and Zeimpekis, I. and Yoshimoto, H. and Tani, K. and Sasago, Y. and Hisamoto, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.} } @Proceedings { LiSBFKHTLS2017, subid = {1124}, title = {Transport properties in silicon nanowire transistors with atomically flat interfaces}, journal = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, year = {2017}, month = {2}, day = {28}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, keywords = {narrow channel effect, silicon nanowire, SOI, TMAH, self-limiting oxidation}, web_url = {https://eprints.soton.ac.uk/402316/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Toyama}, event_name = {2017 IEEE Electron Devices Technology and Manufacturing Conference (EDTM)}, event_date = {28-02-2017 to 02-03-2017}, language = {30}, DOI = {10.1109/EDTM.2017.7947561}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, F. and Husain, M.K. and Li, Z. and Sotto, M.S.H. and Burt, D. and Fletcher, J.D. and Kataoka, M. and Tsuchiya, Y. and Saito, S.} } @Article { deLauretoBPSSFD2017, subid = {453}, title = {\(\alpha\)-Synuclein structural features inhibit harmful polyunsaturated fatty acid oxidation, suggesting roles in neuroprotection}, journal = {Journal of Biological Chemistry}, year = {2017}, month = {2}, day = {23}, volume = {292}, number = {17}, number2 = {15HLT04: NeuroMet: Innovative measurements for improved diagnosis and management of neurodegenerative diseases}, pages = {6927-6937}, keywords = {\(\alpha\)-synuclein (\(\alpha\)-synuclein), lipid oxidation, mass spectrometry, (MS) polyunsaturated fatty acid (PUFA), protein chemical modification}, web_url = {http://www.jbc.org/content/292/17/6927}, misc2 = {EMPIR 2015: Health}, publisher = {American Society for Biochemistry \& Molecular Biology (ASBMB)}, language = {30}, ISSN = {0021-9258, 1083-351X}, DOI = {10.1074/jbc.M116.765149}, stag_bib_extends_levelofaccess = {NA}, author = {De Franceschi, G. and Fecchio, C. and Sharon, R. and Schapira, A.H.V. and Proukakis, C. and Bellotti, V. and de Laureto, P.P.} } @Article { ClarksonCSC2017, title = {Enhancing Prony’s method by nuclear norm penalization and extension to missing data}, journal = {Signal, Image and Video Processing}, year = {2017}, month = {2}, day = {16}, volume = {2017}, number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics}, pages = {1-8}, keywords = {Convex relaxation, Nuclear Norm, Hankel approximation, Prony’s method, Exponential sums, Signal approximation, Missing Data}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Springer Nature}, language = {30}, ISSN = {1863-1703, 1863-1711}, DOI = {10.1007/s11760-017-1062-2}, stag_bib_extends_levelofaccess = {NA}, author = {Clarkson, Paul and Chr{\'e}tien, St{\'e}phane and Sarray, Basad Al and Cottez, Guillaume} } @Article { RobinsonSGWZMRLHSY2017, title = {1.5 \(\mu\)m lasers with sub 10 mHz linewidth}, journal = {APS Physics}, year = {2017}, month = {2}, day = {15}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, keywords = {tiem and frequency metrology, ultra-stable laser, oprical clock}, web_url = {https://arxiv.org/abs/1702.04669}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {30}, DOI = {10.1103/PhysRevLett.118.263202}, stag_bib_extends_levelofaccess = {NA}, author = {Robinson, J.M. and Sonderhouse, L. and Grebing, C. and Weyrich, R. and Zhang, W. and Matei, D.G. and Riehle, F. and Legero, T. and H{\"a}fner, S. and Sterr, U. and Ye, J.} } @Article { EswardSEE2017, subid = {390}, title = {Evaluation of dynamic measurement uncertainty – an open-source software package to bridge theory and practice}, journal = {Journal of Sensors and Sensor Systems}, year = {2017}, month = {2}, day = {14}, volume = {6}, number = {1}, number2 = {14SIP08: Dynamic: Standards and software to maximise end user uptake of NMI calibrations of dynamic force, torque and pressure sensors}, pages = {97-105}, keywords = {dynamic measurement, uncertainty, digital filtering, PyDynamic, software}, web_url = {https://www.j-sens-sens-syst.net/6/97/2017/jsss-6-97-2017.pdf}, misc2 = {EMPIR 2014: Support for Impact}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-6-97-2017}, stag_bib_extends_levelofaccess = {NA}, author = {Eichst{\"a}dt, S. and Elster, C. and Smith, I.M. and Esward, T.J.} } @Article { DrungSK2017, subid = {12}, title = {Measurement of sub-picoampere direct currents with uncertainties below ten attoamperes}, journal = {Review of Scientific Instruments}, year = {2017}, month = {2}, volume = {88}, number = {2}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {024711}, keywords = {ULCA, ultrastable low-noise current amplifier, single-electron transport pumps, measurement uncertainty}, web_url = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4975826}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Krause, C. and Drung, D. and Scherer, H.} } @Article { StagniRPNNMMLFBBAACZC2017, subid = {134}, title = {A VLBI experiment using a remote atomic clock via a coherent fibre link}, journal = {Scientific Reports}, year = {2017}, month = {2}, volume = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {40992}, keywords = {VLBI experiment, remote atomic clock}, web_url = {https://www.nature.com/articles/srep40992}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep40992}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Ambrosini, R. and Artz, T. and Bertarini, A. and Bortolotti, C. and Frittelli, M. and Levi, F. and Mura, A. and Maccaferri, G. and Nanni, M. and Negusini, M. and Perini, F. and Roma, M. and Stagni, M. and Zucco, M. and Calonico, D.} } @Article { PavsiDBFVJSeHRKMAAM2017, subid = {2144}, title = {Inter-laboratory assessment of different digital PCR platforms for quantification of human cytomegalovirus DNA}, journal = {Analytical and Bioanalytical Chemistry}, year = {2017}, month = {1}, day = {26}, volume = {409}, number = {10}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {2601-2614}, keywords = {Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-017-0206-0}, stag_bib_extends_levelofaccess = {NA}, author = {Pavšič, J. and Devonshire, A. and Blejec, A. and Foy, C.A. and Van Heuverswyn, F. and Jones, G.M. and Schimmel, H. and Zel, J. and Huggett, J.F. and Redshaw, N. and Karczmarczyk, M. and Mozioglu, E. and Aky{\"u}rek, S. and Akg{\"o}z, M. and Milavec, M.} } @Article { , title = {Atomic force microscope adhesion measurements and atomistic molecular dynamics simulations at different humidities}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {23}, volume = {28}, number = {3}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {034004 (10pp)}, keywords = {Atomic force microscopy, metrology, adhesion, capillary effects, humidity, force measurement}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034004/meta;jsessionid=1CDCAA65608F84971489636A33CB4FD2.c3.iopscience.cld.iop.org}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/1361-6501/28/3/034004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-1-23}, author = {Sepp{\"a}, J and Reischl, B and Sairanen, H and Korpelainen, V and Husu, H and Heinonen, M and Raiteri, P and Rohl, A and Nordlund, K and Lassila, A} } @Article { KorpelainenLKLS2017, title = {DNA origami structures as calibration standards for nanometrology}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {23}, volume = {28}, number = {3}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {034001}, keywords = {atomic force microscopy, DNA nanotechnology, DNA origami, self-assembly}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/28/3/034001}, stag_bib_extends_levelofaccess = {NA}, author = {Korpelainen, Virpi and Lassila, Antti and Kostiainen, Mauri A and Linko, Veikko and Sepp{\"a}, Jeremias} } @Article { MillesSSEGBNL2017, title = {Comparing AFM cantilever stiffness measured using the thermal vibration and the improved thermal vibration methods with that of an SI traceable method based on MEMS}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {23}, volume = {28}, number = {3}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {034010}, keywords = {cantilever stiffness calibration, active reference spring, micro-electro-mechanical system}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/28/3/034010/pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/28/3/034010}, stag_bib_extends_levelofaccess = {NA}, author = {Milles, L.F. and Stahl, S.W. and Sulzbach, T. and Engl, W. and Gao, S. and Brand, U. and Nesterov, V. and Li, Z.} } @Article { SchubertHSMTGW2017, title = {Angle Dependence of Solar Cells and Modules: The Role of Cell Texturization}, journal = {IEEE Journal of Photovoltaics}, year = {2017}, month = {1}, volume = {7}, number = {1}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {19-24}, keywords = {photovoltaic}, web_url = {http://ieeexplore.ieee.org/document/7600397/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2614120}, stag_bib_extends_levelofaccess = {NA}, author = {Schubert, M.C. and Hohl-Ebinger, J. and Steinkemper, H. and Muller, B. and Tucher, N. and Geisemeyer, I. and Warta, W.} } @Article { BecherLSGCSPHLRK2017_2, title = {Experimental realization of an absolute single-photon source based on a single nitrogen vacancy center in a nanodiamond}, journal = {Optica}, year = {2017}, month = {1}, volume = {4}, number = {1}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {71}, keywords = {Metrology, Radiometry, Sources, Photon statistics}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.4.000071}, stag_bib_extends_levelofaccess = {NA}, author = {Becher, C. and Lindner, S. and Sandoghdar, V. and G{\"o}tzinger, S. and Chu, X.L. and Smid, M. and Porrovecchio, G. and Hofer, H. and L{\'o}pez, M. and Rodiek, B. and K{\"u}ck, S.} } @Proceedings { SchmutzLFFGWW2017, title = {Direct Solar Irradiance measurements with a Cryogenic Solar Absolute Radiometer}, journal = {AIP Conference Proceedings}, year = {2017}, volume = {1810}, number = {1}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, keywords = {Radiometers, Error analysis, Solar irradiance, Cryogenics, Electric measurements}, web_url = {http://aip.scitation.org/doi/abs/10.1063/1.4975538}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {AIP Conference Proceedings}, address = {Melville}, event_place = {Auckland, New Zealand}, event_name = {Proceedings of the International Radiation Symposium (IRC/IAMAS)}, event_date = {16-04-2016 to 22-04-2016}, language = {30}, ISBN = {978-0-7354-1478-5}, DOI = {10.1063/1.4975538}, stag_bib_extends_levelofaccess = {NA}, author = {Schmutz, W. and Li, V. and Fox, N. and Finsterle, W. and Graber, F. and Winkler, R. and Walter, B.} } @Inbook { LinesS2017, subid = {509}, title = {Determining the Quality of Mathematical Software Using Reference Data Sets}, journal = {Software Quality Management XXV: Achieving Software Quality in Development and in Use}, year = {2017}, volume = {XXV}, number = {1}, number2 = {15SIP06: ValTraC: Validation of software development and analysis tools using TraCIM}, pages = {39-52}, keywords = {Software, Standards, Traceability, TraCIM, ValTraC, Verification}, tags = {MAT}, web_url = {https://pdfs.semanticscholar.org/b6e5/990abc2e4f8f4eb608cd2d8f0956f78cce88.pdf?_ga=2.219996826.2046007785.1585047494-450240071.1585047494}, web_url2 = {https://pure.solent.ac.uk/en/publications/achieving-software-quality-in-development-and-in-use;}, misc2 = {EMPIR 2015: Support for Impact}, publisher = {Southampton Solent University}, event_place = {Southampton}, event_name = {British Computer Society (BCS) Quality Specialist Group's Annual International Software Quality Management (SQM) Conference}, event_date = {10-04-2017 to 11-04-2017}, language = {30}, ISBN = {978-0-9932889-6-8}, stag_bib_extends_levelofaccess = {NA}, author = {Lines, Keith J. and Smith, Ian M.} } @Proceedings { SebastianSML2017, subid = {245}, title = {Torque traceability for nacelle’s test benches: a design proposal}, journal = {Conference Proceedings IMEKO 23rd TC3, 13th TC5 and 4 th TC22 International Conference}, year = {2017}, number = {2017}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {wind turbine, torque, standard, nacelle test bench}, misc2 = {EMPIR 2014: Industry}, event_place = {Helsinki Finland}, event_name = {IMEKO 23rd TC3, 13th TC5 and 4th TC22 International Conference}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-004.pdf}, author = {Sebasti{\'a}n, M.A. and S{\'a}enz, M.A. and Medina-Mart{\'i}n, N. and Lorente, R.M.} } @Proceedings { KummeWKS2017, subid = {876}, title = {New perspectives for MN·m torque measurement in PTB}, journal = {Conference Proceedings IMEKO 23rd TC3, 13th TC5 and 4 th TC22 International Conference}, year = {2017}, number = {2017}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {torque, calibration, transfer standard, wind energy, nacelle test bench}, misc2 = {EMPIR 2014: Industry}, event_place = {Helsinki Finland}, event_name = {IMEKO 23rd TC3, 13th TC5 and 4th TC22 International Conference}, event_date = {30-05-2017 to 01-06-2017}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/tc3-2017/IMEKO-TC3-2017-045.pdf}, author = {Kumme, R. and Weidinger, P. and Kahmann, H. and Schlegel, C.} } @Proceedings { PavanelloCLS2017, subid = {966}, title = {Comparison of Electrical Performance of Bifacial Silicon PV Modules}, journal = {Proceedings of EUPVSEC 2017}, year = {2017}, volume = {5CO.7.3}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Bifacial, c-Si, n-Type, Energy Performance, PV Modules}, web_url = {https://www.eupvsec-proceedings.com/proceedings?paper=43071}, misc2 = {EMPIR 2016: Energy}, event_place = {Amsterdam, the Netherlands}, event_name = {33rd European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {25-09-2017 to 29-09-2017}, language = {30}, ISBN = {3-936338-47-7}, DOI = {10.4229/EUPVSEC20172017-5CO.7.3}, stag_bib_extends_levelofaccess = {NA}, author = {Pavanello, D. and Casado, A. and Lopez-Garcia, J. and Sample, T.} } @Article { BojkovskiOKMSISFZSSJoHHPV2017, subid = {1095}, title = {Expansion of European research capabilities in humidity measurement}, journal = {18th International Congress of Metrology}, year = {2017}, number = {2017 18th}, number2 = {15RPT03: HUMEA: Expansion of European research capabilities in humidity measurement}, pages = {4/06006}, keywords = {Humidity, traceability, dew-point temperature, relative humidity, uncertainty analysis, interlaboratory comparison}, web_url = {https://cfmetrologie.edpsciences.org/articles/metrology/abs/2017/01/metrology_metr2017_06006/metrology_metr2017_06006.html}, misc2 = {EMPIR 2015: Research Potential}, publisher = {EDP Sciences}, language = {30}, DOI = {10.1051/metrology/201706006}, stag_bib_extends_levelofaccess = {NA}, author = {Hodzic, N. and Čohodarević, S. and Jandrić, N. and Strnad, R. and Sestan, D. and Zvizdić, D. and Fernicola, V. and Smorgon, D. and Iacomini, L. and Simic, S. and Mac Lochlainn, D. and Karaboce, N. and Oguz Aytekin, S. and Bojkovski, J. and Hudoklin, D. and Petrušova, O. and Vukičević, T.} } @Article { MaringerWKSB2016, title = {Study of particular problems appearing in NORM samples and recommendations for best practice gamma-ray spectrometry}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {12}, day = {28}, volume = {126}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {285-288}, keywords = {Gamma-ray spectrometry; NORM; Spectral interference; Radon tightness}, web_url = {https://www.sciencedirect.com/science/article/pii/S0969804316304961}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2016.12.035}, stag_bib_extends_levelofaccess = {NA}, author = {Maringer, F.J. and Wiedner, H. and Kabrt, F. and Stietka, M. and Baumgartner, A.} } @Article { CuenatCMSHKSWK2016, subid = {249}, title = {Combined anomalous Nernst effect and thermography studies of ultrathin CoFeB/Pt nanowires}, journal = {AIP Advances}, year = {2016}, month = {12}, day = {22}, volume = {7}, number = {5}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {055904}, keywords = {Abstract: Using electrical and thermal measurements, we present a method for characterising the anomalous Nernst effect (ANE) within nanoscale devices implementing perpendicular anisotropy materials. Perpendicularly magnetised CoFeB/Pt nanowires were fabricated in close proximity to Pt heater elements on an electrically insulating substrate. The voltages induced within the magnetic material as a result of the ANE were recorded for increasing heater powers, and for both out-of-plane saturated states of the device. Scanning thermal probe microscopy was used to map the temperature distribution within the region of the device at a range of heater powers. By analysing the results from each thermography measurement, it was possible to correlate the temperature gradient induced at the magnetic nanowire against the anomalous Nernst voltage measured within the device. For the particular material, geometry and substrate used, a Nernst coefficient value KN = 2.3 \(\mu\)V(K.T)-1 was calculated. This combination of measurements can provide a powerful tool to characterise the ANE within a number of nanoscale systems, a necessary task for the future implementation and optimisation of the effect within spin-caloritronic devices.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/1.4973196}, stag_bib_extends_levelofaccess = {NA}, author = {Wells, J. and Selezneva, E. and Krzysteczko, P. and Hu, X. and Schumacher, H.W. and Mansell, R. and Cowburn, R. and Cuenat, A. and Kazakova, O.} } @Article { GersterSSPGBWULHSP2016, subid = {11}, title = {Robustness of single-electron pumps at sub-ppm current accuracy level}, journal = {Metrologia}, year = {2016}, month = {12}, day = {20}, volume = {54}, number = {1}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {S1-S8}, keywords = {single-electron pumps, small-current measurement,}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, address = {Temple Circus, Temple Way, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/54/1/S1}, stag_bib_extends_levelofaccess = {NA}, author = {Stein, F and Scherer, H and Gerster, T and Behr, R and G{\"o}tz, M and Pesel, E and Leicht, C and Ubbelohde, N and Weimann, T and Pierz, K and Schumacher, H W and Hohls, F} } @Article { , title = {Alternative Conducted Immunity Tests}, journal = {IEEE Electromagnetic Compatibility Magazine}, year = {2016}, month = {12}, day = {15}, volume = {5}, number = {3}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {45-51}, keywords = {Alternative, Current Probe, CDN, Conducted Immunity, EMC, High Current, Industry, Mains Impedance}, web_url = {http://ieeexplore.ieee.org/document/7764249/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, language = {30}, ISSN = {2162-2272}, DOI = {10.1109/MEMC.0.7764249}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {\c{C}akır, Soydan and Şen, Osman and ACAK, Savaş and AZPURUA, Marco and SILVA, Ferran and \c{C}etintaş, Mustafa} } @Article { LepratDBSP2016, subid = {66}, title = {Practical Quantum Realization of the Ampere from the Elementary Charge}, journal = {Physical Review X}, year = {2016}, month = {12}, day = {12}, volume = {6}, number = {4}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {041051}, keywords = {Quantum current source, realization of the ampere, programmable Josephson voltage standard, quantum Hall resistance standard, cryogenic current comparator, SI}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {New York, USA}, language = {30}, ISSN = {2160-3308}, DOI = {10.1103/PhysRevX.6.041051}, stag_bib_extends_levelofaccess = {NA}, author = {Brun-Picard, J. and Djordjevic, S. and Leprat, D. and Schopfer, F. and Poirier, W.} } @Article { , title = {Numerical comparison of sampling strategies for BRDF data manifolds}, journal = {Measurement}, year = {2016}, month = {12}, volume = {94}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {578-584}, keywords = {Design of experiments, active learning, BRDF, diffuse reflection, specular reflection, computer graphics, computer vision, metrology, data analysis, statistics of manifolds, distance on the space of BRDFs.}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2016.08.010}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Langovoy, M. and Schm{\"a}hling, F. and W{\"u}bbeler, G.} } @Article { , title = {MN·m torque calibration for nacelle test benches using transfer standards}, journal = {ACTA IMEKO}, year = {2016}, month = {12}, volume = {5}, number = {4}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, pages = {7}, keywords = {torque calibration; transfer standard; nacelle test bench}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-05\%20\%282016\%29-04-03}, misc2 = {EMPIR 2014: Industry}, publisher = {International Measurement Confederation}, address = {Budapest}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v5i4.414}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schlegel, C and Kahmann, H and Kumme, R} } @Article { VandervorstDPFLTHVBTFCS2016, subid = {158}, title = {Understanding Physico-Chemical Aspects in the Depth Profiling of Polymer:Fullerene Layers}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {12}, volume = {120}, number = {49}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {28074-28082}, keywords = {ToF-SIMS, GCIB, Ar cluster, quantification, depth profiling, organics, solar cells, polymer, fullerenes}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society 2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b09911}, stag_bib_extends_levelofaccess = {NA}, author = {Surana, S. and Conard, T. and Fleischmann, C. and Tait, J.G. and Bastos, J.P. and Voroshazi, E. and Havelund, R. and Turbiez, M. and Louette, P. and Felten, A. and Poleunis, C. and Delcorte, A. and Vandervorst, W.} } @Techreport { HultMSMLAVP2016, title = {Metrodecom: JRC-Geel Radionuclide Metrology Sector contribution to WP5 Task 2: Reference materials and standard sources for radiochemical analysis}, journal = {JRC Technical report}, year = {2016}, month = {12}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Reference materials, Radiochemical analysis, standard sources}, web_url = {http://publications.jrc.ec.europa.eu/repository/handle/JRC103355}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {European commission Publication office}, address = {Luxemburg}, language = {30}, ISBN = {978-92-79-63506-9}, ISSN = {1831-9424}, DOI = {10.2789/949534}, stag_bib_extends_levelofaccess = {NA}, author = {Hult, M. and Marissens, G. and Stroh, H. and Marouli, M. and Lutter, G. and Altzitzoglou, T. and Van Ammel, R. and Pomm{\'e}, S.} } @Article { ReitzensteinKLRSSKSMRWFDJK2016, subid = {336}, title = {Impact of Phonons on Dephasing of Individual Excitons in Deterministic Quantum Dot Microlenses}, journal = {ACS Photonics}, year = {2016}, month = {11}, day = {22}, volume = {3}, number = {12}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {2461-2466}, keywords = {single-photon source, 3D lithography, 3D direct laser writing, semiconductor quantum dot, micro-objective}, web_url = {http://pubs.acs.org/doi/pdf/10.1021/acsphotonics.7b00253}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {2330-4022, 2330-4022}, DOI = {10.1021/acsphotonics.6b00707}, stag_bib_extends_levelofaccess = {NA}, author = {Jakubczyk, T. and Delmonte, V. and Fischbach, S. and Wigger, D. and Reiter, D.E. and Mermillod, Q. and Schnauber, P. and Kaganskiy, A. and Schulze, J.H. and Strittmatter, A. and Rodt, S. and Langbein, W. and Kuhn, T. and Reitzenstein, S. and Kasprzak, J.} } @Techreport { LutterSV2016, title = {Preparation of 1100 60Co calibration sources}, journal = {JRC Technical reports}, year = {2016}, month = {11}, day = {18}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Calibration, Decommissioning, reference standards}, web_url = {http://publications.jrc.ec.europa.eu/repository/handle/JRC103167}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {European commission Publication office}, language = {30}, ISBN = {978-92-79-62200-7}, ISSN = {1831-9424}, DOI = {10.2789/787831}, stag_bib_extends_levelofaccess = {NA}, author = {Lutter, G. and Sobiech-Matura, K. and Van Ammel, R.} } @Article { , title = {Near-unity quantum efficiency of broadband black silicon photodiodes with an induced junction}, journal = {Nature Photonics}, year = {2016}, month = {11}, day = {14}, volume = {-}, number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry}, keywords = {Imaging and sensing, Nanowires, Optical metrology, Optical sensors, X-rays}, web_url = {http://www.nature.com/nphoton/journal/vaop/ncurrent/full/nphoton.2016.226.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Nature}, address = {-}, language = {30}, DOI = {10.1038/nphoton.2016.226}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Juntunen, M.A. and Heinonen, J. and V{\"a}h{\"a}nissi, V. and Repo, P. and Valluru, D. and Savin, H.} } @Article { , title = {Creation and characterization of He-related color centers in diamond}, journal = {Journal of Luminescence}, year = {2016}, month = {11}, day = {1}, volume = {179}, number = {November 2016}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {59-63}, keywords = {Diamond; Color center; Defect; Ion implantation; Photoluminescence}, web_url = {http://www.journals.elsevier.com/journal-of-luminescence}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0022-2313}, DOI = {10.1016/j.jlumin.2016.06.039}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-1}, author = {J. Forneris, J. and A. Tengattini, A. and S. Ditalia Tchernij, S. and F. Picollo, F. and A. Battiato, A. and P. Traina, P. and I.P. Degiovanni, I.P. and E. Moreva, E. and G. Brida, G. and V. Grilj, V. and N. Skukan, N. and M. Jakšić, M. and M. Genovese, M. and P. Olivero, P.} } @Article { FernandezVicenteMSLd2016, title = {Speeds of sound for a biogas mixture CH 4 + N 2 + CO 2 + CO from p = (1–12) MPa at T = (273, 300 and 325) K measured with a spherical resonator}, journal = {The Journal of Chemical Thermodynamics}, year = {2016}, month = {11}, volume = {102}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {348-356}, keywords = {Speed of sound, acoustic resonance, spherical resonator, virial acoustic coefficients, heat capacities as perfect gas, biogas.}, tags = {EnG}, web_url = {https://core.ac.uk/download/pdf/61544743.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-9614}, DOI = {10.1016/j.jct.2016.07.033}, stag_bib_extends_levelofaccess = {NA}, author = {Fern{\'a}ndez-Vicente, T. and Mart{\'i}n, M.C. and Segovia, J.J. and Lozano-Mart{\'i}n, D. and del Campo, D.} } @Article { GorenBTZSMPRFAF2016, title = {Towards tributyltin quantification in natural water at the Environmental Quality Standard level required by the Water Framework Directive}, journal = {Talanta}, year = {2016}, month = {11}, volume = {160}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {499-511}, keywords = {ICP-MS, Isotope Dilution, Limit of quantification, Metrological traceability, Tributyltin, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0039-9140}, DOI = {10.1016/j.talanta.2016.07.056}, stag_bib_extends_levelofaccess = {NA}, author = {Goren, A.C. and B{\'i}lsel, M. and Tun\c{c}, M. and Zuliani, T. and Sčančar, J. and Milačič, R. and Philipp, R. and Richter, J. and Fettig, I. and Alasonati, E. and Fisicaro, P.} } @Article { YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016, subid = {321}, title = {Versailles Project on Advanced Materials and Standards Interlaboratory Study on Measuring the Thickness and Chemistry of Nanoparticle Coatings Using XPS and LEIS}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {10}, day = {27}, volume = {120}, number = {42}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {24070-24079}, keywords = {VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory}, web_url = {https://spiral.imperial.ac.uk/handle/10044/1/40824}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b06713}, stag_bib_extends_levelofaccess = {NA}, author = {Belsey, N.A. and Cant, D. and Cant, D.J.H. and Minelli, C. and Araujo, J.R. and Bock, B. and Br{\"u}ner, P. and Castner, D.G. and Ceccone, G. and Counsell, J.D.P. and Dietrich, P.M. and Engelhard, M.H. and Fearn, S. and Galhardo, C.E. and Kalbe, H. and Kim, J.W. and Lartundo-Rojas, L. and Luftman, H.S. and Nunney, T.S. and Pseiner, J. and Smith, E.F. and Spampinato, V. and Sturm, J.M. and Thomas, A.G. and Treacy, J.P.W. and Veith, L. and Wagstaffe, M. and Wang, H. and Wang, M. and Wang, Y.C. and Werner, W. and Yang, L.} } @Article { YoshidaWDKLSGIHTGMB2016, title = {Reassessment of the NH4NO3thermal decomposition technique for calibration of the N2O isotopic composition}, journal = {Rapid Communications in Mass Spectrometry}, year = {2016}, month = {10}, day = {20}, volume = {30}, number = {23}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2487-2496}, keywords = {thermal decomposition, isotopic composition}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0951-4198}, DOI = {10.1002/rcm.7736}, stag_bib_extends_levelofaccess = {NA}, author = {Yoshida, N. and Werner, R.A. and Decock, C. and Kuhn, T. and Lehmann, M.F. and Schleppi, P. and Geilmann, H. and Ibraim, E. and Harris, E. and Toyoda, S. and Gutjahr, W. and Mohn, J. and Brand, W.A.} } @Article { EngertRGPMKHSCLSKMP2016, title = {New Evaluation of T − T2000 from 0.02K to 1K by Independent Thermodynamic Methods}, journal = {International Journal of Thermophysics}, year = {2016}, month = {10}, day = {20}, volume = {37}, number = {12}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, keywords = {Temperature, Thermodynamic Methods, Kelvin}, web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/new-evaluation-of-t-t2000-from-002k-to-1k-by-independent-thermodynamic-methods(dc393a64-8d59-4083-9435-f2bd70eea8ed).html}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-016-2123-4}, stag_bib_extends_levelofaccess = {NA}, author = {Engert, J and Kirste, A. and Shibahara, A. and Casey, A. and Levitin, L.V. and Saunders, J. and Hahtela, O. and Kemppinen, A. and Mykk{\"a}nen, E. and Prunnila, M. and Gunnarsson, D. and Roschier, L. and Meschke, M. and Pekola, J.} } @Article { BillasSGBSFS2016, subid = {91}, title = {Development of a primary standard for absorbed dose from unsealed radionuclide solutions}, journal = {Metrologia}, year = {2016}, month = {10}, day = {19}, volume = {53}, number = {6}, number2 = {15HLT06: MRTDosimetry: Metrology for clinical implementation of dosimetry in molecular radiotherapy}, pages = {1259-1271}, keywords = {dosimetry, radionuclide solution, extrapolation chamber, primary standard,validation of dose calculation}, misc2 = {EMPIR 2015: Health}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/6/1259}, stag_bib_extends_levelofaccess = {NA}, author = {Billas, I and Shipley, D and Galer, S and Bass, G and Sander, T and Fenwick, A and Smyth, V.} } @Article { SmithHRGLI2016, title = {Estimation of background gas concentration from differential absorption lidar measurements}, journal = {Atmospheric Measurement Techniques}, year = {2016}, month = {10}, volume = {9}, number = {10, 2016}, number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions}, pages = {4879-4890}, keywords = {gas concentration, differential absorption, atmosphere, metrology, emission fluxes, lidar, pollutants, measurement}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, address = {G{\"o}ttingen}, language = {30}, ISSN = {18678548}, DOI = {10.5194/amt-9-4879-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Smith, N. and Harris, P. and Robinson, R. and Gardiner, T. and Livina, V. and Innocenti, F.} } @Article { ReganCBABS2016, title = {A comparison of emerging gamma detector technologies for airborne radiation monitoring}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {10}, volume = {763}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {012010}, keywords = {gamma detector, airborne radiation monitoring, radiation monitoring}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/763/1/012010}, stag_bib_extends_levelofaccess = {NA}, author = {Regan, P H and Collins, S M and Beeke, S and Aitken-Smith, P and Bell, S J and Shearman, R} } @Article { DeLeoCVSMTFB2016, subid = {161}, title = {4-Nitrobenzene Grafted in Porous Silicon: Application to Optical Lithography}, journal = {Nanoscale Research Letters}, year = {2016}, month = {9}, day = {29}, volume = {11}, number = {436}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {1-10}, keywords = {Porous silicon, Optical lithography, 4-Nitrobenzenediazonium, grafting, Improved chemical resistance}, web_url = {https://nanoscalereslett.springeropen.com/articles/10.1186/s11671-016-1654-8}, misc2 = {EMPIR 2014: Industry}, publisher = {SpringerOpen}, address = {London}, language = {30}, ISSN = {1556-276X}, DOI = {10.1186/s11671-016-1654-8}, stag_bib_extends_levelofaccess = {NA}, author = {Tiddia, M.V. and Mula, G. and Sechi, E. and Vacca, A. and Cara, E. and De Leo, N. and Fretto, M. and Boarino, L.} } @Article { , title = {Improvement of an Atomic Clock using Squeezed Vacuum}, journal = {Physical Review Letters}, year = {2016}, month = {9}, day = {28}, volume = {117}, number = {14}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {143004}, keywords = {clock, spin squeezing, squeezed vacuum}, web_url = {http://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.143004}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {Washington, DC, USA}, language = {30}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.117.143004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kruse, I and Lange, K and Peise, J and L{\"u}cke, B and Pezz{\`e}, L and Arlt, J and Ertmer, W and Lisdat, C and Santos, L and Smerzi, A and Klempt, C} } @Article { RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016, title = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, journal = {Atmospheric Chemistry and Physics}, year = {2016}, month = {9}, day = {23}, volume = {16}, number = {18}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {11915-11935}, keywords = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7324}, DOI = {10.5194/acp-16-11915-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Ramachandran, R. and Fu, X. and Zhang, H. and Feng, X.B. and Wip, D. and Obolkin, V. and Mashyanov, N. and Sena, F. and Gawlik, B.M. and Neves, L.M. and Read, K.A. and Kotnik, J. and Horvat, M. and Skov, H. and Magand, O. and Angot, H. and Dommergue, A. and Garcia, P.E. and Di{\'e}guez, M.D.C and Barbante, C. and Cairns, W. and Brito, J. and Barbosa, H.D.M.J and Morais, F. and Artaxo, P. and W{\"a}ngberg, I. and Munthe, J. and Martin, L. and Labuschagne, C. and Brunke, E.G. and Weigelt, A. and Ebinghaus, R. and Landis, M. and Mannarino, V. and Cinnirella, S. and Carbone, F. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Cossa, D. and Knoery, J. and Marusczak, Nicolas and Nerentorp, M. and Fisicaro, P.} } @Article { , title = {Comb mode filtering silver mirror cavity for spectroscopic distance measurement}, journal = {Review of Scientific Instruments}, year = {2016}, month = {9}, day = {19}, volume = {87}, number = {2016}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {093107}, keywords = {Mirrors, frequency combs, silver, Fabry-Perot interfermoters, piezoelectric transducers}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/87/9/10.1063/1.4962681}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, DOI = {10.1063/1.4962681}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Šm{\'i}d, R. and H{\"a}nsel, A. and Pravdova, L. and Cip, O. and Bhattacharya, N.} } @Article { LegreKKJGCBMMS2016, subid = {751}, title = {Creation of backdoors in quantum communications via laser damage}, journal = {Physical Review A}, year = {2016}, month = {9}, day = {15}, volume = {94}, number = {3}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {030302(R)}, keywords = {Quantum Cryptography, Quantum Communication}, web_url = {https://link.aps.org/accepted/10.1103/PhysRevA.94.030302}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.94.030302}, stag_bib_extends_levelofaccess = {NA}, author = {Makarov, V. and Bourgoin, J.P. and Chaiwongkhot, P. and Gagn{\'e}, M. and Jennewein, T. and Kaiser, S. and Kashyap, R. and Legr{\'e}, M. and Minshull, C. and Sajeed, S.} } @Proceedings { , title = {Proficiency Testing for Conducted Immunity with a new Round Robin Test Device}, journal = {International Symposium and Exhibition on Electromagnetic Compatibility Proceedings}, year = {2016}, month = {9}, day = {10}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-100}, keywords = {Electromagnetic Compatibility (EMC), IEC 61000- 4-6, EN ISO 17025, EN ISO 17043, proficiency testing, round robin, test device, conducted immunity, common mode, disturbance signal, Coupling-Decoupling Network (CDN), inter-laboratory comparison, Equipment under Test (EUT), Auxiliary Equipment (AE).}, web_url = {http://www.emceurope.org/2016/index.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Wroclaw / Poland}, event_name = {EMC Europe 2016 Wroclaw International Symposium and Exhibition on Electromagnetic Compatibility}, event_date = {05-09-2016 to 09-09-2016}, language = {30}, ISBN = {978-1-4799-6615-8}, ISSN = {2158-110X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Tas, Emrah and Cakir, Soydan and Cetintas, Mustafa and Hamouz, Pavel and Isbring, Thomas and Kokalj, Miha and Lopez, Daniel and Lundgren, Urban and Mandaris, Dwi and Pinter, Borut and Poriz, Martin and Pous, Marc and Pythoud, Fr{\'e}d{\'e}ric and Sen, Osman and Silva, Ferran and Svaboda, Marek and Trincaz, Braise and Zhao, Dongsheng} } @Proceedings { , title = {GTEM cell as an alternative method for radiated immunity tests: A comparison with an anechoic chamber}, journal = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, year = {2016}, month = {9}, day = {9}, volume = {2016}, number = {2016}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {251-256}, keywords = {Alternative Test Methods, EMC, GTEM cell, Anechoich chamber, radiated immunity}, web_url = {http://ieeexplore.ieee.org/document/7739215/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Wroclaw}, event_name = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, event_date = {05-09-2016 to 09-09-2016}, language = {30}, ISBN = {978-1-5090-1416-3}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2016.7739215}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SALHI, Mohammed and \c{C}akır, Soydan and \c{C}ınar, Mehmet and TEKTAŞ, Bahadır and \c{C}etintaş, Mustafa} } @Proceedings { , title = {3D/2D radiation pattern measurement of different GSM phones for EMC applications}, journal = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, year = {2016}, month = {9}, day = {9}, volume = {2016}, number = {2016}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {695-700}, keywords = {Alternative test methods, EMC, GSM, Radiation pattern, Radiated immunity}, web_url = {http://ieeexplore.ieee.org/document/7739219/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Wroclaw}, event_name = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, event_date = {05-09-2016 to 09-09-2016}, language = {30}, ISBN = {978-1-5090-1416-3}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2016.7739219}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SALHI, Mohammed and Şen, Osman and \c{C}akır, Soydan and \c{C}etintaş, Mustafa} } @Proceedings { , title = {Improvements in alternative radiated emission test methods with surface wire}, journal = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, year = {2016}, month = {9}, day = {9}, volume = {2016}, number = {2016}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {799-804}, keywords = {Surface Wire, Alternative, Emission, On-Site, Radiated}, web_url = {http://ieeexplore.ieee.org/document/7739212/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Wroclaw}, event_name = {2016 International Symposium on Electromagnetic Compatibility - EMC Europe}, event_date = {05-09-2016 to 09-09-2016}, language = {30}, ISBN = {-}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2016.7739212}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {TEKTAŞ, Bahadır and Şen, Osman and \c{C}akır, Soydan and \c{C}etintaş, Mustafa} } @Article { , title = {Uncertainty budgets of major ozone absorption cross-sections used in UV remote sensing applications}, journal = {Atmospheric Measurement Technique}, year = {2016}, month = {9}, day = {8}, volume = {9}, number = {9}, number2 = {ENV59: atmoz: Traceability for atmospheric total column ozone}, pages = {4459-4470}, keywords = {absorption cross section, uncertainty, remote sensing}, web_url = {http://www.atmos-meas-tech.net/9/4459/2016/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus Publications}, address = {G{\"o}ttingen}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-9-4459-2016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Weber, M and Gorshelev, V and Serdyuchenko, A} } @Proceedings { , title = {Impact of Surface Curvature on Spectral BRDF of Effect Coatings}, journal = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance}, year = {2016}, month = {9}, day = {7}, volume = {N/A}, number = {N/A}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {295-302}, keywords = {BRDF, effect coatings, colour}, web_url = {http://div2.cie.co.at/?i_ca_id=985}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {CIE}, address = {Vienna, Austria}, event_place = {Prague}, event_name = {Proceedings of 4th CIE Expert Symposium on Colour and Visual Appearance}, event_date = {09-06-2016 to 09-07-2016}, language = {30}, ISBN = {978-3-902842-59-6}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {CIE x043:2016}, author = {Ferrero, A and Bernad, B and Campos, J and Perales, E and Mart{\'i}nez-Verd{\'u}, F M and Smid, M and Porrovecchio, G and Strothk{\"a}mper, C} } @Article { , title = {Comparing methods for evaluating measurement uncertainty given in the JCGM ‘Evaluation of Measurement Data’ documents}, journal = {Measurement}, year = {2016}, month = {8}, day = {31}, volume = {94}, number = {December 2016}, number2 = {14IND10: MET5G: Metrology for 5G communications}, pages = {847–851}, keywords = {measurement uncertainty, GUM, GUM supplements, microwave scattering parameters, standard uncertainty}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116304766}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, language = {30}, DOI = {10.1016/j.measurement.2016.08.015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-8-31}, author = {Stant, L.T. and Aaen, P.H. and Ridler, N. M.} } @Proceedings { , title = {Characterization of HMDS treated CVD Graphene}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {16}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Chemical vapor deposition (CVD), Hexame-thyldisilazane (HMDS), Copper (Cu), CVD graphene (CVDG)}, web_url = {http://ieeexplore.ieee.org/document/7540498/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540498}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Thodkar, K. and Sch{\"o}nenberger, C. and Calame, M. and L{\"u}{\"o}nd, F. and Overney, F. and Jeanneret, B.} } @Article { QuinonesANSBM2016, title = {The Influence of Radon (Gas and Progeny) and Weather Conditions on Ambient Dose Equivalent Rate}, journal = {Radiation Protection Dosimetry}, year = {2016}, month = {8}, day = {13}, volume = {174}, number = {3}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {1-8}, keywords = {radon, radon progeny, ambient dose equivalent rate, dosimetry}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncw219}, stag_bib_extends_levelofaccess = {NA}, author = {Qui{\~n}ones, J. and Alvarez, A. and Navarro, N. and Saez, J. C. and Benito, G. and M{\'a}rquez, J. L.} } @Proceedings { , title = {Convenient Graphene-Based Quantum Hall Resistance Standards}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Graphene, materials science and technology, measurement standards, metrology, quantum Hall effect devices}, web_url = {http://ieeexplore.ieee.org/document/7540650/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540650}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Brun-Pcard, J. and Ribeiro-Palau, R. and Lafont, F. and Kazazis, D. and Michon, A. and Cheynis, F. and Couturaud, O. and Consejo, C. and Jouault, B. and Poirier, W. and Schopfer, F.} } @Proceedings { , title = {Experimental Study of Carrier Density Tuning in Epitaxial Graphene QHR Devices}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Epitaxial graphene, graphene fabrication, carrier concentration, chemical functionalization, precision measurement}, web_url = {http://ieeexplore.ieee.org/document/7540518/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540518}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Fletcher, N. and Gournay, P. and Rolland, B. and G{\"o}tz, M. and Notikov, S. and Lebedeva, N. and Satrapinski, A.} } @Proceedings { , title = {Magnetocapacitance and Dissipation Factor of Epitaxial Graphene Hall Bars}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {graphene, quantum Hall effect, coaxial bridge circuit, magnetocapacitance, dissipation factor}, web_url = {http://ieeexplore.ieee.org/document/7540651/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540651}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schurr, J. and Kalmbach, C.C. and Kruskopf, M. and M{\"u}ller, A. and Pierz, K. and Ahlers, F.} } @Proceedings { , title = {Precision Measurements of Quantum Hall Resistance Plateau in Doping-Controlled Graphene Device}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Graphene, quantum Hall effect, precision measurement, resistance metrology, cryogenic current comparator}, web_url = {http://ieeexplore.ieee.org/document/7540495/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540495}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Chae, D.H. and Kim, W.S. and Satrapinski, A. and Novikov, S.} } @Proceedings { , title = {Testing the new generation of low-frequency current comparators}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Resistance measurement, CCC, current comparator, low frequency, measurement uncertainty, sensitivity}, web_url = {http://ieeexplore.ieee.org/document/7540594/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540594}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Satrapinski, A. and G{\"o}tz, M. and Pesel, E. and Fletcher, N. and Gournay, P. and Rolland, B.} } @Proceedings { , title = {Tests of Series Quantum Hall Arrays Based on Epitaxial Graphene}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Epitaxial graphene, graphene fabrication, quantum Hall array, quantum resistance standard}, web_url = {http://ieeexplore.ieee.org/document/7540653/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540653}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Novikov, S. and Lebedeva, N. and Manninen, A.J. and Satrapinski, A.} } @Proceedings { , title = {Stable arbitrary waveform generator as a transfer standard for ADC calibration}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016), Conference Digest}, year = {2016}, month = {8}, day = {11}, volume = {CPEM 2016 Conference Digest}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {ac voltage measurement, signal synthesis, digital-to-analog converter, analog-to-digital converter, comparison, sampling, ac-dc transfer.}, web_url = {http://ieeexplore.ieee.org/document/7540454/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York, USA}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {July 10-15, 2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540454}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Nissila, J. and Lee, J. and Sira, M. and {\"O}zt{\"u}rk, T. and Arifovic, M. and Diaz de Aguilar, J. and Lapuh, R. and Behr, R.} } @Article { , title = {Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites}, journal = {International Journal of Remote Sensing}, year = {2016}, month = {8}, day = {9}, volume = {37}, number = {19}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {4665-4682}, keywords = {Non-normal distribution of the top-of-atmosphere satellite optical measurements over calibration sites}, web_url = {http://www.tandfonline.com/doi/full/10.1080/01431161.2016.1220030}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Taylor and Francis}, address = {Abingdon}, language = {30}, ISSN = {1366-5901}, DOI = {10.1080/01431161.2016.1220030}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gorrono, JG and Bialek, AB and Green, PDG and Harris, PH and Scanlon, TS and Fox, NPF and Underwood, CU} } @Proceedings { , title = {Calibration of Si-SPAD detectors using the double attenuator technique and a low noise silicon photodiode}, journal = {DGaO Proceedings 2016}, year = {2016}, month = {8}, day = {8}, volume = {117}, number = {none}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {28-29}, keywords = {Calibration, SPAD}, web_url = {http://www.dgao-proceedings.de/download/117/117_p28.pdf}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {DGaO}, address = {Erlangen}, event_place = {Hannover}, event_name = {DGaO - Deutschen Gesellschaft f{\"u}r angewandte Optik}, event_date = {12-05-2016 to 17-05-2016}, language = {30}, ISSN = {1614-8436}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.dgao-proceedings.de/download/117/117_p28.pdf}, author = {Lopez, M. and Porrovecchio, G. and Hofer, H. and Rodiek, B. and Šmid, M. and K{\"u}ck, S.} } @Article { , title = {The calibration of a prototype occluded ear simulator designed for neonatal hearing assessment applications}, journal = {AIP Citation}, year = {2016}, month = {8}, day = {5}, volume = {140 (2016)}, number = {2}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {806–813}, keywords = {occluded ear simulator, prototype, neonatal hearing assessment applications, Microphones, Ears, Calibration, Acoustic impedance measurement, Sound pressure}, web_url = {http://scitation.aip.org/content/asa/journal/jasa/140/2/10.1121/1.4960517}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {The Journal of the Acoustical Society of America}, address = {Melville, NY}, language = {30}, DOI = {10.1121/1.4960517}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Barham, R. and Olsen, E.S. and Rodrigues, D. and Barrera-Figueroa, S. and Sadikoğlu, E. and Karab{\"o}ce, B.} } @Article { , title = {Update on the status of metrology for metalloproteins}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, month = {8}, day = {3}, volume = {31}, number = {9/2016}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1756-1765}, keywords = {Metalloproteins, Haemoglobin, transferrin, superoxide dismutase, ceruloplasmin, prenatal diagnostics}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00181E\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Royal Society of Chemistry}, address = {Cambridge, United Kingdom}, language = {30}, ISSN = {0267-9477 (print) ; 1364-5544 (online)}, DOI = {10.1039/c6ja00181e}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Swart, Claudia and Jakubowski, Norbert} } @Proceedings { , title = {First ac measurements of the quantum Hall effect in epitaxial graphene}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2016}, month = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {38--39}, keywords = {AC analysis technique,AC loss elimination,AC measurement,C,Electrical resistance measurement,Gallium arsenide,Graphene,Hall effect,Impedance,Noise,Resistance,electric current measurement,epitaxial graphene-based impedance standard,graphene,impedance,quantized Hall resistance,quantum Hall effect,spectral noise density}, web_url = {http://ieeexplore.ieee.org/articleDetails.jsp?arnumber=6898247}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898247}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kalmbach, C. and Schurr, J. and Ahlers, F.J. and M{\"u}ller, A. and Novikov, S. and Lebedeva, N. and Satrapinsky, A.} } @Article { , title = {Characterization of a Multi-Element Clinical HIFU System Using Acoustic Holography and Nonlinear Modeling}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2016}, month = {8}, volume = {60}, number = {8}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1683-98}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Institute of Electrical and Electronics Engineers}, language = {30}, ISSN = {0885–3010}, DOI = {10.1109/TUFFC.2013.2750}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Krieder, w and Yuldashev, P and Sapoznikov, OA and Farr, N and Partinen, A and Bailey, MR and Khokhlova, VA} } @Article { , title = {The Feasibility of Thermal Imaging as a Future Portal Imaging Device for Therapeutic Ultrasound}, journal = {Ultrasound in Medicine and Biology}, year = {2016}, month = {8}, volume = {42}, number = {8}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {2033–2038}, keywords = {High intensity focused ultrasound dosimetry, Quality assurance, Thermal mapping, Acoustic field evaluation, Magnetic resonance–guided focused ultrasound surgery, Infrared camera}, web_url = {http://www.sciencedirect.com/science/article/pii/S0301562916300047}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier}, language = {30}, ISSN = {0301-5629}, DOI = {10.1016/j.ultrasmedbio.2016.03.028}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-9-1}, author = {Miloro, P and Civale, J and Rivens, I and Shaw, A} } @Article { , title = {Advances in Large Scale Metrology – Review and Future Trends}, journal = {CIRP Annals Manufacturing Technology}, year = {2016}, month = {8}, volume = {65/I}, number = {2016}, number2 = {ENG56: Drive Train: Traceable measurement of drive train components for renewable energy systems}, pages = {643-665}, keywords = {Metrology, Measuring Instrument, Uncertainty, Simulation, Modelling, Information}, web_url = {http://www.sciencedirect.com/science/article/pii/S0007850616301895}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Oxford}, language = {30}, DOI = {10.1016/j.cirp.2016.05.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Schmitt, R. and Peterek, M. and Morse, E. and Knapp, W. and Galetto, M. and H{\"a}rtig, F. and Goch, G. and Hughes, B. and Forbes, A. and Estler, W.T.} } @Article { , title = {Long-term Stability of Al2O3 Passivated Black Silicon}, journal = {Energy Procedia}, year = {2016}, month = {8}, volume = {92}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {341-346}, keywords = {Black silicon, Nano-texturing, Surface passivation, Lifetime, Atomic layer deposition, Al2O3, Solar cells}, web_url = {http://www.sciencedirect.com/science/article/pii/S1876610216305203}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.egypro.2016.07.093}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Calle, E. and Ortega, P. and von Gastrow, G. . and Martin, I and Savin, H. and Alcubilla, R.} } @Article { , title = {Effect of different ALD Al2O3 oxidants on the surface passivation of black silicon}, journal = {Energy Procedia}, year = {2016}, month = {8}, volume = {92}, number = {-}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {381-385}, keywords = {black silicon; surface passivatoin; aluminum oxide}, web_url = {http://www.sciencedirect.com/science/article/pii/S1876610216305434}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {-}, language = {30}, DOI = {10.1016/j.egypro.2016.07.116}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Repo, P. and Savin, H.} } @Article { HerrmannPSHM2016, title = {Photovoltaic energy rating data sets for Europe}, journal = {Solar Energy}, year = {2016}, month = {8}, volume = {133}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {349-362}, keywords = {Photovoltaics; Energy rating; Sensitivity analysis; Power matrix}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York}, language = {30}, ISSN = {0038-092X}, DOI = {10.1016/j.solener.2016.03.071}, stag_bib_extends_levelofaccess = {NA}, author = {Herrmann, W and Pozza, A and Salis, E and Huld, T and M{\"u}llejans, H} } @Article { SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016, subid = {135}, title = {A clock network for geodesy and fundamental science}, journal = {Nature Communications}, year = {2016}, month = {8}, volume = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {12443}, keywords = {Clock network; geodesy;}, web_url = {https://www.nature.com/articles/ncomms12443}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms12443}, stag_bib_extends_levelofaccess = {NA}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and Doerscher, S. and Haefner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G. and Amy-Klein, A. and Le Targat, R. and Lodewyck, J. and Lopez, O and Pottie, P.-E.} } @Article { SvecSSRPNMLKJGFFDMAHBTTVW2016_2, title = {60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {8}, volume = {114}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {167-172}, keywords = {Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.05.014}, stag_bib_extends_levelofaccess = {NA}, author = {Svec, A. and Solc, J. and Silva, L. and Reis, M. and Peyres, V. and Nečemer, M. and Moser, H. and Luca, A. and Klemola, S. and Javornik, A. and Garc{\'i}a-Tora{\~n}o, E. and Ferreux, L.. and Fazio, A. and Dry{\'a}k, P. and Marroyo, B.C. and Arnold, D. and Hult, M. and Burda, O. and Tzika, F. and Tyminski, Z. and Vodenik, B. and W{\"a}tjen, U.} } @Article { ShortisRKMB2016_2, title = {Optimised multi-camera systems for dimensional control in factory environments}, journal = {Proceedings of the Institution of Mechanical Engineers, Part B: Journal of Engineering Manufacture}, year = {2016}, month = {8}, volume = {232}, number = {10}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {1707-1718}, keywords = {Industrial photogrammetry, camera calibration, refraction correction, manufacturing, part assembly}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SAGE Publications}, language = {30}, ISSN = {0954-4054, 2041-2975}, DOI = {10.1177/0954405416654936}, stag_bib_extends_levelofaccess = {NA}, author = {Shortis, M. and Robson, S. and Kyle, S. and MacDonald, L. and Boehm, J.} } @Article { WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016, title = {Five-year records of Total Mercury Deposition flux at GMOS sites in the Northern and Southern Hemispheres}, journal = {Atmospheric Chemistry and Physics Discussions}, year = {2016}, month = {7}, day = {20}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {1-33}, keywords = {mercury, wet deposition flux,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7375}, DOI = {10.5194/acp-2016-517}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}ngberg, I. and Walters, C. and Vard{\`e}, M. and Spandow, P. and Somerset, V. and Sena, F. and Islas, M.R. and Obolkin, V. and Munthe, J. and Mkololo, T. and Mashyanov, N. and Martin, L. and Magand, O. and Labuschagne, C. and Kotnik, J. and Horvat, M. and Hansson, K. and Hagestr{\"o}m, U. and Gawlik, B. and Garcia, P.E. and Fu, X. and Feng, X.B. and Ebinghaus, R. and Dommergue, A. and Di{\'e}guez, M.D.C. and Comero, S. and Cairns, W. and Arcega-Cabrera, F. and Brunke, E.G. and Barbante, C. and Angot, H. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Weigelt, A. and Yang, X. and Fisicaro, P.} } @Proceedings { , title = {Close range calibration of long focal length lenses in a changing environment}, journal = {The International Archives of the Photogrammetry, Remote Sensing and Spatial Information Sciences}, year = {2016}, month = {7}, day = {19}, volume = {2016}, number = {XLI-B5}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {115-122}, keywords = {Camera, calibration, close range, physical parameter, correlation, temperature, wavelength}, web_url = {http://www.int-arch-photogramm-remote-sens-spatial-inf-sci.net/XLI-B5/115/2016/isprs-archives-XLI-B5-115-2016.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {ISPRS}, address = {Hannover}, event_place = {Prague, Czech Republic}, event_name = {XXIII International Socirty of Photogrammetry and Remote Sensing Congress}, event_date = {12-19 July 2016}, language = {30}, DOI = {10.5194/isprs-archives-XLI-B5-115-2016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Robson, S and MacDonald, L and Kyle, S and Shortis, M R} } @Proceedings { , title = {Quasi coherent overlapping procedure to improve harmonics suppression using single tone estimation algorithms}, journal = {Proceedings CPEM 2016}, year = {2016}, month = {7}, day = {18}, volume = {54}, number = {12}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Measurement, sampling, estimation algorithms, harmonic distortion, estimation error, uncertainty}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540596}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Unknown}, event_place = {Ottawa}, event_name = {Conference on Precision Elexctromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {0018-9456}, ISSN = {0018-9456}, DOI = {10.1109/CPEM.2016.7540596}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lapuh, Rado and Voljč, Boštjan and Kokalj, Miha and Lindič, Matjaž and Svetik, Zoran} } @Proceedings { , title = {Uncertainty of the Signal Parameter Estimation from Sampled Data}, journal = {Proceedings CPEM 2016}, year = {2016}, month = {7}, day = {18}, volume = {54}, number = {12}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {Measurement, sampling, estimation algorithms, harmonic distortion, estimation error, uncertainty}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7540770}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Unknown}, event_place = {Ottawa}, event_name = {Conference on Precision Elexctromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {0018-9456}, ISSN = {0018-9456}, DOI = {10.1109/CPEM.2016.7540770}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lapuh, Rado and Šira, Martin and Lindič, Matjaž and Voljč, Boštjan} } @Proceedings { , title = {QWTB – Software Tool Box for Sampling Measurements}, journal = {Conference on Precision Electromagnetic Measurements Digest}, year = {2016}, month = {7}, day = {15}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {2}, keywords = {Algorithms, measurement, open source software, signal sampling, software tools, uncertainty.}, web_url = {http://ieeexplore.ieee.org/document/7540599/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Ontario, Canada}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {10-07-16 to 15-07-16}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540599}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Š{\'i}ra, MŠ and Mašl{\'a}ň, SM and Nov{\'a}kov{\'a} Zachovalov{\'a}, VNZ} } @Proceedings { , title = {Verification concepts in S-parameter measurements}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, day = {15}, volume = {NA}, number = {NA}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {NA}, keywords = {Verification, scattering parameter, vector network analyzer.}, web_url = {http://ieeexplore.ieee.org/document/7540508/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {NA}, language = {30}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540508}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mubarak, F. and Zeier, M. and Hoffmann, J. and Ridler, N.M. and Salter, M.J. and Kuhlmann, K.} } @Article { , title = {High resolution kilometric range optical telemetry in air by radio frequency phase measurement}, journal = {Review of Scientific Instruments}, year = {2016}, month = {7}, day = {12}, volume = {87}, number = {2016}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {075101}, keywords = {telemeter, ADM, laser tracker}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/87/7/10.1063/1.4954180}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.4954180}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Guillory, J. and Šm{\'i}d, R. and Garcia-M{\'a}rquez, J. and Truong, D. and Alexandre, C. and Wallerand, J.-P.} } @Proceedings { , title = {Comparison of Calibration Methods for Multiport VNAs up to 67 GHz}, journal = {Conference on Precision Electromagnetic Measurements, Ottawa, Canada, 10 – 15 July 2016 (CPEM 2016)}, year = {2016}, month = {7}, day = {10}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {N/A}, keywords = {VNA characterization, multiport measurements, calibration methods, error correction models}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7540728}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, USA}, event_place = {Ottawa, Canada}, event_name = {Conference on Precision Electromagnetic Measurements 2016 (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, DOI = {10.1109/CPEM.2016.7540728}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Zinal, S. and Allal, D. and Salter, M.} } @Proceedings { , title = {Uncertainty Evaluation of Balanced S-Parameter Measurements}, journal = {Conference on Precision Electromagnetic Measurements, Ottawa, Canada, 10 – 15 July 2016}, year = {2016}, month = {7}, day = {10}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {N/A}, keywords = {Balanced devices, electromagnetic simulation, Monte Carlo method, scattering parameters, uncertainty analysis, signal integrity, vector network analyzer.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7540616}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, USA}, event_place = {Ottawa, Canada}, event_name = {Conference on Precision Electromagnetic Measurements 2016 (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, DOI = {10.1109/CPEM.2016.7540616}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ziade, F. and Hudlicka, M. and Salter, M. and Pavlicek, T. and Allal, D.} } @Proceedings { , title = {A Nonlinear Verification Device for Nonlinear Vector Network Analyzers}, journal = {Proceedings Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, month = {7}, day = {10}, volume = {1}, number = {1}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-2}, keywords = {Impedance matching, electromagnetic modeling, measurement uncertainty, microwave integrated circuits, nonlinear network analysis, semiconductor diodes.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7540467\&isnumber=7539723}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Westin Hotel, Ottawa, Ontario, Canada}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 16-07-2016}, language = {30}, ISBN = {N/A}, ISSN = {05891485}, DOI = {10.1109/CPEM.2016.7540467}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Humphreys, D. A. and Rajabi, M. and Schreur, D. and Nielsen, T.} } @Proceedings { , title = {An AC Power Amplifier for Testing Instrument Transformer Test Equipment}, journal = {Conference on Precision Electromagnetic Measurements 2016 (Digest)}, year = {2016}, month = {7}, day = {10}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, keywords = {Analogue power amplifier, voltage gain, transconductance, test equipment, instrument transformers}, web_url = {http://ieeexplore.ieee.org/document/7540559/}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Ottawa}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540559}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Enrico, Mohns and Soeren, Fricke and Florian, Pauling} } @Article { , title = {Comparison at the sub-100 fW optical power level of calibrating a single-photon detector using a high-sensitive, low-noise silicon photodiode and the double attenuator technique}, journal = {Metrologia}, year = {2016}, month = {7}, day = {8}, volume = {53}, number = {4}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {1115-1122}, keywords = {detection efficiency, Si-SPAD, calibration, comparison}, web_url = {http://iopscience.iop.org/journal/0026-1394}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Oxford}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1115}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Porrovecchio, G. and Šmid, M. and Lopez, M. and Hofer, H. and Rodiek, B. and K{\"u}ck, S.} } @Article { , title = {Optical to microwave clock frequency ratios with a nearly continuous strontium optical lattice clock}, journal = {Metrologia}, year = {2016}, month = {7}, day = {8}, volume = {53}, number = {4}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {1123}, keywords = {atomic clocks, high precision spectrocopy, frequency ratios, optical lattice clocks}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1123/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1123}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lodewyck, J and Bilicki, S and Bookjans, E and Robyr, J-L and Shi, C and Vallet, G and Le Targat, R and Nicolodi, D and Le Coq, Y and Gu{\'e}na, J and Abgrall, M and Rosenbusch, P and Bize, S} } @Proceedings { , title = {On-board compact system for full time-domain electromagnetic interference measurements}, journal = {Aerospace EMC (Aerospace EMC), 2016 ESA Workshop on}, year = {2016}, month = {7}, day = {7}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {-}, keywords = {Electromagnetic interference, Antenna measurements, Voltage measurement, Current measurement, Frequency measurement, Time-domain analysis, Lightning}, web_url = {http://ieeexplore.ieee.org/document/7504579/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {-}, event_place = {Valencia (Spain)}, event_name = {Aerospace EMC (Aerospace EMC), 2016 ESA Workshop on}, event_date = {23-05-2016 to 25-05-2016}, language = {30}, ISBN = {978-9-2922-1303-9}, DOI = {10.1109/AeroEMC.2016.7504579}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {16138551}, author = {Azp{\'u}rua, Marco and Pous, Marc and Silva, Ferran} } @Article { , title = {Reference data sets for testing metrology software}, journal = {Metrologia}, year = {2016}, month = {7}, day = {6}, volume = {53}, number = {4}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {1091-1100}, tags = {MAT}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1091}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1091}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kok, GJPK and Harris, PMH and Smith, IMS and Forbes, ABF} } @Article { , title = {A second generation of low thermal noise cryogenic silicon resonators}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {7}, day = {4}, volume = {723}, number = {1}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {012031}, keywords = {ultrastable laser, thermal noise, coating, silicon resonator}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012031/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {1742-6596}, DOI = {10.1088/1742-6596/723/1/012031}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Matei, D and Legero, T and Grebing, C and H{\"a}fner, S and Lisdat, C and Weyrich, R and Zhang, W and Sonderhouse, L and Robinson, J M and Riehle, F and Ye, J and Sterr, U} } @Proceedings { , title = {Realization of Quantum Hall Effect in Closed Cycle Refrigerators}, journal = {Conference Digest}, year = {2016}, month = {7}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {2}, keywords = {Cryogen-free, measurement standards, quantum Hall effect, graphene, resistance}, web_url = {http://cpem2016.com/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Danvers}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9133-7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Kučera, J. and Š{\'i}ra, M. and Svoboda, P. and Kaštil, J.} } @Proceedings { , title = {Characterization and Optimization of Ultrasonic Tests for Inspection of Fiber-Reinforced Plastic Composites in Energy Related Applications, 19th World Conference on Non-Destructive Testing 13-17 June 2016, Munich}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Energy Generation}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-8}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we4d5.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hosseini, SH and Segur, DS and Boehm, RB and Gohlke, DG and Heckel, TH and Riemer, SR and Brackrock, DB and Gaal, MG} } @Proceedings { , title = {Simulation of ultrasonic inspections of composite structures in the CIVA software platform}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Modelling and Data Processing}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-8}, keywords = {Ultrasonic Testing (UT), Modelling and Data Processing}, web_url = {http://www.ndt.net/article/wcndt2016/papers/fr1h5.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Jezzine, KJ and Segur, DS and Ecault, RE and Dominguez, ND} } @Proceedings { , title = {Design and manufacture of reference and natural defect artefacts for the evaluation of NDE techniques for fibre reinforced plastic (FRP) composites in energy applications}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Composite Materials}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-10}, keywords = {Infrared Testing (IRT), Ultrasonic Testing (UT), Visual and Optical Testing (VT/OT), Other Methods, delamination, validation, carbon fiber reinforced plastic (CFRP), Glass Fiber Reinforced Plastic (GFRP), tensile load, flat bottom hole}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we1e4.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gower, MG and Lodeiro, ML and Aktas, AA and Shaw, RS and Maierhofer, CM and Krankenhagen, RK and Augustin, SA and R{\"o}llig, MR and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Judaschke, RJ and Segur, DS} } @Article { GiuscaSPZCMSK2016, title = {Effects of humidity on the electronic properties of graphene prepared by chemical vapour deposition}, journal = {Carbon}, year = {2016}, month = {7}, volume = {103}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {273-280}, keywords = {Chemical vapour deposition, Graphene, Kelvin probe force microscopy, Raman spectroscopy}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {New York, USA}, language = {30}, DOI = {10.1016/j.carbon.2016.03.018}, stag_bib_extends_levelofaccess = {NA}, author = {Giusca, Christina E. and Spencer, Steve and Panchal, Vishal and Zurutuza, Amaia and Centeno, Alba and Melios, Christos and Silva, S. Ravi P. and Kazakova, Olga} } @Proceedings { StyblikovaKHPD2016, title = {Use of a nanocrystalline core for a precise non-invasive AC current measurement}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, month = {7}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, keywords = {AC current sensor, nanocrystalline material, non-invasive measurement, phase displacement, ratio error.}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Ottawa, ON, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540492}, stag_bib_extends_levelofaccess = {NA}, author = {Styblikova, R. and Knenicky, M and Hlavacek, J. and Prochazka, R. and Draxler, K.} } @Article { , title = {Precise measurement of the performance of thermoelectric modules}, journal = {Measurement Science and Technology}, year = {2016}, month = {6}, day = {23}, volume = {27}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {085002}, keywords = {thermoelectric generator, metrology, accuracy, precision, reproducibility}, web_url = {http://iopscience.iop.org/article/10.1088/0957-0233/27/8/085002/meta}, web_url2 = {http://pubs.rsc.org/en/content/ebook/978-1-78262-323-6\#!divbookcontent}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Physics}, address = {London}, language = {30}, DOI = {10.1088/0957-0233/27/8/085002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-6-23}, stag_bib_extends_persistent_identifier = {http://pubs.rsc.org/en/content/chapter/bk9781782623236-00109/978-1-78262-323-6\#!divabstract}, author = {DIAZ-CHAO, P and MUNIZ-PINIELLA, A and SELEZNEVA, E and Cuenat, A} } @Proceedings { CalmonDESJ2016, title = {Hybrid ray-FDTD model for the simulation of the ultrasonic inspection of CFRP parts}, journal = {QNDE16}, year = {2016}, month = {6}, day = {16}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, keywords = {Hybrid ray-FDTD simulation ultrasonic inspection CFRP}, web_url = {http://aip.scitation.org/doi/pdf/10.1063/1.4974660}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Atlanta}, event_name = {QNDE16}, event_date = {17-07-2016 to 22-07-2016}, language = {30}, DOI = {10.1063/1.4974660}, stag_bib_extends_levelofaccess = {NA}, author = {Calmon, P. and Dominguez, N. and Ecault, R. and S{\'e}gur, D. and Jezzine, K.} } @Article { , title = {High-speed atomic force microscopy for materials science}, journal = {International Materials Reviews}, year = {2016}, month = {6}, day = {14}, volume = {61}, number = {8}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {473-494}, keywords = {Atomic force microscopy, AFM, High-speed AFM, Nanoscale analysis}, web_url = {http://www.tandfonline.com/doi/abs/10.1080/09506608.2016.1156301?journalCode=yimr20}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Taylor \& Francis}, address = {London}, language = {30}, DOI = {10.1080/09506608.2016.1156301}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Payton, O.D. and Picco, L. and Scott, T.B.} } @Article { , title = {High-performance near- and mid-infrared crystalline coatings}, journal = {Optica}, year = {2016}, month = {6}, day = {13}, volume = {3}, number = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {647}, keywords = {(300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings; (310.1860) Deposition and fabrication; (140.4780) Optical resonators.}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington, D.C. 20036-1012 USA}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.3.000647}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {COLE, G D and ZHANG, W and BJORK, B J and FOLLMAN, D and HEU, P and DEUTSCH, C and SONDERHOUSE, L and ROBINSON, J and FRANZ, C and ALEXANDROVSKI, A and NOTCUTT, M and HECKL, O H and YE, J and ASPELMEYER, M} } @Article { SterrAKGHVL2016, title = {A transportable optical lattice clock}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {6}, volume = {723}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {012020}, keywords = {time and frequency metrology, transportable optical lattice clock, chronometric geodesy}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012020/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/723/1/012020}, stag_bib_extends_levelofaccess = {NA}, author = {Sterr, U. and Al-Masoudi, A. and Koller, S. and Grotti, J. and H{\"a}fner, S. and Vogt, S. and Lisdat, C.} } @Article { , title = {Alternative radiated emission measurements at close distance in industry}, journal = {International Journal of RF and Microwave Computer-Aided Engineering}, year = {2016}, month = {5}, day = {31}, volume = {26}, number = {4}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {294-303}, keywords = {Alternative; close distance; emission; on-site; radiated}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/mmce.20977/epdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wiley Online Library}, address = {USA}, language = {30}, ISSN = {-}, DOI = {10.1002/mmce.20977}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Şen, Osman and TEKTAŞ, Bahadır and \c{C}akır, Soydan and \c{C}etintaş, Mustafa} } @Proceedings { , title = {Maximizing the Benefit of Existing Equipment for Nonlinear and Communication Measurements}, journal = {N/A}, year = {2016}, month = {5}, day = {27}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Nonlinear measurements, oscilloscope, sampling, analogue to digital conversion}, web_url = {http://www.arftg.org/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {San Francisco, CA, USA}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30}, stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART}, author = {Humphreys, D. A. and Raffo, A. and Bosi, G. and Vannini, G. and Schreurs, D. and Gebremicael, K. N. and Morris, K.} } @Proceedings { , title = {Impact of Microwave Measurement Uncertainty on the Nonlinear Embedding Procedure}, journal = {N/A}, year = {2016}, month = {5}, day = {27}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Microwave measurements uncertainty, microwave transistors, nonlinear embedding, power amplifiers, vector-calibrated nonlinear measurements.}, web_url = {http://www.arftg.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {San Francisco, CA, USA}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30}, stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART}, author = {Bosi, G. and Raffo, A. and Avolio, G. and Schreurs, D. and Humphreys, D. A.} } @Article { , title = {Realization of a timescale with an accurate optical lattice clock}, journal = {Optica}, year = {2016}, month = {5}, day = {25}, volume = {3}, number = {6}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {563-569}, keywords = {optical clocks, SI units, caesium fountain clocks, metrology, atom optics, spectroscopy, high resolution}, web_url = {http://arxiv.org/abs/1511.03888}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Optical Society of America}, address = {Washington DC}, language = {30}, ISSN = {n/a}, DOI = {10.1364/OPTICA.3.000563}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-5-25}, author = {Grebing, C and Al-Masoudi, A and D{\"o}rscher, S and H{\"a}fner, S and Gerginov, V and Weyers, S and Lipphardt, B and Sterr, U and Lisdat, C} } @Article { , title = {Aperture alignment in autocollimator-based deflectometric profilometers}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2016}, month = {5}, day = {24}, volume = {87}, number = {051906 (2016)}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-9}, keywords = {Apertures, Calibration Charge coupled devices, Ray tracing, Optical aberrations}, web_url = {http://aip.scitation.org/doi/10.1063/1.4950734}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Institute of Physics}, address = {Melville, NY 11747-4300 USA}, language = {30}, ISSN = {Print: 0034-6748, Online: 1089-7623}, DOI = {10.1063/1.4950734}, extern = {1}, stag_bib_extends_fe_group = {55,59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Geckeler, R. D. and Artemiev, N. A. and Barber, S. K. and Just, A and Lacey, I. and Kranz, O and Smith, B. V. and Yaschckuk, V. V.} } @Article { , title = {Linear chirped slope profile for spatial calibration in slope measuring deflectometry}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2016}, month = {5}, day = {24}, volume = {87}, number = {051907 (2016)}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-9}, keywords = {Spatial resolution, Modulation transfer functions, Topography, Calibration, Spatial dimensions}, web_url = {http://aip.scitation.org/doi/10.1063/1.4950737}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Institute of Physics}, address = {Melville, NY 11747-4300 USA}, language = {30}, ISSN = {ISSN: Print: 0034-6748, Online: 1089-7623}, DOI = {10.1063/1.4950737}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Siewert, F and Zeschke, T and Arnold, T and Paetzelt, H and Yashchuk, VV} } @Proceedings { , title = {Influence of dielectric support on military radiated emission tests above 30 MHz}, journal = {2016 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)}, year = {2016}, month = {5}, day = {21}, volume = {01}, number = {-}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {709-711}, keywords = {Radiated Emission, REI 02, Support, MIL-STD- 46IF}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7522843\&newsearch=true\&queryText=RE102\%20support}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Shenzhen}, event_name = {2016 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)}, event_date = {17-05-2016 to 21-05-2016}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1109/APEMC.2016.7522843}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Şen, Osman and \c{C}akır, Soydan and CELEP, Murat and \c{C}ınar, Mehmet and HAMID, Ramiz and \c{C}etintaş, Mustafa} } @Article { , title = {High precision tilt stage as a key element to a universal test mirror for characterization and calibration of slope measuring instruments}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2016}, month = {5}, day = {20}, volume = {87}, number = {051904 (2016)}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-12}, keywords = {Calibration, Mirrors, X-ray optics, Apertures, Comparators}, web_url = {http://aip.scitation.org/doi/10.1063/1.4950729}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Institute of Physics}, address = {Melville, NY 11747-4300 USA}, language = {30}, ISSN = {Print: 0034-6748, Online: 1089-7623}, DOI = {10.1063/1.4950729}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yashchuk, VV and Artemiev, NA and Centers, G and Chaubard, A and Geckeler, RD and Lacey, I and Marth, H and McKinney, WR and Noll, T and Siewert, F and Winter, M and Zeschke, T} } @Article { , title = {Nonequilibrium thermodynamics of the spin Seebeck and spin Peltier effects}, journal = {Physical Review B}, year = {2016}, month = {5}, day = {18}, volume = {93}, number = {184421}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {184421-1-11}, keywords = {spincaloritronics, Spin-Seebeck, Spin-Peltier}, web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.93.184421}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {2469-9969 (online), 2469-9950 (print)}, DOI = {10.1103/PhysRevB.93.184421}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Basso, V. and Ferraro, E. and Magni, A. and Sola, A. and Kuepferling, M. and Pasquale, M.} } @Proceedings { , title = {Impact of measurement uncertainty on modelling}, journal = {Proc. of 21st International Conference on Microwave, Radar and Wireless Communications (MIKON)}, year = {2016}, month = {5}, day = {9}, volume = {n/a}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Calibration, Measurement uncertainty, Microwave measurement, nonlinear modelling}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7492056\&isnumber=7491934}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Krakow, Poland}, event_name = {21st International Conference on Microwave, Radar and Wireless Communications (MIKON)}, event_date = {9-11 May 2016}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/MIKON.2016.7492056}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schreurs, D. and Liu, S. and Avolio, G. and Ocket, I.} } @Article { , title = {Mini array of quantum Hall devices based on epitaxial graphene}, journal = {Journal of Applied Physics}, year = {2016}, month = {5}, volume = {119}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {174504}, keywords = {QHE, Graphene, measurement,}, web_url = {http://arxiv.org/abs/1512.03163}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.4948675}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Novikov, S. and Lebedeva, N. and H{\"a}m{\"a}l{\"a}inen, J. and Iisakka, I. and Immonen, P. and Manninen, A.J. and Satrapinski, A.} } @Proceedings { , title = {Traceable Calibration with 1.0mm Coaxial Standards}, journal = {2016 87th ARFTG Microwave Measurement Conference (ARFTG)}, year = {2016}, month = {5}, volume = {May 2016}, number = {1}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Coaxial, S-parameters, transmission, reflection, vector network analyzer}, web_url = {http://ieeexplore.ieee.org/document/7501943/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York}, event_place = {San Francisco}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27.5.2016}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/ARFTG.2016.7501943}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hoffmann, J and Wollensack, M and Ruefenacht, J and Stalder, D and Zeier, M} } @Article { StyblikovaD2016, title = {Calibration of AC Clamp Meters}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2016}, month = {5}, volume = {65}, number = {5}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {1156-1162}, keywords = {Resistors, Standards, Current measurement, Voltage measurement, Frequency measurement, Calibration, Measurement uncertainty}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2507413}, stag_bib_extends_levelofaccess = {NA}, author = {Styblikova, R. and Draxler, K.} } @Article { ProfrockGBBNGEPGSG2016, title = {Potential reference measurement procedures for PBDE in surface water at levels required by the EU Water Frame Directive}, journal = {Talanta}, year = {2016}, month = {5}, volume = {152}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {251-258}, keywords = {IDMS, Method Validation, PBDE, Water, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0039-9140}, DOI = {10.1016/j.talanta.2016.01.066}, stag_bib_extends_levelofaccess = {NA}, author = {Pr{\"o}frock, D. and Gonz{\'a}lez-Gago, A. and Binici, B. and B{\'i}lsel, M. and Nousiainen, M. and Goenaga-Infante, H. and Entwisle, J. and Petrov, P. and Gantois, F. and Swart, C. and Goren, A.C.} } @Article { , title = {A Planar Near Field Setup for Millimeter-Wave System-Embedded Antenna Testing}, journal = {IEEE Antennas and Wireless Propagation Letters}, year = {2016}, month = {4}, day = {21}, volume = {PP (pre pubblicaiton)}, number = {99}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {1-4}, keywords = {Embedded antenna, on-module antenna, near field measurement.}, web_url = {http://ieeexplore.ieee.org/document/7457638/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, language = {30}, ISSN = {Print ISSN: 1536-1225 Online ISSN: 1548-5757}, DOI = {10.1109/LAWP.2016.2557239}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7457638/}, author = {Alonso del Pino, M. and Di Rosa, M. and Simeoni, M. and Spella, M. and de Martino, C. and Spirito, M.} } @Article { SchraderKSGKS2016, title = {Near and Far Field Characterization of Planar mm-Wave Antenna Arrays with Waveguide-to-Microstrip Transition}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2016}, month = {4}, day = {12}, volume = {37}, number = {9}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {857-873}, keywords = {Phased patch antenna arrays, Radiation pattern measurements, Millimeter wave antenna design and characterization, Spherical far-field and planar near-field scanner, Near to far field transformation,}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Springer Nature}, address = {233 Spring St. Attn: Joerg Schreiber New York NY 10013 United States}, language = {30}, ISSN = {1866-6892, 1866-6906}, DOI = {10.1007/s10762-016-0273-x}, stag_bib_extends_levelofaccess = {NA}, author = {Schrader, T. and Kleine-Ostmann, T. and Spirito, M. and Gentille, G. and Kazemipour, A. and Salhi, M.A.} } @Article { , title = {Diffusion-induced grain boundary migration as mechanism for grain growth and defect annihilation in chalcopyrite thin films}, journal = {Acta Materialia}, year = {2016}, month = {4}, day = {10}, volume = {111}, number = {-}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {377-384}, keywords = {X-ray diffraction, Physical vapor deposition (PVD), Stacking faults, Grain boundary migration, CuInSe2}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier Ltd.}, address = {Amsterdam}, language = {30}, ISSN = {1359-6454}, DOI = {10.1016/j.actamat.2016.03.073}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Stange, H. and Brunken, S. and Greiner, D. and Heinemann, M. D. and Kaufmann, C. A. and Schmidt, S. S. and B{\"a}cker, J.-P. and Klaus, M. and Genzel, C. and Mainz, R.} } @Proceedings { , title = {JRP SIB60 “Metrology for Long Distance Surveying”-a concise survey on major project results}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {March 30-April 1, 2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pollinger, F. and Bauch, A. and Leute, J. and Meiners-Hagen, K. and Mildner, J. and Guillory, J. and Wallerand, J.-P. and Jokela, J. and Kallio, U. and Koivula, H. and Lahtinen, S. and Poutanen, M. and Astrua, M. and Francese, C. and Zucco, M. and Eusebio, L. and Marques, F. and Pires, C. and Saraiva, F. and Pelligrino, O. and Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M. and Kupko, V. and Neyezhmakov, P. and Bergstrand, S. and van den Berg, S.A. and Kersten, T. and Krawinkel, T.} } @Proceedings { , title = {Towards Kilometric Distance Measurements with Air Refractive Index Compensation}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {Submission 27}, keywords = {Kilometric distance, optical telemetry, two-wavelength telemetry, absolute distance meter.}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {FIG}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {30-03-2016 to 01-04-2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf}, author = {Guillory, J. and Wallerand, J.-P. and Truong, D. and Šm{\'i}d, R. and Alexandre, C.} } @Article { , title = {A determination of Planck’s constant using the NRC watt balance}, journal = {Metrologia}, year = {2016}, month = {3}, day = {31}, volume = {51}, number = {21/06/2016}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {S5-S14}, keywords = {watt balance, Planck’s constant, kilogram}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/51/2/S5/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Metrologia}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/0026-1394/51/2/S5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sanchez, C A and Wood, B M and Green, R G and Liard, J O and Inglis, D} } @Article { , title = {Potential of GPS Common Clock Single-differences for Deformation Monitoring}, journal = {Journal of Applied Geodesy}, year = {2016}, month = {3}, day = {31}, volume = {10}, number = {1}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {pages 45.52}, keywords = {GPS; Monitoring; Clock Modeling; Common Clock; EMRP JRP SIB60}, web_url = {https://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/reviewed/JISDM_2016_submission_101.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {De Gruyter}, language = {30}, ISSN = {(Online) 1862-9024, (Print) 1862-9016}, DOI = {10.1515/jag-2015-0029}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Sch{\"o}n, S. and Pham, H.K. and Kersten, T. and Leute, J. and Bauch, A.} } @Article { , title = {Progress towards the determination of thermodynamic temperature with ultra-low uncertainty}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150046}, keywords = {Boltzmann constant, thermodynamic temperature, International Temperature Scale}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150046}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society Publishing}, address = {London}, language = {30}, ISSN = {1364-503X}, DOI = {10.1098/rsta.2015.0046}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-3-28}, stag_bib_extends_persistent_identifier = {http://rsta.royalsocietypublishing.org/content/374/2064/20150046}, author = {Gavioso, R M and Madonna Ripa, D and Steur, P P M and Gaiser, C and Zandt, T and Fellmuth, B and de Podesta, M and Underwood, R and Sutton, G and Pitre, L and Sparasci, F and Risegari, L and Gianfrani, L and Castrillo, A and Machin, G} } @Article { , title = {Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150044}, keywords = {high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150044}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0044}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wooliams, E.R and Anhalt, K and Ballico, M and Bloembergen, P and Bourson, F and Briaudeau, S and Campos, J and Cox, M.G and del Campo, D and Dong, W and Dury, M.R and Gavrilov, V and Grigoryeva, I and Hernanz, M.L and Jahan, F and Khlevnoy, B and Khromchenko, V and Lowe, D.H and Lu, X and Machin, G and Mantilla, J.M and Martin, M.J and McEvoy, H.C and Rougie, B and Saldi, M and Salim, S.G.R and Sasajima, N and Taubert, D.R and Todd, A.D.W and Van den Bossche, R} } @Article { , title = {DABAM: an open-source database of x-ray mirrors metrology}, journal = {Journal of Synchrotron Radiation}, year = {2016}, month = {3}, day = {24}, volume = {23}, number = {23}, number2 = {SIB58: Angles: Angle metrology}, pages = {665-678}, keywords = {X-ray mirror; metrology; database; Python; statistics.}, web_url = {http://scripts.iucr.org/cgi-bin/paper?S1600577516005014}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IUCr Journals}, address = {Chester CH1 2HU, England}, language = {30}, ISSN = {1600-5775}, DOI = {10.1107/S1600577516005014}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sanchez del Rio, M and Bianchi, D and Cocco, D and Glass, M and Idir, M and Metz, J and Raimondi, L and Rebuffi, L and Reininger, R and Shi, X and Siewert, F and Spielmann-Jaeggi, S and Takacs, P and Tomasset, M and Tonnessen, T and Tonnessenivo, A and Yashchuk, VV} } @Article { , title = {Performance evaluation of a cheap, open source, digital environmental monitor based on the Raspberry Pi}, journal = {Measurement}, year = {2016}, month = {3}, day = {17}, volume = {87}, number = {June 2016}, number2 = {IND53: Large Volume: Large volume metrology in industry}, pages = {228–235}, keywords = {environment, calibration, metrology, air sensor, open source, data logging}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116001871}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2016.03.023}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-3-18}, author = {Lewis, A J and Campbell, M and Stavroulakis, P} } @Article { , title = {Accurate and precise quantification of Cu,Zn-SOD in human red blood cells using species-specific double and triple IDMS}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, month = {3}, day = {17}, volume = {9 / 2016}, number = {31}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1922-1928}, keywords = {Clinical/biomedical analysis, Metalloproteins, Reference materials, Reference measurement procedures}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/c5ja00459d\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {The Royal Society of Chemistry}, address = {Cambridge, United Kingdom}, language = {30}, ISSN = {0267-9477 (print) ; 1364-5544 (online)}, DOI = {10.1039/c5ja00459d}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gleitzmann, Julia and Raab, Andrea and Schulze, Dirk and Waetzig, Hermann and Feldmann, Joerg and Swart, Claudia} } @Article { NadvornikNSNNOJTKWJ2016, title = {Long-range and high-speed electronic spin-transport at a GaAs/AlGaAs semiconductor interface}, journal = {Scientific Reports}, year = {2016}, month = {3}, day = {16}, volume = {6}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {22901}, keywords = {Long-range and high-speed electronic spin-transport at a GaAs/AlGaAs semiconductor interface}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Nature}, address = {233 Spring St., New York NY 10013, USA}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep22901}, stag_bib_extends_levelofaccess = {NA}, author = {N{\'a}dvorn{\'i}k, L. and Němec, P. and Skoromets, V. and Němec, H. and Nov{\'a}k, V. and Olejn{\'i}k, K. and Janda, T. and Troj{\'a}nek, F. and Kužel, P. and Wunderlich, J. and Jungwirth, T.} } @Article { DryakKS2016, title = {Validation of Monte Carlo model of HPGe detector for field-station measurement of airborne radioactivity}, journal = {Journal of Instrumentation}, year = {2016}, month = {3}, day = {15}, volume = {11}, number = {03}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {P03015-P03015}, keywords = {Models and simulations; Dosimetry concepts and apparatus}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/11/03/P03015}, stag_bib_extends_levelofaccess = {NA}, author = {Dry{\'a}k, P. and Kov{\'a}ř, P. and Solc, J.} } @Article { , title = {Preparation and characterisation of an 57Fe enriched haemoglobin spike material for speciesspecific isotope dilution mass spectrometry}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2016}, month = {3}, day = {10}, volume = {31}, number = {9}, number2 = {HLT05: Metallomics: Metrology for metalloproteins}, pages = {1846 - 1857}, keywords = {isotope dilution mass spectrometry (IDMS), MonoQ® ion exchange chromatography, size exclusion column (SEC),high-performance liquid chromatography (HPLC) system}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2016/JA/C6JA00028B\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {0267-9477 (print) ; 1364-5544 (online)}, DOI = {10.1039/c6ja00028b}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Brauckmann, C. and Frank, C. and Schulze, D. and Kaiser, P. and Stosch, R. and Swart, C.} } @Article { , title = {Coherent cancellation of photothermal noise in GaAs/Al0.92Ga0.08As Bragg mirrors}, journal = {Metrologia}, year = {2016}, month = {3}, day = {9}, volume = {53}, number = {2}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {860}, keywords = {photothermal noise, AlGaAs, laser frequency stabilization, Fabry-P{\'e}rot cavities, gravitational waves}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/2/860/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/2/860}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Chalermsongsak, T and Hall, E D and Cole, G D and Follman, D and Seifert, F and Arai, K and Gustafson, E K and Smith, J R and Aspelmeyer, M and Adhikari, R X} } @Article { , title = {Activity standardization, photon emission probabilities and half-life measurements of 177Lu}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number = {March 2016}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {160-163}, keywords = {Radionuclide 177Lu, Activity Standardization, Photon Emission probability, Half-life}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804315302906}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier}, address = {Oxford}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.11.059}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Dryak, P. and Sochorova, J. and Solc, J. and Auerbach, P.} } @Article { AltzitzoglouSM2016, title = {Evaluation of the 2014 EC measurement comparison on 137Cs in air filters}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {36-40}, keywords = {Interlaboratory comparison Environmental radioactivity Spiked air filter 137Cs in air}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.12.008}, stag_bib_extends_levelofaccess = {NA}, author = {Altzitzoglou, T. and Sobiech-Matura, K. and M{\'a}t{\'e}, B.} } @Article { KovarSLTMSHSS2016, title = {Distribution of radionuclides in an iron calibration standard for a free release measurement facility}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {96-100}, keywords = {246 kg reference standard, free release measurement facility, Distribution of radionuclides, iron calibration}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804315302396}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.11.010}, stag_bib_extends_levelofaccess = {NA}, author = {Kov{\'a}ř, P. and Šur{\'a}ň, J. and Lutter, G. and Tzika, F. and Marissens, G. and Stroh, H. and Hult, M. and Skala, L. and Sud, J.} } @Article { CapogniKDSI2016, title = {A novel method for the activity measurement of large-area beta reference sources}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, pages = {358-362}, keywords = {Method of measurement, Large area reference sources, Numerical model}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.12.030}, stag_bib_extends_levelofaccess = {NA}, author = {Capogni, M. and Keightley, J. and De Felice, P. and Stanga, D. and Ioan, M.R.} } @Article { , title = {Primary current-sensing noise thermometry in the millikelvin regime}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {2}, day = {22}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150054}, keywords = {noise, thermometry, PLTS-2000, SQUID, primary, uncertainty}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150054}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society Publishing}, address = {London}, language = {30}, ISSN = {1471-2962}, DOI = {10.1098/rsta.2015.0054}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-22}, author = {Shibahara, A and Hahtela, O and Engert, J and van der Vliet, H and Levitin, L V and Casey, A and Lusher, C P and Saunders, J and Drung, D and Schurig, Th} } @Article { , title = {Dissemination of thermodynamic temperature above the freezing point of silver}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {2}, day = {22}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150043}, keywords = {high-temperature fixed points, thermodynamic temperature, filter radiometer, radiation thermometer}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150043}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0043}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sadli, M and Machin, G and Anhalt, K and Bourson, F and Biraudeau, S and del Campo, D and Diril, A and Kozlova, O and Lowe, D.H and Mantilla Amor, J.M and Martin, M.J and McEvoy, H.C and Ojanen-Saloranta, M and Pehlivan, {\"O} and Rougi{\'e}, B and Salim, S.G.R} } @Article { , title = {The kelvin redefinition and its mise en pratique}, journal = {Phiolosophical Transactions of the Royal Society A}, year = {2016}, month = {2}, day = {22}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150037}, keywords = {International System of Units, kelvin, mise en pratique, temperature, temperature scale, thermodynamic temperature}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150037}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1098/rsta.2015.0037}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Fellmuth, B and Fischer, J and Machin, G and Picard, S and Steur, P.P.M and Tamura, O and White, D.R and Yoon, H} } @Article { , title = {Sampling Depths, Depth Shifts and Depth Resolutions for Bin + Ion Analysis in Argon Gas Cluster Depth Profiles}, journal = {Journal of Physical Chemistry B}, year = {2016}, month = {2}, day = {17}, volume = {120}, number = {9}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {2604–2611}, web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b12697}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ACS}, address = {Washington DC}, language = {30}, DOI = {10.1021/acs.jpcb.5b12697}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-17}, author = {Havelund, R. and Seah, M.P. and Gilmore, I.S.} } @Article { SilvaPCCSC2016, title = {Alternative conducted emission measurements on mains without LISNs}, journal = {IEEE Electromagnetic Compatibility Magazine}, year = {2016}, month = {2}, day = {16}, volume = {4}, number = {4}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {58-65}, keywords = {Alternative, Current Probe, Conducted Emission, EMC, High Current, Industry, LISN, Mains Impedance}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7407180}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, language = {30}, ISSN = {2162-2264}, DOI = {10.1109/MEMC.2015.7407180}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, F. and Pous, M. and Cinar, M. and \c{C}akır, S. and Şen, O. and \c{C}etintaş, M.} } @Article { , title = {Traceable atomic force microscopy of high-quality solvent-free crystals of [6,6]-phenyl-C61-butyric acid methyl ester}, journal = {Appliced Physics Letters}, year = {2016}, month = {2}, day = {4}, volume = {108}, number = {(2016)}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {053303}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.4941227}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lazzerini, G.M. and Patern{\`o}, G.M. and Tregnago, G. and Treat, N. and Stingelin, N. and Yacoot, A. and Cacialli, F.} } @Article { , title = {Traceable quantitative Raman spectrometry and x-ray fluorescence analysis as non-destructive methods for spatially resolved chemical characterization of Cu(In,Ga)Se2 absorber films}, journal = {Applied Spectroscopy}, year = {2016}, month = {2}, volume = {70}, number = {2}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {279-288}, keywords = {Calibration, Cu(In; Ga)Se2, International System of Units, Measurement uncertainty, Raman mapping, Raman spectrometry, SI, Solar cell, Traceability, X-ray spectrometry}, web_url = {http://www.ncbi.nlm.nih.gov/pubmed/26903563}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {SAGE Publications }, language = {30}, ISSN = {0003-7028}, DOI = {10.1177/0003702815620131.}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-2-1}, author = {Zakel, SZ and Pollakowski, BP and Streeck, CS and Wundrack, SW and Weber, AW and Brunken, SB and Mainz, RM and Beckhoff, BB and Stosch, RS} } @Article { ShardCWC2016, subid = {318}, title = {A technique for calculation of shell thicknesses for core-shell-shell nanoparticles from XPS data}, journal = {Surface and Interface Analysis}, year = {2016}, month = {2}, volume = {48}, number = {5}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {274-282}, keywords = {XPS, nanoparticle, nanoparticles, core-shell-shell, core-shell, thickness, overlayer}, web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4829121/}, misc2 = {EMPIR 2014: Industry}, publisher = {Wiley-Blackwell}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.5923}, stag_bib_extends_levelofaccess = {NA}, author = {Cant, D.J.H. and Wang, Y.C. and Castner, D.G. and Shard, A.G.} } @Article { TammLSHP2016, title = {Single-Ion Atomic Clock with3\(\times\)10−18Systematic Uncertainty}, journal = {Physical Review Letters}, year = {2016}, month = {2}, volume = {116}, number = {6}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, keywords = {Atomic Clock}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.116.063001}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.116.063001}, stag_bib_extends_levelofaccess = {NA}, author = {Tamm, C. and Lipphardt, B. and Sanner, C. and Huntemann, N. and Peik, E.} } @Article { SawalNPGZRBTGSGACFEERBP2016, title = {An interlaboratory comparison on whole water samples}, journal = {Accreditation and Quality Assurance}, year = {2016}, month = {1}, day = {29}, volume = {21}, number = {2}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {121-129}, keywords = {Water Framework Directive, Interlaboratory comparison, Whole water sample, Suspended particulate matter, Polycyclic aromatic hydrocarbons, Polybrominated diphenyl ethers, Tributlyltin}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-1775, 1432-0517}, DOI = {10.1007/s00769-015-1190-8}, stag_bib_extends_levelofaccess = {NA}, author = {Sawal, G. and Nousiainen, M. and Pr{\"o}frock, D. and Gago, A.G. and Zuliani, T. and Rodr{\'i}guez-Cea, A. and Binici, B. and Tun\c{c}, M. and Gokcen, T. and Swart, C. and Gantois, F. and Alasonati, E. and Cabillic, J. and Fettig, I. and Emteborg, H. and Elordui-Zapatarietxe, S. and Richter, J. and Buzoianu, M. and Philipp, R.} } @Article { , title = {First measurements of nitrous oxide self-broadening and self-shift coefficients in the 0002-0000 band at 2.26 \(\mu\)m using high resolution Fourier transform spectroscopy}, journal = {Journal of Molecular Spectroscopy}, year = {2016}, month = {1}, day = {23}, volume = {323}, number = {Atmospheric Spectroscopy}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {28-42}, keywords = {Nitrous oxide, Fourier transform infrared spectroscopy, Line parameters; Self-broadening, Self-shift, Gas metrology}, web_url = {http://www.sciencedirect.com/science/article/pii/S002228521630011X}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier B. V.}, address = {Kidlington (Oxford)}, language = {30}, ISSN = {0022-2852}, DOI = {10.1016/j.jms.2016.01.010}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.sciencedirect.com/science/article/pii/S002228521630011X}, author = {Werwein, Viktor and Brunzendorf, Jens and Serdyukov, Anton and Werhahn, Olav and Ebert, Volker} } @Article { OzgurAHYaCCY2016, title = {Application of the differential Fabry–Perot interferometer in angle metrology}, journal = {Measurement Science and Technology}, year = {2016}, month = {1}, day = {20}, volume = {27}, number = {3}, number2 = {SIB58: Angles: Angle metrology}, pages = {035201}, keywords = {Angle metrology, Differential Fabry–Perot interferometry, small angle generators, autocollimators, Synchrotron and X-FEL optics}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/27/3/035201}, stag_bib_extends_levelofaccess = {NA}, author = {{\"O}zg{\"u}r, B. and Akg{\"o}z, A. and Hamid, R. and Yandayan, T. and Şahin, E. and \c{C}elik, M. and \c{C}etintaş, M. and Yandyan, T.} } @Article { , title = {A fiber-coupled quantum-dot on a photonic tip}, journal = {APPLIED PHYSICS LETTERS}, year = {2016}, month = {1}, day = {8}, volume = {108}, number = {1}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {011112-5}, keywords = {quantum-dot, fiber-coupling}, web_url = {http://scitation.aip.org/content/aip/journal/apl}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publishing LLC}, address = {Melville, NY}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4939264}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Cadeddu, D. and Teissier, J. and Braakman, F. and Gregersen, N. and Stepanov, P. and G{\'e}rard, J.M. and Claudon, J. and Warburton, R. J. and Poggio, M. and Munsch, M.} } @Article { , title = {Calibrated detectors for broad-band terahertz power measurements}, journal = {Laser+PHOTONICS}, year = {2016}, month = {1}, day = {1}, volume = {11}, number = {Trade Journal (international issue of the German magazine PHOTONIK)}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {2}, keywords = {Terahertz, THz power, THz detector}, web_url = {http://www.photonik.de/calibrated-detectors-for-broad-band-terahertz-power-measurements/150/21404/320987}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AT-Fachverlag GmbH}, address = {Fellbach}, language = {30}, ISSN = {1865-6633}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bohmeyer, W. and Lange, K. and M{\"u}ller, R. and Steiger, A.} } @Article { , title = {Molar fraction stability in dynamic preparation of reference trace gas mixtures}, journal = {IET Science, Measurement \& Technology}, year = {2016}, month = {1}, volume = {10}, number = {xx}, number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments}, pages = {Online 1-6}, keywords = {organic compounds; gas mixtures; measurement uncertainty; gas sensors}, web_url = {www.ietdl.org}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Institution of Engineering and Technology}, address = {London}, language = {30}, ISSN = {Print ISSN 1751-8822, Online ISSN 1751-8830}, DOI = {10.1049/iet-smt.2015.0051}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Demichelis, A and Sassi, G and Lecuna, M and Sassi, M} } @Article { , title = {Strain-rate and temperature dependent material properties of Agar and Gellan Gum used in biomedical applications}, journal = {Journal of the mechanical behavior of biomedical materials}, year = {2016}, month = {1}, volume = {53}, number = {January 2016}, number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials}, pages = {119-130}, keywords = {Hydrogels, Relaxation time, Strain-rate-dependence, Temperature-dependence, Young׳s modulus}, web_url = {http://www.sciencedirect.com/science/article/pii/S1751616115002829}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, language = {30}, ISSN = {1751-6161v}, DOI = {10.1016/j.jmbbm.2015.08.011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Schiavi, AS and Cuccaro, RC and Troia, AT} } @Article { WeigeltSRRMGGDY2016, title = {Microfocusing at the PG1 beamline at FLASH}, journal = {Journal of Synchrotron Radiation}, year = {2016}, month = {1}, volume = {23}, number = {1}, number2 = {SIB58: Angles: Angle metrology}, pages = {123-131}, keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {International Union of Crystallography (IUCr)}, language = {30}, ISSN = {1600-5775}, DOI = {10.1107/S1600577515023127}, stag_bib_extends_levelofaccess = {NA}, author = {Weigelt, H. and Siewert, F. and R{\"u}bhausen, M. and Reininger, R. and Mey, T. and Goderich, R. and Gerasimova, N. and Dziarzhytski, S. and Yandayan, T.} } @Techreport { TerauchiKSBWWADGAAHUWSJKKFSBSS2016, subid = {415}, title = {Final report of CCQM-K129 'Measurement of Mole Fractions of Cu, In, Ga and Se in Cu(In,Ga)Se2 Films}, journal = {Metrologia}, year = {2016}, month = {1}, volume = {53}, number = {1A}, number2 = {14SIP05: TF-STANDARD: Developing a Standard for Valid Methodology for the Characterisation of Functional Alloy Thin Films}, pages = {08011-08011}, keywords = {CIGS, Cu(In,Ga)Se2, mole fractions, key comparison CCQM-K129}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1A/08011\&\#10;https://www.bipm.org/utils/common/pdf/final_reports/QM/K129/CCQM-K129.pdf}, misc2 = {EMPIR 2014: Support for Impact}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/1A/08011}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, A.S. and Kim, K.J. and Jang, J.S. and Suh, J.K. and Wirth, T. and Unger, W. and Hodoroaba, V.D. and Araujo, J.R. and Archanjo, B.S. and Galhardo, C.E. and Damasceno, J. and Achete, C.A. and Wang, H. and Wang, M. and Bennett, J. and Simon, D. and Kurokawa, A. and Terauchi, S. and Fujimoto, T. and Streeck, C. and Beckhoff, B. and Spencer, S. and Shard, A.} } @Article { HammererSLLS2016, title = {Quantum Algorithmic Readout in Multi-Ion Clocks}, journal = {Physical Review Letters}, year = {2016}, month = {1}, volume = {116}, number = {1}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, keywords = {Multi-Ion Clocks}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.116.013002}, stag_bib_extends_levelofaccess = {NA}, author = {Hammerer, K. and Schmidt, P. O. and Leroux, I. D. and L{\"o}rch, N. and Schulte, M.} } @Proceedings { , title = {A Current Clamp based High Voltage Monitoring System}, journal = {2015 IEEE International Workshop on Applied Measurements for Power Systems}, year = {2016}, volume = {2015}, number = {na}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {13-18}, keywords = {current clamp, high voltage capacitor, analogue integrator, sampling system, asynchronous sampling}, web_url = {http://amps2015.ieee-ims.org/front}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Aachen, Germany}, event_name = {6rd IEEE International Workshop on Applied Measurements for Power Systems, AMPS 2015}, event_date = {September 2015}, language = {30}, ISBN = {978-1-4799-9997-2}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Mohns, E. and Fricke, S. and J{\"a}schke, C. and Schegner, P.} } @Article { , title = {Estimates of the difference between thermodynamic temperature and the ITS-90 in the range 118 K to 303 K}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {16}, keywords = {primary thermometry, acoustic gas thermometry, ITS-90}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society Publishing}, address = {London}, language = {30}, ISSN = {1364-503X}, DOI = {10.1098/rsta.2015.0048}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Underwood, R and de Podesta, M and Sutton, G and Stanger, L and Rusby, R and Harris, P and Morantz, P and Machin, G} } @Proceedings { , title = {The calibration of static and dynamic performances of PMUs}, journal = {Proceedings of the International Congress of Metrology}, year = {2016}, volume = {17}, number = {n/a}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {n/a}, keywords = {Phasor measurement units,}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_12002.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {EDP Sciences}, address = {London}, event_place = {Paris}, event_name = {17th International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1051/metrology/201512002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Braun, J. P. and Siegenthaler, S} } @Article { , title = {Experimental assessment of the speed of light perturbation in free-fall absolute gravimeters}, journal = {Metrologia}, year = {2016}, volume = {52}, number = {Oct}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {635–645}, keywords = {speed of light perturbation, absolute gravimeters, gravimetry, watt balance, SI}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/635}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institute of Physics}, address = {Bristol (UK)}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/52/5/635}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Baumann, H and Pythoud, F and Blas, D and Sibiryakov, S and Eichenberger, A and Klingel{\'e}, E E} } @Article { , title = {Depth Profiling and Melting of Nanoparticles in Secondary Ion Mass Spectrometry (SIMS)}, journal = {J. Phys. Chem. C}, year = {2016}, volume = {117}, number = {31}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {16042-16052}, keywords = {cluster ion beams, core-shell, melting, SEM, St{\"o}ber silica, SiO2}, web_url = {http://pubs.acs.org/doi/abs/10.1021/jp4048538}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {American chemical society}, address = {Washington DC}, language = {30}, ISSN = {1932-7447}, DOI = {10.1021/jp4048538}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-7-13}, author = {Yang, L and Seah, M and Gilmore, I .S and Morris, R.J.H and Dowsett, M.G and Boarino, L and Sparnacci, K and Laus, M} } @Proceedings { , title = {HIFU scattering by the ribs: constrained optimisation with a complex surface impedance boundary condition}, journal = {Journal of Physics Conference Series}, year = {2016}, volume = {498}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {36-46}, keywords = {HIFU, ribs, modelling}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/498/1/012004/pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Institute of Physics}, address = {London}, event_place = {Frejus, France}, event_name = {Anglo-French Physical Acoustics Conference}, event_date = {16-01-2013 - 18-01-2013}, language = {30}, ISSN = {1742-6588}, DOI = {10.1088/1742-6596/498/1/012004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gelat, P and ter Haar, G and Saffari, N} } @Article { , title = {Telling it like it is}, journal = {Journal of Therapeutic Ultrasound}, year = {2016}, volume = {1}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {4}, keywords = {ultrasound, dose, exposure, reporting}, web_url = {http://jtultrasound.biomedcentral.com/articles/10.1186/2050-5736-1-4}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {BioMed Central}, address = {London, UK}, language = {30}, ISSN = {2050-5736}, DOI = {10.1186/2050-5736-1-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaw, A and ter Haar, G} } @Article { , title = {Towards a dosimetric framework for therapeutic ultrasound}, journal = {International Journal of Hyperthermia}, year = {2016}, volume = {31}, number = {2}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {182-192}, keywords = {High intensity focused ultrasound, modelling, quality assurance, thermal ablation, ultrasound}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Taylor and Francis}, address = {Abingdon, UK}, language = {30}, ISSN = {0265-6736}, DOI = {10.3109/02656736.2014.997311}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaw, A and ter Haar, G and Haller, J and Wilkens, V} } @Article { , title = {Infrared mapping of ultrasound fields generated by medical transducers: Feasibility of determining absolute intensity levels.}, journal = {Journal of the Acousticla Society of America}, year = {2016}, volume = {134}, number = {2}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {1586–1597}, keywords = {ultrasound, infrared, intensity, thermal imaging, exposimetry}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Acoustical Society of America.}, address = {New York}, language = {30}, ISSN = {0001-4966}, DOI = {10.1121/1.4812878}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-3-1}, author = {Khokhlova, VA and Shmeleva, SM and Gavrilov, LR and Martin, E and Sadhoo, N and Shaw, A} } @Proceedings { , title = {Uncertainty Evaluation of an Alternative Conducted Emission Test Method}, journal = {Proceeding of the 7th Asia-Pacific International Symposium on Electromagnetic Compatibility \& Signal Integrity and Technical Exhibition (APEMC 2016)}, year = {2016}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {WE-PM-I-TC02-6}, keywords = {Alternative test method, ATM, conducted emission}, web_url = {http://ieeexplore.ieee.org/document/7522905/?arnumber=7522905\&tag=1}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {APEMC}, event_place = {Shenzhen, China}, event_name = {The 7th Asia-Pacific International Symposium on Electromagnetic Compatibility \& Signal Integrity and Technical Exhibition (APEMC 2016)}, event_date = {18-05-2016 to 21-05-2016}, language = {30}, ISBN = {978-1-4673-9494-9}, DOI = {10.1109/APEMC.2016.7522905}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Zhao, D. and Cakir, S. and Sen, O.} } @Proceedings { , title = {Diffusion vials for low and accurate release of key-voc in atmospheric chemistry and clean room industries}, journal = {XXI IMEKO World Congress “Measurement in Research and Industry” August 30 - September 4, 2015, Prague, Czech Republic}, year = {2016}, volume = {IMEKO World Congress 2015,}, number = {Unique}, number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments}, pages = {TC24-459.}, keywords = {Key-VOC, AMCs, reference gas mixtures, diffusion rate, uncertainty.}, web_url = {https://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC24-459.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IMEKO}, address = {Budapest}, event_place = {Prague}, event_name = {XXI IMEKO World Congress “Measurement in Research and Industry”}, event_date = {August 30 - September 4, 2015}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC24-459.pdf}, author = {Demichelis, A and Sassi, G and Sassi, M} } @Article { , title = {METROLOGICALLY TRACEABLE DETERMINATION OF THE WATER CONTENT IN BIOPOLYMERS: INRIM ACTIVITY}, journal = {International Journal of Thermophysics}, year = {2016}, volume = {-}, number = {Special Issue Tempmeko 2016}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {-}, keywords = {Water content, metrological traceability, coulometric Karl Fischer titration, Evolved Water Vapour analysis, biopolymers}, web_url = {-}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer}, address = {Berlin}, language = {30}, ISSN = {ISSN: 0195-928X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rolle, F. and Beltramino, G. and Fernicola, V. and Sega, M. and Verdoja, A.} } @Article { , title = {Decomposition of Electromagnetic Interferences in the Time-Domain}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2016}, volume = {58}, number = {2}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {385-392}, keywords = {Digital signal processing, electromagnetic compatibility, electromagnetic interference, electromagnetic measurements, time-domain analysis.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7390236\&isnumber=7429977}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9375}, DOI = {10.1109/TEMC.2016.2518302}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {15837187}, author = {Azp{\'u}rua, Marco A. and Pous, Marc and Silva, Ferran} } @Article { , title = {A new thoron atmosphere reference measurement system}, journal = {Applied Radiation and Isotopes}, year = {2016}, volume = {109}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {205-209}, keywords = {Thoron Rn-220 Rn-222 Radon Primary standard}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804315302773}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.apradiso.2015.11.055}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Sabot, B} } @Article { , title = {Annihilation of structural defects in chalcogenide absorber films for high-efficiency solar cells}, journal = {Energy \& Environmental Science}, year = {2016}, volume = {9}, number = {5}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1818-1827}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, XRD, XRF, in-situ, planar defects, TEM}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {1754-5692}, DOI = {10.1039/c6ee00402d}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-18}, author = {Mainz, R. and Simsek Sanli, E. and Stange, H. and Azulay, D. and Brunken, S. and Greiner, D. and Hajaj, S. and Heinemann, M. D. and Kaufmann, C. A. and Klaus, M. and Ramasse, Q. M. and Rodriguez-Alvarez, H. and Weber, A. and Balberg, I. and Millo, O. and van Aken, P. A. and Abou-Ras, D.} } @Article { , title = {Comparison of Active Levelling and Pre-Calibrating/Substitution Method for Radiated Immunity Testing of Large Equipment}, journal = {Proceedings of the 2016 International Symposium on EMC (EMC Europe) Wroclaw, Poland}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-6}, keywords = {radiated susceptibility tests, radiated immunity test, active levelling, pre-calibration, substitution, MIL-STD, AECTP, IEC 61000-4-3, Large Equipment}, web_url = {http://www.emceurope.org/2016/program.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Not yet available}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mandaris, D. and Cakir, S. and Sen, O. and Lorenzo, M.J. and Sanz, D.L. and Leferink, F.B.J.} } @Article { , title = {Time-Frequency Diversity for Solving the Deadlock in Defining Interference Levels in Power Lines}, journal = {Proceedings of the 2016 International Symposium on EMC (EMC Europe) Wroclaw, Poland}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-6}, keywords = {electromagnetic interference; power line telecommunication; narrow-band frequency; cyclic short-time}, web_url = {http://www.emceurope.org/2016/program.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Not yet available}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Setiawan, I. and Keyer, C.H. and Buesink, F.J.K. and Leferink, F.B.J.} } @Article { , title = {Drawbacks of a medium sized, grid coupled Photo Voltaic Array}, journal = {Proceedings of the 2016 International Conference on Renewable Energies and Power Quality (ICREPQ), Madrid, Spain, 2016}, year = {2016}, volume = {N.A.}, number = {14}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1-4}, keywords = {Photo voltaic array, apparent power, real power, reactive power fine.}, web_url = {http://www.icrepq.com/re\&pqj/RE\&PQJ\%2714-Index.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Renewable Energy \& Power Quality Journal (RE\&PQJ) European Association for the Development of Renewable Energies, Environment and Power Quality, Reg.No. 169208}, address = {Vigo, Spain}, language = {30}, ISSN = {2172-038X}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Keyer, C.H. and Setiawan, I. and Leferink, F.B.J. and Buesink, Frits} } @Article { , title = {Time-domain Measurement Technique to Analyze Cyclic Short-Time Interference in Power Supply Networks}, journal = {Proceedings of the 2016 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Shenzhen, China}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {279-282}, keywords = {electromagnetic compatibility; time-domain measurement; spectrogram; power mains noise and interference}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Unknown}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Setiawan, I. and Keyer, C.H. and Azpurua, M. and Silva, F. and Leferink, F.B.J.} } @Article { , title = {Equipment, measurement and dose—a survey for therapeutic ultrasound}, journal = {Journal of Therapeutic Ultrasound}, year = {2016}, volume = {4}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {7}, keywords = {Therapeutic ultrasound, Dosimetry, Exposimetry, Survey}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {BioMed Central}, address = {London}, language = {30}, ISSN = {2050-5736}, DOI = {10.1186/s40349-016-0051-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaw, A and Martin, E and Haller, J and ter Haar, G} } @Proceedings { , title = {Harmonics and Interharmonics Spectral Analysis by ANN}, journal = {Conference on Precision Electromagnetic Measurements Digest}, year = {2016}, number = {CPEM 2016}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, note = {The LEVEL OF ACCESS has changed in 06/09/2016 to: No, EURAMET is never allowed to make the publication publicly available''}, keywords = {Artificial Neural Networks, digital measurements, spectral analysis, frequency estimation, harmonics, interharmonics}, web_url = {http://ieeexplore.ieee.org/document/7540649/?arnumber=7540649}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE Transactions on Instrumentation and Measurement}, event_place = {Ottawa (Canad{\'a})}, event_name = {Conference on Precision Electromagnetic Measurements 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9133-7}, DOI = {10.1109/CPEM.2016.7540649}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Salinas, J. R. and Garc{\'i}a-Lagos, F. and Diaz de Aguilar, J. and Joya, G. and Lapuh, R. and Sandoval, F.} } @Proceedings { , title = {Series arrays of NbSi barrier Josephson junctions for AC voltage standards}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) - Conference Digest}, year = {2016}, volume = {n / a}, number = {n / a}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {7540562 (2 pp.)}, keywords = {AC Josephson voltage standards, binary-divided Josephson series arrays, NbSi barrier Josephson junctions, pulse-driven Josephson series arrays, SNS Josephson junctions}, web_url = {http://ieeexplore.ieee.org/document/7540562/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway, USA}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {Electronic ISSN: 2160-0171}, DOI = {10.1109/CPEM.2016.7540562}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7540562/}, author = {Kohlmann, J. and Kieler, O. and Scheller, T. and Egeling, B. and Wendisch, R. and Behr, R.} } @Article { , title = {Gamma camera calibration and validation for quantitative SPECT imaging with 177Lu}, journal = {Applied Radiation and Isotopes}, year = {2016}, volume = {112}, number = {Not Available}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {156-164}, keywords = {Quantitative imaging Molecular radiotherapy Gamma camera Calibration Radionuclide therapy}, web_url = {http://ac.els-cdn.com/S0969804316300902/1-s2.0-S0969804316300902-main.pdf?_tid=0dfc2a3c-6de4-11e6-8cf3-00000aab0f02\&acdnat=1472473873_beaec1e776a0c054de0ab95c6804d14c}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier Ltd}, address = {Netherlands, Amsterdam}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.03.007}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-6-30}, author = {D'Arienzo, Marco and Cazzato, Marta and Cozzella, Maria Letizia and Cox, Maurice and D'Andrea, Marco and Fazio, Aldo and Fenwick, Andrew and Iaccarino, Giuseppe and Johansson, Lena and Strigari, Lidia and Ungania, Sara and De Felice, Pierino} } @Article { , title = {Experimental determination of (p, \(\rho\), T) data for binary mixtures of methane and helium}, journal = {Journal of Chemical Thermodynamics}, year = {2016}, volume = {96}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {1–11}, keywords = {methane; helium; natural gas thermodynamic characterization; density; single-sinker densimeter; GERG-2008 equation of state}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0021-9614}, DOI = {10.1016/j.jct.2015.12.006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hern{\'a}ndez-G{\'o}mez, R. and Tuma, D. and Segovia, J.J. and Chamorro, C.R.} } @Article { , title = {Heat capacities and acoustic virial coefficients for a synthetic coal mine methane mixture by speed of sound measurements at T = (273.16 and 250.00) K.}, journal = {Journal of Chemical Thermodynamics}, year = {2016}, volume = {97}, number = {1}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {137-141}, keywords = {speed of sound; coal mine methane; spherical resonator; GERG-2008 equation of state.}, tags = {EnG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0021-9614}, DOI = {10.1016/j.jct.2016.01.020}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {P{\'e}rez-Sanz, F.J. and Mart{\'i}n, M.C. and Chamorro, C.R. and Fern{\'a}ndez-Vicente, T.E. and Segovia, J.J.} } @Proceedings { , title = {Moisture measurement setup for wood based materials and biomasses}, journal = {International Congress of Metrology 08008 (2015)}, year = {2016}, volume = {International Congress of Metrology 08008 (2015)}, number = {International Congress of Metrology 08008 (2015)}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {4}, keywords = {moisture, biomass, loss-on-drying, SI traceability}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08008.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {17th International Congress of Metrology, 08008 (2015)}, event_date = {21-09-2015 to 24-09-2015}, language = {30}, DOI = {10.1051/metrology/20150008008}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ojanen-Saloranta, M. and Sairanen, H. and Salminen, J. and Kajastie, H. and Heinonen, M.} } @Proceedings { , title = {New Approach for Measuring Moisture in Solids Using Radio Frequency and Microwave}, journal = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances}, year = {2016}, volume = {11th}, number = {2016}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {297}, keywords = {dielectric permittivity, capacitive cell, coaxial cell, moisture measurement}, web_url = {http://www.isema2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Edifir-Edizioni}, address = {Firenze}, event_place = {Firenze (Italy)}, event_name = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances}, event_date = {23-05-2016 to 27-05-2016}, language = {30}, ISBN = {978-88-7970-800-5}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ben Ayoub, MW and Georgin, E and Rochas, J F and Hubert, S and Achard, P and Neves, L and Sabouroux, P} } @Inbook { , title = {Review of the Methods for Thermal Conductivity Measurements Most Appropriate for Thermoelectric Materials}, year = {2016}, volume = {--}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {109-132}, keywords = {Thermoelectric, solar cells, thermal conductivity}, web_url = {http://pubs.rsc.org/en/content/ebook/978-1-78262-323-6\#!divbookcontent}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Royal Society of Chemistry}, address = {London}, booktitle = {Thermoelectric Materials and Devices (Energy and Environment Series)}, language = {30}, ISBN = {978-1-78262-323-6(print) 978-1-78262-404-2(pdf)}, DOI = {10.1039/9781782624042-00109}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://pubs.rsc.org/en/content/chapter/bk9781782623236-00109/978-1-78262-323-6\#!divabstract}, author = {SELEZNEVA, E and Stacey, C and DIAZ-CHAO, P and MUNIZ-PINIELLA, A and Cuenat, A} } @Article { , title = {The role of acoustic nonlinearity in tissue heating behind a rib cage using a high-intensity focused ultrasound phased array}, journal = {PHYSICS IN MEDICINE AND BIOLOGY}, year = {2016}, volume = {58}, number = {2013}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {2537–2559}, keywords = {HIFU, ultrasound surgery, ribs, nonlinear propagation, focusing, diffraction, shock heating}, web_url = {http://iopscience.iop.org/article/10.1088/0031-9155/58/8/2537/pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP PUBLISHING}, address = {Bristol, Tokyo, Philadelphia, Beijing}, language = {30}, ISSN = {1088/0031}, DOI = {10.1088/0031-9155/58/8/2537}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yuldashev, P V and Shmeleva, S M and Ilyin, S A and Sapozhnikov, O A and Gavrilov, L R and Khokhlova, V A} } @Article { , title = {Design and Optimisation of the Nozzle of an Innovative High Temperature Solid Particulate Erosion Testing System using Finite Element Modelling}, year = {2016}, number2 = {IND61: Metrosion: Metrology to enable high temperature erosion testing}, pages = {1-11}, web_url = {http://www.sciencedirect.com/science/article/pii/S009630031630755X}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {30}, DOI = {10.1016/j.amc.2016.12.021}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Smith, NS and Fry, ATF and Crocker, LEC and Cernuschi, FC and Lorenzoni, LL} } @Proceedings { , title = {Tests on waveform synthesis in a new cryocooler setup}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, volume = {10.1109/CPEM.2016.7540563}, number = {10.1109/CPEM.2016.7540563}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {voltage measurement, coaxial cables, cooling, cryogenics, Josephson effect, measurement standards}, web_url = {http://ieeexplore.ieee.org/abstract/document/7540563/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa}, event_name = {CPEM16}, event_date = {10-15 July 2016}, language = {30}, ISBN = {978-1-4673-9134-4, 978-1-4673-9135-1, 978-1-4673-9132-0}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540563}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SOSSO, A and Trinchera, B and Durandetto, P and Monticone, E and Kieler, O and Behr, R and Kohlmann, J} } @Article { , title = {Characterization of a Josephson array for pulse-driven voltage standard in a cryocooler}, journal = {Measurement}, year = {2016}, volume = {95}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {77–81}, keywords = {Josephson effect; Quantum voltage standard; Quantum waveform synthesis; Measurement techniques; Measurement uncertainty; Precision measurements; Uncertainty}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116305425}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {Amsterdam, The Netherlands}, language = {30}, ISSN = {http://dx.doi.org/10.1016/j.measurement.2016.09.039}, DOI = {10.1016/j.measurement.2016.09.039}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {SOSSO, A and Durandetto, P and Trinchera, B and Kieler, O and Behr, R and Kohlmann, J} } @Proceedings { , title = {Numerical method for calculation of transfer matrix for non typical adapters used for calibration of EMC devices}, journal = {ERK 2015}, year = {2016}, volume = {Volume A}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {273-276}, keywords = {EMC, adapter, LISN}, web_url = {http://www.ieee.si/erk/erk15.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {24th International Electrotechnical and Computer Science Conference ERK 2015}, address = {Portorož}, event_place = {Portorož}, event_name = {24th International Electrotechnical and Computer Science Conference ERK 2015}, event_date = {21-9-2015 to 23-9-2015}, language = {110}, ISSN = {1581-4572}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kokalj, M. and Voljč, B. and Pinter, B. and Lindič, M. and Svetik, Z. and Kokalj, Miha} } @Proceedings { , title = {The frequency dependence of a 10 nF gas-dielectric capacitor}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, year = {2016}, volume = {.}, number = {.}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {1-2}, keywords = {Capacitors, Frequency dependence, Standards, Impedance, Uncertainty, Bridge circuits, Capacitance}, web_url = {http://ieeexplore.ieee.org/document/7540476/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {.}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {10-15 July 2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {978-1-4673-9134-4}, DOI = {10.1109/CPEM.2016.7540476}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Callegaro, L and Sellone, M} } @Proceedings { , title = {Investigation of the Influence of Temperature Inhomogeneity on the Measurement Uncertainty of Solar Cell Temperature Coefficients}, journal = {Proceedings of the 32nd European PV Solar Energy Conference and Exhibition ( 32nd EU PVSEC)}, year = {2016}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {2200 - 2203}, keywords = {calibration, characterization, spectral responsivity}, web_url = {http://www.eupvsec-proceedings.com/proceedings?paper=39495}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Munich, Germany}, event_name = {32nd European Photovoltaic Solar Energy Conference and Exhibition}, event_date = {20-24 June 2016}, language = {30}, ISBN = {3-936338-41-8}, DOI = {10.4229/EUPVSEC20162016-5BV.4.10}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Schweitzer, A. and Kroeger, I. and Winter, S.} } @Proceedings { , title = {Comparison of the frequency dependence of capacitance ratios between LNE and PTB}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, keywords = {Impedance bridge, Josephson array, Josephson impedance bridge}, web_url = {http://ieeexplore.ieee.org/document/7540585/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540585}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Hagen, T and Th{\'e}venot, O and S{\'e}ron, O and Khan, S and Palafox, L and Behr, R} } @Proceedings { , title = {Implementation of an impedance bridge based on pulse-driven Josephson arrays for arbitrary impedance ratios and phase angles}, journal = {Confernce digest Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, volume = {1}, number = {1}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, keywords = {Bridge circuits, Impedance, Impedance measurement, Frequency measurement, Temperature measurement, Resistors, Standards}, web_url = {http://ieeexplore.ieee.org/document/7540626/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {July 10-15}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540626}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Bauer, S and Behr, R and Hagen, T and Kieler, O and Palafox, L and Schurr, J} } @Article { , title = {Development of a programmable small capacitance standard at LNE}, journal = {Conference on Precision Electromagnetic Measurements Digest 2016}, year = {2016}, volume = {2016}, number = {2016}, number2 = {SIB53: AIM QuTE: Automated impedance metrology extending the quantum toolbox for electricity}, pages = {388-389}, keywords = {Capacitance measurements, multiplexer, small capacitance standard, capacitance bridge}, web_url = {https://www.eiseverywhere.com/retrieveupload.php?c3VibWlzc2lvbl8xMjc4NzJfNzkxODg4LnBkZiplc2VsZWN0}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {CPEM}, address = {Ottawa}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540611}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {KHAN, Mohammad Saif khan and Seron, Olivier Seron and Thuillier, Ga{\"e}l Thuillier and Th{\'e}venot, Olivier Th{\'e}venot} } @Article { , title = {Metrological challenges for measurements of key climatological observables: oceanic salinity and pH, and atmospheric humidity. Part 1: overview}, journal = {Metrologia}, year = {2016}, volume = {53}, number = {1}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {R1-R11}, keywords = {seawater salinity, seawater pH, relative humidity, traceability}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1/R1}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Physics}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/1/R1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Feistel, R and Wielgosz, R and Bell, S A and Cam{\~o}es, M F and Cooper, J R and Dexter, P and Dickson, A G and Fisicaro, P and Harvey, A H and Heinonen, M and Hellmuth, O and Kretzschmar, H-J and Lovell-Smith, J W and McDougall, T J and Pawlowicz, R and Ridout, P and Seitz, S and Spitzer, P and Stoica, D and Wolf, H} } @Article { , title = {Calibrated CAD model of freeform standard}, journal = {21st IMEKO World Congress 2015 Measurement in Research and Industry}, year = {2016}, volume = {1}, number = {-}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {1429-1434}, keywords = {Coordinate measurement, freeform standard, CAD model, calibrated CAD model, B-spline}, web_url = {http://www.proceedings.com/27913.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Curran Associates, Inc.}, address = {Budapest}, language = {30}, ISSN = {978-1-5108-1292-5}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.proceedings.com/27913.html}, author = {Linkeov{\'a}, I and Skaln{\'i}k, P and Zelen{\'y}, V} } @Proceedings { LiEBWSW2016, title = {EUMETRISPEC: A Versatile, Metrological, High-resolution Fouriertransform-spectrometer- Infrastructure to Determine Accurate Spectral Data}, journal = {Imaging and Applied Optics 2016}, year = {2016}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {LM3G.1}, keywords = {infrared spectroscopy, Fourier transform spectroscopy, high-Resolution spectroscopy, spectral line data, gas metrology}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW Washington, DC 20036-1023, USA}, event_place = {Heidelberg}, event_name = {Laser Applications to Chemical, Security and Environmental Analysis 2016}, event_date = {25-07-2016 to 28-07-2016}, language = {30}, DOI = {10.1364/LACSEA.2016.LM3G.1}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Gang and Ebert, Volker and Brunzendorf, Jens and Werhahn, Olav and Serdyukov, Anton and Werwein, Viktor} } @Article { WerweinBESLW2016, title = {Nitrous oxide line positions in the 0002-0000 band at 2.26 µm as test case for high-resolution FTIR-spectrometer stability}, journal = {Imaging and Applied Optics 2016}, year = {2016}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {JT3A.14}, keywords = {infrared spectroscopy, Fourier transform spectroscopy, nitrous oxide, line position}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023, United States}, language = {30}, DOI = {10.1364/3D.2016.JT3A.14}, stag_bib_extends_levelofaccess = {NA}, author = {Werwein, Viktor and Brunzendorf, Jens and Ebert, Volker and Serdyukov, Anton and Li, Gang and Werhahn, Olav} } @Article { SilvaSSSMK2016, title = {Surface and interface structure of quasi-free standing graphene on SiC}, journal = {2D Materials}, year = {2016}, volume = {3}, number = {2}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {025023}, keywords = {intercalated graphene, Kelvin probe force microscopy, x-ray photoelectron spectroscopy, surface enhanced Raman scattering, Raman spectroscopy}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP science}, address = {Bristol, United Kingdom}, language = {30}, DOI = {10.1088/2053-1583/3/2/025023}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, S R P and Strupinski, W and Shard, A and Spencer, S and Melios, C and Kazakova, O} } @Article { PetricevicSMT2016, subid = {315}, title = {Development of a single-sided guarded hot plate apparatus for thermal conductivity measurements}, journal = {Thermal Science}, year = {2016}, volume = {20}, number = {suppl. 1}, number2 = {14RPT05: Eura-Thermal: Developing traceable capabilities in thermal metrology}, pages = {321-329}, keywords = {thermal conductivity, ceramics, polymers, rubbers, glasses, biological materials, guarded hot plate method}, web_url = {http://www.doiserbia.nb.rs/img/doi/0354-9836/2016/0354-98361500226T.pdf}, misc2 = {EMPIR 2014: Research Potential}, publisher = {National Library of Serbia}, language = {30}, ISSN = {0354-9836, 2334-7163}, DOI = {10.2298/TSCI151009226T}, stag_bib_extends_levelofaccess = {NA}, author = {Terzic, M. and Milosevic, N. and Stepanic, N. and Petricevic, S.} } @Thesis { Sand2016, title = {Alpha Radiation Detection via Radioluminescence of Air}, year = {2016}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Alpha radiation detection, nuclear safety, nuclear decommissioning, radioluminescence emission, light yield.}, web_url = {https://tutcris.tut.fi/portal/en/publications/alpha-radiation-detection-via-radioluminescence-of-air(65a22d41-6a29-4c36-9d4f-67a018eec833).html}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Tampere University of Technology}, school = {Tampere University of Technology}, language = {30}, ISBN = {978-952-15-3889-6}, ISSN = {978-952-15-3889-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://urn.fi/URN:ISBN:978-952-15-3889-6}, author = {Sand, J.} } @Article { RappDGSLODDB2015, title = {Using a dose-area product for absolute measurements in small fields: a feasibility study}, journal = {Physics in Medicine and Biology}, year = {2015}, month = {12}, day = {22}, volume = {61}, number = {2}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {650-662}, keywords = {small fields, dosimetric reference, dose-area product, absolute dosimetry}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/61/2/650}, stag_bib_extends_levelofaccess = {NA}, author = {Rapp, B and Delaunay, F and Gouriou, J and Sommier, L and Le Roy, M and Ostrowsky, A and Dufreneix, S and Daures, J and Bordy, J-M} } @Article { NichollsWSG2015, title = {Direct observations of erosion-induced ferroelasticity in EB-PVD thermal barrier coatings}, journal = {Journal of Materials Science}, year = {2015}, month = {12}, day = {17}, volume = {51}, number = {6}, number2 = {IND61: Metrosion: Metrology to enable high temperature erosion testing}, pages = {3136-3145}, keywords = {Direct observations of erosion-induced ferroelasticity in EB-PVD thermal barrier coatings}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0022-2461, 1573-4803}, DOI = {10.1007/s10853-015-9623-7}, stag_bib_extends_levelofaccess = {NA}, author = {Nicholls, John and Wellman, Richard and Schubert, Amanda B. and Gentleman, Molly M.} } @Article { , title = {Traceable methods for vertical scale characterization of dynamic stroboscopic scanning white-light interferometer measurements}, journal = {Applied Optics}, year = {2015}, month = {12}, day = {9}, volume = {54}, number = {35}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {10397-10403}, keywords = {Stroboscopic scanning white-light interferometry (SSWLI),3D imaging of oscillating samples,Traceability of the vertical displacement measurement, metrology, uncertainties}, web_url = {https://www.osapublishing.org/ao/abstract.cfm?uri=ao-54-35-10397}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {OSA Publishing}, address = {Washington, D.C.}, language = {30}, ISSN = {n/a}, DOI = {10.1364/AO.54.010397}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-9}, author = {Heikkinen, V and Kassmakov, I and Sepp{\"a}, J and Paulin, T and Nolvi, A and Lassila, A and H{\ae}ggstr{\"o}m, E} } @Article { , title = {How to efficiently characterize special effect coatings}, journal = {Journal of the Optical Society of America A}, year = {2015}, month = {12}, day = {3}, volume = {33}, number = {1}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1-8}, keywords = {Metrology, BSDF, BRDF, BTDF, Color measurement, Color vision, and Colorimetry}, web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-33-1-1}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Optical Society of America}, address = {Washington, D.C.}, language = {30}, ISSN = {1084-7529}, DOI = {10.1364/JOSAA.33.000001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Strothk{\"a}mper, C. and Hauer, K.-O. and H{\"o}pe, A.} } @Article { , title = {An IQ-Steering Technique for Amplitude and Phase Control of mm-Wave Signals}, journal = {Microwave Measurement Conference (ARFTG), 2014 86th ARFTG}, year = {2015}, month = {12}, day = {3}, volume = {IEEE Catalog Number: CFP15ARG-USB}, number = {December}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {69-72}, keywords = {calibration;millimetre wave measurement;phase control;IQ-steering technique;amplitude predistortion technique;amplitude-phase control;calibration;direct IQ up-conversion;frequency 30 GHz to 40 GHz;frequency multiplication;multipath mm-wave signals;signal amplification;wafer probe-tip level;Calibration;Hardware;Minimization;Mixers;Phase measurement;Phase modulation;IQ modulation;calibration;mm-wave;phase coherent}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7381471\&queryText=spirito\%20m\&refinements=4291944822\&ranges=2015_2015_Year}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, language = {30}, ISSN = {978-1-4673-9246-4}, DOI = {10.1109/ARFTG.2015.7381471}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Visweswaran, A. and de Martino, C. and Sirignano, E. and Spirito, M.} } @Article { , title = {Self-supporting graphene films and their applications}, journal = {IET Circuits, Devices \& Systems}, year = {2015}, month = {12}, day = {3}, volume = {9}, number = {6}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {420 - 427}, keywords = {thermal properties, atomic force microscopy, chemical vapour deposition, copper, foils, graphene, mechanical properties, micromechanical resonators, monolayers, scanning electron microscopy}, web_url = {http://ieeexplore.ieee.org/document/7339736/}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York CIty}, language = {30}, ISSN = {1751-858X}, DOI = {10.1049/iet-cds.2015.0149}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-3}, author = {Goniszewski, S and Gallop, J and Adabi, M and Gajewski, K and Shaforost, E and Klein, N and Sierakowski, A and Chen, J and Gotszalk, T and Chen, Y and Hao, L} } @Article { , title = {Temperature drift compensation in Fourier-transform integrated micro-spectrometers}, journal = {Optica Pura y Aplicada}, year = {2015}, month = {12}, day = {1}, volume = {48}, number = {4}, number2 = {14IND13: PhotInd: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {283-289}, keywords = {integrated optics, spectroscopy, Fourier transform, Silicon on insulator, temperature drift, spectral retrieval.}, web_url = {-}, misc2 = {EMPIR 2014: Industry}, publisher = {SEDOPTICA}, address = {MADRID}, language = {112}, ISSN = {-}, DOI = {10.7149/OPA.48.4.283}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Velasco, A. V. and Galindo-Santos, J. and Cheben, P. and Calvo, M. L and Schmid, J. and Delage, A. and Xu, D.-X. and Janz, S. and Corredera, P.} } @Article { , title = {On the Statistical Properties of the Peak Detection for Time-Domain EMI Measurements}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2015}, month = {12}, volume = {57}, number = {6}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1374-1381}, keywords = {Electromagnetic compatibility, electromagnetic interference (EMI), electromagnetic measurements, statistical signal processing, time-domain analysis.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7169567\&isnumber=7353235}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9375}, DOI = {10.1109/TEMC.2015.2456983}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {15677166}, author = {Azp{\'u}rua, Marco A. and Pous, Marc and Silva, Ferran} } @Article { , title = {Measurement and Evaluation Techniques to Estimate the Degradation Produced by the Radiated Transients Interference to the GSM System}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2015}, month = {12}, volume = {57}, number = {6}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1382-1390}, keywords = {Amplitude probability distribution (APD), electromagnetic transients interferences, GSM, impulsive noise, timedomain measurements.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7247681\&isnumber=7353235}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9375}, DOI = {10.1109/TEMC.2015.2472983}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {15677194}, author = {Pous, Marc and Azp{\'u}rua, Marco A. and Silva, Ferran} } @Article { , title = {Accurate Experimental Field Mapping in the Close Vicinity of a Pyramidal Absorber Using the Monostatic Optically Modulated Scatterer Technique}, journal = {IEEE Transactions on electromagnetic compatibility}, year = {2015}, month = {12}, volume = {57}, number = {6}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1391 - 1397}, keywords = {Electromagnetic field mapping, modulated scatterer technique (MST), numerical validation, pyramidal absorber, optically modulated scatterer (OMS), optically modulated scatterer technique.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7155550}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {0018-9375}, DOI = {10.1109/TEMC.2015.2449354}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Vogt-Ardatjew, R.A. and Sowa, A.E.} } @Article { , title = {Piezoelectric materials for high temperature transducers and actuators}, journal = {Journal of Materials Science: Materials in Electronics}, year = {2015}, month = {12}, volume = {26}, number = {12}, number2 = {NEW09: METCO: Metrology of electro-thermal coupling for new functional materials technology}, pages = {9256-9267}, web_url = {http://link.springer.com/article/10.1007/s10854-015-3629-4}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer US}, language = {30}, ISSN = {0957-4522}, DOI = {10.1007/s10854-015-3629-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stevenson, TS and Martin, DM and Cowin, PC and Blumfield, AB and Bell, AB and Comyn, TC and Weaver, PMW} } @Article { SterrHDAL2015, title = {Noise and instability of an optical lattice clock}, journal = {Physical Review A}, year = {2015}, month = {12}, volume = {92}, number = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {063814}, keywords = {time and frequency metrology, optical lattice clock, ultra-stable laser, stability}, web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.92.063814}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {1050-2947, 1094-1622}, DOI = {10.1103/PhysRevA.92.063814}, stag_bib_extends_levelofaccess = {NA}, author = {Sterr, U. and H{\"a}fner, S. and D{\"o}rscher, S. and Al-Masoudi, A. and Lisdat, C.} } @Article { KralikBAVSS2015, title = {Measurement of secondary neutrons generated during proton therapy}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {12}, volume = {172}, number = {4}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {341-345}, keywords = {Secondary neutrons, proton therapy, Bonner Sphere Spectrometer}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv504}, stag_bib_extends_levelofaccess = {NA}, author = {Kr{\'a}l{\'i}k, M. and B{\'a}rtov{\'a}, H. and Andrl{\'i}k, M. and Vykydal, Z. and Solc, J. and Solc, J.} } @Article { , title = {Ion beam analysis of Cu(In,Ga)Se2 thin film solar cells}, journal = {Applied Surface Science}, year = {2015}, month = {11}, day = {30}, volume = {356}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {631–638}, keywords = {Thin solar Cu(In,Ga)Se2 cells, Ion beam analysis, RBS/PIXE techniques, Synchrotron GIXRF analysis, Depth profiling}, web_url = {http://ac.els-cdn.com/S0169433215019467/1-s2.0-S0169433215019467-main.pdf?_tid=cba9d288-1c21-11e6-9bf0-00000aab0f26\&acdnat=1463484395_b9279df87868924a41b103cfe0aeacf7}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, ISSN = {0169-4332}, DOI = {10.1016/j.apsusc.2015.08.133}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Karydas, AGK and Streeck, CS and Bogdanovic Radovic, IBR and Kaufmann, CK and Rissom, TR and Beckhoff, BB and Jakšic, MJ and Barradas, NPB} } @Article { SmerziSHAEPLKLPK2015, title = {Satisfying the Einstein–Podolsky–Rosen criterion with massive particles}, journal = {Nature Communications}, year = {2015}, month = {11}, day = {27}, volume = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {8984}, keywords = {quantum mechanics, entanglement, heisenberg limit}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms9984}, stag_bib_extends_levelofaccess = {NA}, author = {Smerzi, A. and Santos, L. and Hammerer, K. and Arlt, J. and Ertmer, W. and Pezz{\`e}, L. and L{\"u}cke, B. and Kruse, I. and Lange, K. and Peise, J. and Klempt, C.} } @Proceedings { SperlingPTRPJBR2015, title = {Multiple Transfer Standard for characterisation of sphere test setups}, journal = {Proceedings of the CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, year = {2015}, month = {11}, day = {26}, volume = {1}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {1-5}, keywords = {LED standard, multiple standard, characterisation sphere setup}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Commission Internationale de L'Eclairage}, address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A, 1010 Vienna, Austria}, event_place = {Braunschweig, Germany}, event_name = {CIE Tutorial and Expert Symposium on the CIE S 025 LED Lamps, LED Luminaires and LED Modules Test Standard}, event_date = {26-11-2015 to 26-11-2015}, language = {30}, ISBN = {978-3-902842-28-2}, stag_bib_extends_levelofaccess = {NA}, author = {Sperling, A. and Penda, S. and Taddeo, M. and Revtova, E. and Poikonen, T. and Jordan, W. and Blattner, P. and Renoux, D.} } @Article { , title = {A clock network for geodesy and fundamental science}, journal = {Nature Communication}, year = {2015}, month = {11}, day = {24}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, web_url = {arxiv.org/abs/1511.07735}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and D{\"o}rscher, S. and H{\"a}fner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G.} } @Article { SzmyrkaGrzebykKG2015, title = {The basics of calibration procedure and estimation of uncertainty budget for meteorological temperature sensors}, journal = {Meteorological Applications}, year = {2015}, month = {11}, day = {24}, volume = {22}, number = {S1}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {867-872}, keywords = {calibration; uncertainty budget; temperature sensor}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Wiley}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1527}, stag_bib_extends_levelofaccess = {NA}, author = {Szmyrka-Grzebyk, A. and Kowal, A. and Grykałowska, A.} } @Article { , title = {Thermoelectric properties of currently available Au/Pt thermocouples related to the valid reference function}, journal = {Int. J. Metrol. Qual. Eng.}, year = {2015}, month = {11}, day = {23}, volume = {6}, number = {3}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {303}, keywords = {Au/Pt thermocouple, reference function, temperature scale}, web_url = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Dr. A. CHARKI}, address = {EDP Sciences - France 17, Avenue du Hoggar Parc d'Activit{\'e} de Courtabœuf BP 112 91944 Les Ulis Cedex A France}, language = {30}, DOI = {10.1051/ijmqe/2015016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, author = {Edler, F. and Arifovic, N. and Atance, G. and Dinu, C. and Elliott, C. J. and Izquierdo, C. G. and Hodzic, N. and Kalisz, S. and Pearce, J.V. and Simic, S. and Strnad, R. and Taubert, D.} } @Article { HogstromLSH2015, title = {Comsol Simulations as a Tool in Validating a Measurement Chamber}, journal = {International Journal of Thermophysics}, year = {2015}, month = {11}, day = {23}, volume = {36}, number = {12}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {3474-3486}, keywords = {Adsorption, Fluid flow, Mass transfer, Numerical simulation, Radiosonde}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-015-2000-6}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}gstr{\"o}m, R. and Lakka, A. and Sairanen, H. and Heinonen, M.} } @Article { , title = {ELSTAB - fiber optic time and frequency distribution technology - a general characterization and fundamental limits}, journal = {IEEE Transactions on Ultrasonics, Ferroelectrics, and Frequency Control}, year = {2015}, month = {11}, day = {20}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, keywords = {fiber optics; time transfer; frequency transfer; delay stabilization}, misc2 = {EMRP A169: Call 2009 Energy}, language = {30}, DOI = {10.1109/TUFFC.2015.2502547}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Krehlik, P. and Śliwczyński, L. and Buczek, L. and Kolodziej, J. and Lipiński, M.} } @Article { SourgenCBDJSH2015, title = {Submillimetre thermistors for balloon-borne applications up to lower stratosphere: preliminary characterization with 0.02 K uncertainty}, journal = {Meteorological Applications}, year = {2015}, month = {11}, day = {18}, volume = {22}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {836-841}, keywords = {calibration; thermistors; uncertainty; stratosphere; metrological characterization}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Wiley}, language = {30}, ISSN = {1350-4827}, DOI = {10.1002/met.1504}, stag_bib_extends_levelofaccess = {NA}, author = {Sourgen, D. and Coeur-Joly, G. and Bordereau, J. and Deuz{\'e}, T. and Jouin, D. and Sparasci, F. and Hertzog, A.} } @Article { , title = {Analysis of thermal radiation in ion traps for optical frequency standards}, journal = {Metrologia}, year = {2015}, month = {11}, day = {12}, volume = {52}, number = {6}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {842-856}, keywords = {blackbody radiation shift, ion traps, optical atomic clocks, ion clocks, thermal and high frequency finite element method modelling}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/6/842}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, BIPM}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/52/6/842}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Doležal, M and Balling, P and Nisbet-Jones, P B R and King, S A and Jones, J M and Klein, H A and Gill, P and Lindvall, T and Wallin, A E and Merimaa, M and Tamm, C and Sanner, C and Huntemann, N and Scharnhorst, N and Leroux, I D and Schmidt, P O and Burgermeister, T and Mehlst{\"a}ubler, T E and Peik, E} } @Article { , title = {Kalibrierte THz-Detektoren zur breitbandigen Leistungsmessung}, journal = {Photonik}, year = {2015}, month = {11}, day = {10}, volume = {47}, number = {6.2015}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {2}, keywords = {THz-Detektor, Kalibration, wellenl{\"a}ngenunabh{\"a}ngige Absorption}, web_url = {http://www.photonik.de/kalibrierte-thz-detektoren-zur-breitbandigen-leistungensmessung/150/21002/317549}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AT-Fachverlag GmbH}, address = {D-70736 Fellbach}, language = {43}, ISSN = {1432-9778}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bohmeyer, W. and Lange, K. and M{\"u}ller, R. and Steiger, A.} } @Techreport { , title = {Global Geodetic Observing System (GGOS) Requirements for Core Sites}, journal = {CDDIS: NASA's Archive of Space Geodesy Data}, year = {2015}, month = {11}, day = {1}, volume = {Revision 2}, number = {Draft 3.4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {GNSS, SLR, DORIS, VLBI, global network}, web_url = {http://cddis.gsfc.nasa.gov/docs/2015/SiteRecDoc_Rev2_D3.4.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {NASA Goddard Space Flight Center}, address = {Greenbelt}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Appleby, G. and Behrend, D. and Bergstrand, S. and Donovan, H. and Emerson, C. and Esper, J. and Hase, H. and Long, J. and Ma, C. and McCormick, D. and Noll, C. and Pavlis, E. and Ferrage, P. and Pearlman, M. and Saunier, J. and Stowers, D. and Wetzel, S.} } @Article { , title = {Numerical prediction of the influence of uncertain inflow conditions in pipes by polynomial chaos}, journal = {International Journal of Computational Fluid Dynamics}, year = {2015}, month = {11}, day = {1}, volume = {29}, number = {6}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {1-12}, keywords = {non-intrusive generalized polynomial chaos, uncertainty quanti cation, computational uid dynamics (CFD), pipe ow, disturbed in ow pro le}, tags = {MAT}, web_url = {https://www.researchgate.net/publication/285383826_Numerical_prediction_of_the_influence_of_uncertain_inflow_conditions_in_pipes_by_polynomial_chaos}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Taylor \& Francis}, address = {Abingdon}, language = {30}, ISSN = {-}, DOI = {10.1080/10618562.2015.1112899}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schmelter, S and Fiebach, A and Model, R and B{\"a}r, M} } @Techreport { , title = {Guideline for the preparation of fixed nano-objects on hard surfaces, like nanoparticles and nanowires}, year = {2015}, month = {11}, number = {2015}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, keywords = {Nano-particles, nano-objects, nano-rods}, web_url = {http://www.ptb.de/emrp/2618.html}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Fiala, P. and Stintz, M.} } @Techreport { , title = {Introductory guide to measuring the mechanical properties of nanoobjects/particles with AFM on flat surfaces}, year = {2015}, month = {11}, number = {2015}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, keywords = {AFM cantilever calibration, f-d curve, mechanical stiffness}, web_url = {http://www.ptb.de/emrp/2618.html}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sepp{\"a}, J.} } @Article { , title = {Impact of improved calibration of a NEO HySpex VNIR-1600 sensor on remote sensing of water depth.}, journal = {IEEE Transactions on Geoscience and Remote Sensing}, year = {2015}, month = {11}, volume = {53}, number = {11}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {6085-6098}, keywords = {Bathymetry, calibration, hyperspectral, imaging spectrometer, nonlinearity, remote sensing, stray light.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7115112\&isnumber=7185497}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {IEEE}, language = {30}, ISSN = {0196-2892}, DOI = {10.1109/TGRS.2015.2431743}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lenhard, KL and Baumgartner, AB and Gege, PG and Nevas, SN and Nowy, SN and Sperling, AS} } @Article { , title = {Measuring dynamic pressure by laser Doppler vibrometry}, journal = {PTB-Mitteilungen}, year = {2015}, month = {11}, volume = {125}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {38-42}, keywords = {dynamic measurement, dynamic pressure calibration, primary calibration, laser interferometry, Clausius-ossotti elation, index of refraction, density change}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, language = {30}, ISSN = {ISSN 0030-834X}, DOI = {10.7795/310.20150206}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bruns, T. and Slanina, O.} } @Article { , title = {Dynamic measurements as an emerging field in industrial metrology}, journal = {PTB-Mitteilungen}, year = {2015}, month = {11}, volume = {125}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {62-67}, keywords = {dynamic measurement, dynamic torque, dynamic force, dynamic calibration, industrial needs}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Physikalisch-Technische Bundesanstalt}, address = {Braunschweig}, language = {30}, ISSN = {0030-834X}, DOI = {10.7795/310.20150209}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sch{\"a}fer, A.} } @Proceedings { , title = {TRUTHS Cross-calibration Uncertainty Tool}, journal = {IEEE Geoscience and Remote Sensing Symposium (IGARSS), 2015.}, year = {2015}, month = {11}, volume = {2015}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {2135-2138}, keywords = {Cross-calibration, Libya-4, radiometric uncertainty, TRUTHS}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7326225}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IEEE}, event_place = {Milan, Italy}, event_name = {IEEE Geoscience and Remote Sensing Symposium (IGARSS), 2015.}, event_date = {26-07-2015 to 31-07-2015}, language = {30}, ISBN = {978-1-4799-7929-5}, ISSN = {2153-7003}, DOI = {10.1109/IGARSS.2015.7326225}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Gorro{\~n}o, JG and Fox, NPF and Bialek, AB and Green, PDG and Scanlon, TS} } @Article { LiGWSE2015, title = {FTIR-based measurements of self-broadening and self-shift coefficients as well as line strength in the first overtone band of HCl at 1.76µM}, journal = {Journal of Quantitative Spectroscopy and Radiative Transfer}, year = {2015}, month = {11}, volume = {165}, number2 = {ENV06: EUMETRISPEC: Spectral Reference Data for Atmospheric Monitoring}, pages = {76-87}, keywords = {HCl, Self-induced broadening, Self-induced shift, Line intensity, First overtone band (2-0)}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, address = {New York, USA}, language = {30}, ISSN = {0022-4073}, DOI = {10.1016/j.jqsrt.2015.06.021}, stag_bib_extends_levelofaccess = {NA}, author = {Li, Gang and Gisi, Michael and Werhahn, Olav and Serdyukov, Anton and Ebert, Volker} } @Article { OliveroGSGMEDBBAMTF2015, subid = {563}, title = {Electrical stimulation of non-classical photon emission from diamond color centers by means of sub-superficial graphitic electrodes}, journal = {Scientific Reports}, year = {2015}, month = {10}, day = {29}, volume = {5}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {15901}, keywords = {Single Photon Sources, NV centers}, web_url = {https://www.nature.com/articles/srep15901}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep15901}, stag_bib_extends_levelofaccess = {NA}, author = {Forneris, J. and Traina, P. and Monticone, D.G. and Amato, G. and Boarino, L. and Brida, G. and Degiovanni, I.P. and Enrico, E. and Moreva, E. and Grilj, V. and Skukan, N. and Jakšić, M. and Genovese, M. and Olivero, P.} } @Article { , title = {One-step large-scale deposition of salt-free DNA origami nanostructures}, journal = {Scientific Reports}, year = {2015}, month = {10}, day = {23}, volume = {5}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {15634}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Nature Publishing Group}, language = {30}, DOI = {10.1038/srep15634}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Linko, V. and Shen, B. and Tapio, K. and Toppari, J. and Kostianen, M and Tuukkanen, S.} } @Article { , title = {Effect of Na presence during CuInSe2 growth on stacking fault annihilation and electronic properties}, journal = {Applied Physics Letters}, year = {2015}, month = {10}, day = {14}, volume = {107}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {152103}, keywords = {Stacking faults, Cu(In,Ga)Se2, thin films, solar cells, XRD, GIXRD, GDOES, grain growth, optical pump terahertz probe spectroscopy}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {AIP Publishing LLC}, address = {College Park}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4933305}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Stange, H. and Brunken, S. and Hempel, H. and Rodriguez-Alvarez, H. and Sch{\"a}fer, N. and Greiner, D. and Scheu, A. and Lauche, J. and Kaufmann, C. A. and Unold, T. and Abou-Ras, D. and Mainz, R.} } @Article { , title = {Sudden stress relaxation in compound semiconductor thin films triggered by secondary phase segregation}, journal = {Physical Review B}, year = {2015}, month = {10}, day = {12}, volume = {92}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {155310}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, stress relaxation, recrystallization, grain growth, in-situ, XRD, XRF}, web_url2 = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.155310}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {American Physical Society}, address = {College Park}, language = {30}, ISSN = {2469-9969}, DOI = {10.1103/PhysRevB.92.155310}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Mainz, R. and Rodriguez-Alvarez, H. and Klaus, M. and Thomas, D. and Lauche, J. and Weber, A. and Heinemann, M. D. and Brunken, S. and Greiner, D. and Kaufmann, C. A. and Unold, T. and Schock, H.-W. and Genzel, C.} } @Article { , title = {ToF-SIMS analysis of a polymer microarray composed of poly(meth)acrylates with C6 derivative pendant groups}, journal = {Surface and interface Analysis}, year = {2015}, month = {10}, day = {11}, volume = {48}, number = {4}, number2 = {IND56: Q-AIMDS: Chemical metrology tools for manufacture of advanced biomaterials in the medical device industry}, pages = {19th January 2016}, keywords = {surface analysis; polymer microarray; multivariate analysis; high-throughput surface characterisation}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5959/pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Wiley}, address = {Hoboken}, language = {30}, ISSN = {0142-2421}, DOI = {10.1002/sia.5959}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Hook, A.L and Scurr, D.J} } @Article { , title = {The European project on high temperature measurement solutions in industry (HiTeMS) – A summary of achievements}, journal = {Measurement}, year = {2015}, month = {10}, day = {9}, volume = {78}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {168-179}, keywords = {High temperature measurement High temperature fixed points (HTFPs) Industrial process control Radiation thermometry Thermocouples Reference functions}, web_url = {http://www.sciencedirect.com/science/article/pii/S026322411500500X}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2015.09.033}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Machiin, G and Anhalt, K and Battuello, M and Bourson, F and Dekker, P and Diril, A and Edler, F and Elliott, C.J. and Girard, F and Greenen, A and Knazovick{\'a}, L and Lowe, D and Pavlasek, P and Pearce, J.V. and Sadli, M and Strnad, R and Seifert, M and Vuelban, E.M.} } @Article { , title = {Domain wall magneto-Seebeck effect}, journal = {Physical Review B}, year = {2015}, month = {10}, day = {6}, volume = {92}, number = {14}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {140405}, keywords = {Spincaloritronics, magnetic domain wall, spin-Seebeck}, web_url = {http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.140405}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {New York}, language = {30}, ISSN = {1098-0121}, DOI = {10.1103/PhysRevB.92.140405}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Krzysteczko, P. and Hu, X. and Liebing, N. and Sievers, S. and Schumacher, H. W.} } @Article { , title = {Thickness and Microdomain Orientation of Asymmetric PS‑b‑PMMA Block Copolymer Films Inside Periodic Gratings}, journal = {Applied Materials and Interfaces}, year = {2015}, month = {10}, day = {6}, volume = {7}, number = {42}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {23615-23622}, keywords = {PS-b-PMMA, self-assembly, trench, thin film, rapid thermal annealing, graphoepitaxy}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {ACS Publications}, address = {Washington}, language = {30}, DOI = {10.1021/acsami.5b07127}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lupi, F. and Aprile, G. and Giammaria, T. and Seguini, G. and Zuccheri, G. and De Leo, N. and Boarino, L. and Perego, M.} } @Article { , title = {Highly directive and Gaussian far-field emission from “giant” photonic trumpets}, journal = {APPLIED PHYSICS LETTERS}, year = {2015}, month = {10}, day = {6}, volume = {107}, number = {14}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {141106-4}, keywords = {photonic antennas; photonic wire; quantum dot}, web_url = {http://scitation.aip.org/content/aip/journal/apl}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publishing}, address = {Melville, NY}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4932574}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stepanov, P. and Delga, A. and Gregersen, N. and Peinke, E. and Munsch, M. and Teissier, J. and M{\o}rk, J. and Richard, M. and Bleuse, J. and G{\'e}rard, J.M. and Claudon, J.} } @Article { , title = {Parity measurement of remote qubits using dispersive coupling and photodetection}, journal = {Physical Review A}, year = {2015}, month = {10}, day = {5}, volume = {92}, number = {4}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {042305}, keywords = {parity measurement, remote qubits, photodetection, dispersive coupling}, web_url = {http://journals.aps.org/pra/abstract/10.1103/PhysRevA.92.042305}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park}, language = {30}, ISSN = {2469-9934}, DOI = {10.1103/PhysRevA.92.042305}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Govenius, J. and Matsuzaki, Y. and Savenko, I. G. and M{\"o}tt{\"o}nen, M.} } @Article { , title = {Simultaneous dynamic electrical and structural measurements of functional materials}, journal = {Review of Scientific Instruments}, year = {2015}, month = {10}, day = {5}, volume = {83}, number2 = {IND54: Nanostrain: Novel electronic devices based on control of strain at the nanoscale}, pages = {103901}, keywords = {Piezoelectric fields, Interferometers, Ferroelectric materials, Polarization, Diffractometers}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/86/10/10.1063/1.4931992}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {0034-6748}, DOI = {10.1063/1.4931992}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vecchini, CV and Thompson, PT and Stewart, MS and Muniz-Piniella, AMP and McMitchell, SRCM and Wooldridge, JW and Lepadatu, SL and Bouchenoire, LB and Brown, SB and Wermeille, DW and Bikondoa, OB and Lucas, CAL and Hase, TH and Lesourd, ML and Dontsov, DD and Cain, MGC} } @Inbook { , title = {Determination Of Numerical Uncertainty Associated With Numerical Artefacts For Validating Coordinate Metrology Software}, year = {2015}, month = {10}, day = {1}, volume = {86}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {273-278}, keywords = {Uncertainty, numerical error, geometric element}, tags = {MAT}, web_url = {http://www.npl.co.uk/content/ConPublication/6703}, web_url2 = {http://www.worldscientific.com/worldscibooks/10.1142/9610}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {World Scientific Publishing Company}, address = {London}, booktitle = {Advanced Mathematical and Computational Tools in Metrology and Testing X}, language = {30}, ISBN = {9789814678612}, DOI = {10.1142/9789814678629_0033}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Minh, H D and Smith, I M and Forbes, A B} } @Article { , title = {Measuring the Thickness of Flakes of Hexagonal Boron Nitride Using the Change in Zero-Contrast Wavelength of Optical Contrast}, journal = {Measuring the Thickness of Flakes of Hexagonal Boron Nitride Using the Change in Zero-Contrast Wavelength of Optical Contrast}, year = {2015}, month = {10}, volume = {19}, number = {5}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {503-507}, keywords = {Thickness, Optical contrast, h-BN, Microscope, Optical inspection, Surface measurements, Thin films, figure, optical properties}, web_url = {http://www.osapublishing.org/abstract.cfm?uri=josk-19-5-503}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Journal of the Optical Society of Korea}, language = {30}, DOI = {10.3807/JOSK.2015.19.5.503}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dong Hyun, Kim and Sung-Jo, Kim and Jeong-Seon, Yu and Jong-Hyun, Kim} } @Proceedings { , title = {Metrology for MRI Safety}, year = {2015}, month = {9}, day = {21}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://cfmetrologie.edpsciences.org}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {EDP Sciences}, address = {Les Ulis}, event_place = {Paris, France}, event_name = {17th International Congress of Metrology}, event_date = {September 21-24, 2015}, language = {30}, DOI = {10.1051/metrology/20150009001}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ittermann, B and Bottauscio, O and Hand, J and de Pooter, J and de Prez, L and Rabus, H and Seifert, F and Szymanowski, H and Weidemann, G and Zilberti, L} } @Article { , title = {A European project to enhance process efficiency through improved temperature measurement: EMPRESS}, journal = {17 International Congress of Metrology, 0 00 (20 5 )}, year = {2015}, month = {9}, day = {21}, volume = {17}, number = {17}, number2 = {14IND04: EMPRESS: Enhancing process efficiency through improved temperature measurement}, pages = {08001}, keywords = {efficiency, temperature measurement}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08001.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {International Congress of Metrology}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150008001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pearce, J V and Edler, F and Elliott, C J and Rosso, L and Sutton, G and Zante, R and Machin, G} } @Article { , title = {METefnet: developments in metrology for moisture in materials}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15003}, keywords = {Development - Moisture in materials}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bell, S and Aro, A and Arpino, F and Aytekin, S and Cortellessa, G and Dell’Isola, M and Ferenč{\'i}kov{\'a}, Z and Fernicola, V and Gavioso, R and Georgin, E and Heinonen, M and Hudoklin, D and Jalukse, L and Karab{\"o}ce, N and Leito, I and M{\"a}kynen, A and Miao, P and Nielsen, J and Nicolescu, I and Rudolfov{\'a}, M and Ojanen-Saloranta, M and {\"O}sterberg, P and {\O}stergaard, P and Rujan, M and Sega, M and Strnad, R and Vachova, T} } @Proceedings { , title = {Experimental assessment of methods of dissemination of the thermodynamic temperature at the highest temperatures}, journal = {International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17}, number = {15001}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1-5}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15001/metrology_metr2015_15001.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {EDP Sciences}, address = {London/Parc d'Activit{\'e} de Courtabœuf}, event_place = {Paris}, event_name = {17th International Congress of Metrology}, event_date = {September 2015}, language = {30}, DOI = {10.1051/metrology/201515001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sadli, M and Anhalt, K and Bourson, F and Briaudeau, S and del Campo, D and Diril, A and Lowe, D and Machin, G and Manuel Mantilla Amor, J and Martin, M.J and McEvoy, H and Ojanen, M and Pehlivan, O and Rougie, B and Salim, S.G.R} } @Article { , title = {Dynamic properties during wood humidification}, journal = {17 th International Congress of Metrology, 14009 (2015 )}, year = {2015}, month = {9}, day = {21}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {humiditiy, wood samples, humidification wood}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_14009.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, address = {Paris}, language = {30}, DOI = {10.1051/metrology/20150014009}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rudolfov{\'a}, M.R. and Pitrov{\'a} Netolick{\'a}, L.P. N. and Ferenč{\'i}kov{\'a}, Z. F. and V{\'a}chov{\'a}, T. V. and Strnad, R. S.} } @Article { , title = {First steps in development of a new transfer standard, for moisture measurement, based on radio-frequency wave and micro-wave.}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15008}, keywords = {Moisture, high frequencies, micro-waves, metrology, transfer standard.}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15008/metrology_metr2015_15008.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Georgin, E and Rochas, JF and Achard, P and Hubert, S and Ben Ayoub, MW and Sabouroux, P} } @Article { , title = {Characterization of surface topography of a newly developed metrological gloss scale}, journal = {Surface Topography: Metrology and Properties}, year = {2015}, month = {9}, day = {15}, volume = {3}, number = {4}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {045001}, keywords = {Gloss, roughness, PSD}, web_url = {http://iopscience.iop.org/article/10.1088/2051-672X/3/4/045001}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {2051-672X}, DOI = {10.1088/2051-672X/3/4/045001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-15}, author = {Flys, O and K{\"a}llberg, S and Ged, G and Silvestri, Z and Ros{\'e}n, B-G} } @Proceedings { , title = {Design, stability analysis and uncertainty contribution of a voltage divider designed for a phase meter}, year = {2015}, month = {9}, day = {15}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, keywords = {ADC, phase, uncertainty, Monte Carlo}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Benevento, Italy}, event_name = {20 th IMEKO TC4 International Symposium “Research on Electrical and Electronic Measurement for the Economic Upturn” and 18th IMEKO TC-4 International Workshop on ADC and DAC Modelling and Testing}, event_date = {15-09-2014 to 17-09-2014}, language = {30}, ISBN = {978-92-990073-2-7}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.imeko.org/publications/tc4-2014/IMEKO-TC4-2014-192.pdf}, author = {Š{\'i}ra, MŠ and Mašl{\'a}ň, SM and Nov{\'a}kov{\'a} Zachovalov{\'a}, VNZ} } @Article { , title = {Comprehensive Comparison of Various Techniques for the Analysis of Elemental Distributions in Thin Films: Additional Techniques}, journal = {Microscopy and Microanalysis}, year = {2015}, month = {9}, day = {14}, volume = {21}, number = {6}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1644-1648}, keywords = {elemental distributions, thin films, laser-induced breakdown spectroscopy, grazing-incidence X-ray fluorescence analysis, comparison}, web_url = {http://journals.cambridge.org/action/displayAbstract?fromPage=online\&aid=10063275\&fulltextType=RA\&fileId=S1431927615015093}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Cambridge University Press (CUP)}, language = {30}, ISSN = {1431-9276}, DOI = {10.1017/S1431927615015093}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Abou-Ras, DAR and Caballero, RC and Streeck, CS and Beckhoff, BB and In, JHI and Jeong, SJ} } @Article { , title = {Molecular-Scale Remnants of the Liquid-Gas Transition in Supercritical Polar Fluids}, journal = {Physical Review Letters}, year = {2015}, month = {9}, day = {11}, volume = {115}, number = {11}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {117801}, web_url = {https://www.researchgate.net/publication/280773225_Molecular-Scale_Remnants_of_the_Liquid-Gas_Transition_in_Supercritical_Polar_Fluids}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {American Physical Society}, address = {Maryland}, DOI = {10.1103/PhysRevLett.115.117801}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Sokhan, V. P. and Jones, A. and Cipcigan, F. S. and Crain, J. and Martyna, G. J.} } @Proceedings { , title = {Scatterometric characterization of diffractive optical elements}, journal = {Proceedings of SPIE}, year = {2015}, month = {9}, day = {10}, volume = {9173}, number = {-}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, pages = {91730I}, keywords = {scatterometry, diffractive optical elements}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1901269}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {SPIE}, address = {Bellingham}, event_place = {San Diego}, event_name = {SPIE Optics+Photonics 2014}, event_date = {17-21 August, 2014}, language = {30}, ISBN = {9781628412000}, ISSN = {0277-786X}, DOI = {10.1117/12.2061699}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Saastamoinen, Toni and Husu, Hannu and Laukkanen, Janne and Siitonen, Samuli and Turunen, Jari and Lassila, Antti} } @Article { , title = {Optical injection locking based amplification in phase coherent transfer of optical frequencies}, journal = {Optics Letters}, year = {2015}, month = {9}, day = {3}, volume = {40}, number = {18}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {4198-4201}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/OL.40.004198}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kim, J. and Schnatz, H. and Wu, D. S. and Marra, G. and Richardson, D.J. and Slav{\'i}k, R.} } @Article { , title = {Tunnel-Junction Thermometry Down to Millikelvin Temperatures}, journal = {APS Physics}, year = {2015}, month = {9}, day = {3}, volume = {4}, number = {034001}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1-9}, keywords = {Tunnel-Junction Thermometry Down to Millikelvin Temperatures}, web_url = {http://journals.aps.org/prapplied/abstract/10.1103/PhysRevApplied.4.034001}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {APS Physics}, address = {New York}, language = {30}, ISSN = {NA}, DOI = {10.1103/PhysRevApplied.4.034001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Feshchenko, A V and Casparis, L and Khaymovich, I M and Marandan, D and Saira, O-P and Palma, M and Meschke, M and Pekola, J P and Zumbuhl, D M} } @Article { , title = {Methodology of Designing an Occluded Ear Simulator}, journal = {ACTA ACUSTICA UNITED WITH ACUSTICA}, year = {2015}, month = {9}, day = {1}, volume = {101 (2015)}, number = {5}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {1007 – 1015}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {S. Hirzel Verlag}, address = {Stuttgart}, language = {30}, DOI = {10.3813/AAA.918895}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rodrigues, D and Lavergne, T and Sandermann Olsen, E and Fedtke, T and Barham, R and Durocher, J.-N.} } @Proceedings { , title = {Moisture determination for food quality assessment}, journal = {Proceedings of CIM 2015 - 17th International Congress of Metrology}, year = {2015}, month = {9}, volume = {-}, number = {-}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {-}, keywords = {Moisture, Food, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis}, web_url = {www.metrologie2015.com}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {Paris}, event_place = {Paris}, event_name = {CIM 2015 - 17th International Congress of Metrology}, event_date = {21-24 September 2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/20150015006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rolle, F. and Beltramino, G. and Fernicola, V. and Sega, M. and Verdoja, A.} } @Proceedings { , title = {Metrological traceability for moisture content analysis in wood pellets}, journal = {Proceedings of CIM 2015 - 17th International Congress of Metrology}, year = {2015}, month = {9}, volume = {-}, number = {-}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {-}, keywords = {Moisture, Metrological Traceability, Wood Pellets, Coulometric Karl-Fischer titration, Evolved Water Vapour analysis}, web_url = {www.metrologie2015.com}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {Paris}, event_place = {Paris}, event_name = {CIM 2015 - 17th International Congress of Metrology}, event_date = {21-24 September 2015}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/20150008002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sega, M. and Beltramino, G. and Fernicola, V. and Rolle, F. and Verdoja, A.} } @Article { ViefhausNSRHAHPYY2015, title = {A new compact soft x-ray spectrometer for resonant inelastic x-ray scattering studies at PETRA III}, journal = {Review of Scientific Instruments}, year = {2015}, month = {9}, volume = {86}, number = {9}, number2 = {SIB58: Angles: Angle metrology}, pages = {093109}, keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4930968}, stag_bib_extends_levelofaccess = {NA}, author = {Viefhaus, J. and Nordgren, J. and Siewert, F. and Reininger, R. and Hage, A. and Ag{\aa}ker, M. and Hahn, U. and Peters, H. B. and Yin, Z. and Yandayan, Tanfer} } @Article { ManaSMM2015, title = {A More Accurate Measurement of the28Si Lattice Parameter}, journal = {Journal of Physical and Chemical Reference Data}, year = {2015}, month = {9}, volume = {44}, number = {3}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {031208}, keywords = {Error analysis, Optical interferometers,Temperature measurement, Laser beams. Lattice constants. X-ray diffraction. X-ray interferometry. interferometers, Electric measurements}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0047-2689, 1529-7845}, DOI = {10.1063/1.4917488}, stag_bib_extends_levelofaccess = {NA}, author = {Mana, G. and Sasso, C. P. and Massa, E. and Mana, Giovanni} } @Proceedings { , title = {Numerical prediction of the flow rate through a flow meter with uncertain inflow profile}, journal = {XXI IMEKO World Congress ”Measurement in Research and Industry”}, year = {2015}, month = {8}, day = {30}, volume = {-}, number = {2015}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {CFD, non-intrusive gPC, uncertainty quantification, flow measurement, disturbed inflow profile}, tags = {MAT}, web_url = {https://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC21-389.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Czech Technical University in Prague}, address = {Prague}, event_place = {Prague}, event_name = {XXI IMEKO World Congress ”Measurement in Research and Industry”}, event_date = {30-08-2015 to 04-09-2015}, language = {30}, ISBN = {-}, ISSN = {-}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Weissenbrunner, A and Fiebach, A and Schmelter, S and Straka, M and B{\"a}r, M and Lederer, T} } @Proceedings { , title = {Emission Measurement of a Full Body mm Wave Scanner}, year = {2015}, month = {8}, day = {26}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, keywords = {THz, mm-wave, Full Body Scanner, Emission Measurements}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Hong Kong}, event_name = {40th International Conference on Infrared, Millimeter and Terahertz Waves (IRMMW-THz 2015)}, event_date = {2015-08-23 until 2015-08-28}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kleine-Ostmann, T. and Schrader, T.} } @Article { , title = {Validation of a calibration set-up for radiosondes to fulfil GRUAN requirements}, journal = {Measurement Science and Technology}, year = {2015}, month = {8}, day = {26}, volume = {26}, number = {10}, number2 = {ENV58: MeteoMet2: Metrology for essential climate variables}, pages = {105901}, keywords = {Radiosonde, calibration, GRUAN, humidity, traceability, uncertainty}, web_url = {http://iopscience.iop.org/article/10.1088/0957-0233/26/10/105901}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing Ltd}, address = {UK}, language = {30}, ISSN = {0957-0233/15/105901}, DOI = {10.1088/0957-0233/26/10/105901}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-26}, author = {Sairanen, H. and Heinonen, M. and H{\"o}gstr{\"o}m, R.} } @Article { , title = {Depth resolution at organic interfaces sputtered by argon gas cluster ions: the effect of energy, angle and cluster size}, journal = {Analyst}, year = {2015}, month = {8}, day = {25}, volume = {140}, number = {19}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {6508-6516}, web_url = {http://pubs.rsc.org/en/content/articlelanding/2015/an/c5an01473e\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {0003-2654}, DOI = {10.1039/C5AN01473E}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-25}, author = {Seah, M.P. and Spencer, S.J. and Havelund, R. and Gilmore, I.S. and Shard, A.G.} } @Article { KimNHLAHLHMLHJBCPYKSPPHK2015, title = {A Facile Route for Patterned Growth of Metal–Insulator Carbon Lateral Junction through One-Pot Synthesis}, journal = {ACS Nano}, year = {2015}, month = {8}, day = {25}, volume = {9}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {8352-8360}, keywords = {amorphous carbon, bottom-up growth, graphene, graphene growth from polymer, graphene-based heterostructure}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Chemical Society (ACS)}, address = {Washington, USA}, language = {30}, ISSN = {1936-0851, 1936-086X}, DOI = {10.1021/acsnano.5b03037}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, Kwang S. and Novoselov, Konstantin S. and Hwang, Chanyong and Lee, Zonghoon and Ahn, Jong-Hyun and Han, Sang Woo and Lee, Tae Geol and Hyun, Seung and Mishchenko, Artem and Lee, Seoung-Ki and Huh, Sung and Jeon, Gumhye and Byun, Jinseok and Chae, Dong-Hun and Park, Hyo Ju and Yu, Seong Uk and Kim, Yong-Jin and Son, Jin Gyeong and Park, Jaesung and Park, Beomjin and Hong, Byung Hee and Kim, Jin Kon} } @Article { , title = {MEMS-based voltage detector}, journal = {Sensors and Actuators A: Physical}, year = {2015}, month = {8}, day = {24}, volume = {234}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {99-103}, keywords = {Capacitive sensors; MEMS; Readout; Pull-in; Noise; Voltage measurement}, web_url = {https://www.researchgate.net/publication/282373168_MEMS-based_voltage_detector}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {n/a}, DOI = {10.1016/j.sna.2015.08.011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-8-17}, author = {Helist{\"o}, P and Sepp{\"a}, H and Manninen, A} } @Proceedings { , title = {Alternative conducted immunity testing with multiple CDNs and wire winding}, journal = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, year = {2015}, month = {8}, day = {22}, volume = {2015}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1260 - 1265}, keywords = {Alternative, Current Probe, CDN, Conducted Immunity, EMC, High Current, Industry, Mains Impedance}, web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=7256351\&tag=1}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Dresden}, event_name = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, event_date = {16-08-2015 to 22-08-2015}, language = {30}, ISBN = {-}, ISSN = {2158-110X}, DOI = {10.1109/ISEMC.2015.7256351}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {\c{C}akır, Soydan and Şen, Osman and ACAK, Savaş and \c{C}etintaş, Mustafa} } @Proceedings { CetintasACS2015, title = {Alternative conducted emission measurements with LISN simulation \& CISPR 16 Voltage Probe}, journal = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, year = {2015}, month = {8}, day = {22}, volume = {2015}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1243-1247}, keywords = {Alternative; Voltage; Probe; Conducted Emission; EMC; Industry; In-Situ; LISN; Mains Impedance; On-Site}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, event_place = {Dresden}, event_name = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, event_date = {16-08-2015 to 22-08-2015}, language = {30}, DOI = {10.1109/ISEMC.2015.7256348}, stag_bib_extends_levelofaccess = {NA}, author = {\c{C}etintaş, M. and Acak, S. and \c{C}akır, S. and Şen, O.} } @Article { , title = {Assessment of a dual-channel array spectrometer for ground-based ozone retrievals}, journal = {Journal of Atmospheric and Oceanic Technology}, year = {2015}, month = {8}, day = {20}, volume = {32}, number = {August 2015}, number2 = {ENV03: solarUV: Traceability for surface spectral solar ultraviolet radiation}, pages = {1464-1477}, keywords = {Ozone, UV, array spectrometer}, web_url = {http://journals.ametsoc.org/doi/pdf/10.1175/JTECH-D-14-00200.1}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {American Meteorological Society}, address = {Boston}, language = {30}, ISSN = {0739-0572}, DOI = {10.1175/JTECH-D-14-00200.1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Smedley, Andrew R.D. and Kift, Richard C. and Webb, Ann R.} } @Article { , title = {A determination of the molar gas constant R by acoustic thermometry in helium}, journal = {Metrologia}, year = {2015}, month = {8}, day = {19}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S274-S304}, keywords = {molar gas constant, Boltzmann constant, acoustic gas thermometry, acoustic resonators, kelvin, speed of sound, helium}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S274/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing - Bureau International des Poids et Mesures}, address = {London}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/52/5/S274}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-19}, author = {Gavioso, R M and Madonna Ripa, D and Steur, P P M and Gaiser, C and Truong, D and Guianvarc'h, C and Tarizzo, P and Stuart, F M and Dematteis, R} } @Article { , title = {Measurement of pressures up to 7 MPa applying pressure balances for dielectric-constant gas thermometry}, journal = {Metrologia}, year = {2015}, month = {8}, day = {19}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S305-S313}, keywords = {Gas pressure balance, effective area, pressure distortion coefficient, dielectric-constant gas thermometry, Boltzmann constant}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S305/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/0026-1394/52/5/S305}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Zandt, T and Sabuga, W and Gaiser, C and Fellmuth, B} } @Article { , title = {Determination of the Boltzmann constant k from the speed of sound in helium gas at the triple point of water}, journal = {Metrologia}, year = {2015}, month = {8}, day = {19}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S263–S273}, keywords = {Acoustic resonance, Boltzmann constant, Definition of the kelvin, Microwave resonance, Quasi-sphere, Speed of sound, Triaxial ellipsoid}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S263/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/0026-1394/52/5/S263}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pitre, L and Risegari, L and Sparasci, F and Plimmer, M D and Himbert, M E and Giuliano Albo, P A} } @Article { , title = {Improving Time-Domain EMI Measurements Through Digital Signal Processing}, journal = {IEEE Electromagnetic Compatibility Magazine}, year = {2015}, month = {8}, day = {17}, volume = {4}, number = {Quarter 2}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {82-91}, keywords = {Digital Signal Processing, Electromagnetic compatibility, Electromagnetic interference, Electromagnetic measurements, Time-domain analysis.}, web_url = {http://ieeexplore.ieee.org/document/7204056/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {-}, language = {30}, ISSN = {2162-2272}, DOI = {10.1109/MEMC.2015.7204056}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {2162-2264}, author = {Azp{\'u}rua, Marco and Pous, Marc and \c{C}akir, Soydan and \c{C}ETİNTAŞ, Mustafa and Silva, Ferran} } @Article { , title = {Investigation of Verification Artifacts in WR-03 Waveguides}, journal = {Journal of Infrared, Millimeter, and Terahertz Waves}, year = {2015}, month = {8}, day = {15}, volume = {36}, number = {11}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1089-1100}, keywords = {Scattering parameters, Waveguide standards, Measurement uncertainty, Verification artifacts, Microwave measurements}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer}, address = {New York}, language = {30}, ISSN = {1866-6906}, DOI = {10.1007/s10762-015-0193-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shoaib, N. and Kuhlmann, K. and Judaschke, R. and Sellone, M. and Brunetti, L.} } @Article { , title = {Progress towards an acoustic determination of the Boltzmann constant at CEM-UVa}, journal = {Metrologia}, year = {2015}, month = {8}, day = {15}, volume = {52}, number = {5}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {S257-S262}, keywords = {Boltzmann constant, acoustic gas thermometry, speed of sound, new kelvin, uncertainty budget}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/5/S257}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Science}, address = {Bristol}, language = {30}, ISSN = {NA}, DOI = {10.1088/0026-1394/52/5/S257}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {P{\'e}rez-Sanz, F J and Segovia, J J and Martin, M C and Villamanan, M A and del Campo, D and Garcia, C} } @Article { BaerSPSO2015, title = {Fast and Flexible Non-Null Testing of Aspheres and Free-Form Surfaces with the Tilted-Wave-Interferometer}, journal = {International Journal of Optomechatronics}, year = {2015}, month = {8}, day = {8}, volume = {8}, number = {4}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {242-250}, keywords = {Interferometry, Non-Null-Test, Asphere, Freeform}, web_url = {http://www.tandfonline.com/doi/full/10.1080/15599612.2014.942925}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1080/15599612.2014.942925}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Baer, Goran and Schindler, Johannes and Pruss, Christof and Siepmann, Jens and Osten, Wolfgang} } @Article { , title = {Brief bursts of infrasound may improve cognitive function - An fMRI study}, journal = {Hearing Research}, year = {2015}, month = {8}, day = {7}, volume = {328 (2015)}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {87-93}, keywords = {Auditory system; Cognitive processing; Infrasound; N-back; Working memory; fMRI}, web_url = {http://www.sciencedirect.com/science/article/pii/S0378595515001628}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, address = {Philadelphia}, language = {30}, DOI = {10.1016/j.heares.2015.08.001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-5-31}, author = {Weichenberger, Markus and Bauer, Martin and K{\"u}hler, Robert and Hensel, Johannes and Br{\"u}hl, R{\"u}diger and Ihlenfeld, Albrecht and Ittermann, Bernd and Gallinat, J{\"u}rgen and Koch, Christian and Sander, Tilmann and K{\"u}hn, Simone} } @Article { , title = {Evaluating the Internal Structure of Core–Shell Nanoparticles Using X-ray Photoelectron Intensities and Simulated Spectra}, journal = {The Journal of Physical Chemistry C}, year = {2015}, month = {8}, day = {6}, volume = {119}, number = {31}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {17687–17696}, keywords = {Core shell Nanoparticles, XPS simulations, XPS Intensities}, web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4554492/}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Sociery}, address = {Washington DC}, language = {30}, DOI = {10.1021/acs.jpcc.5b04517}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-6}, author = {Chudzicki, M and Werner, WSM and Shard, AG and Wang, YC and Castner, DG and Powell, CJ} } @Proceedings { , subid = {135}, title = {Metrology for long distance surveying - a joint attempt to improve traceability of long distance measurements}, journal = {IAG 150 Years - Proceedings of the 2013 IAG Scientific Assembly}, year = {2015}, month = {8}, day = {1}, volume = {143}, number = {2015}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {calibration · EDM · GNSS · local ties · reference baseline · long distance}, web_url = {http://link.springer.com/chapter/10.1007\%2F1345_2015_154}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer International Publishing}, address = {Berlin Heidelberg}, event_place = {Potsdam, Germany}, event_name = {International Association of Geodesy (IAG) Scientific Assembly 2013}, event_date = {September 1-6, 2013}, language = {30}, ISSN = {0939-9585}, DOI = {10.1007/1345_2015_154}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Pollinger, F. and Astru, M. and Bauch, A. and Bergstrand, S. and G{\"o}rres, B. and Jokela, J. and Kallio, U. and Koivula, H. and Kuhlmann, H. and Kupko, V. and Meiners-Hagen, K. and Merimaa, M. and Niemeier, W. and Neyezhmakov, P. and Poutanen, M. and Saraiva, F. and Sch{\"o}n, S. and van den Berg, S.A. and Wallerand, J.-P. and Zucco, M.} } @Article { , title = {Verification of an optical micro-CMM using the focus variation technique: Aspects of probing errors}, journal = {CIRP Annals Manufacturing Technology}, year = {2015}, month = {8}, day = {1}, volume = {64}, number = {2}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, pages = {511-514}, keywords = {Metrology, Optical, Coordinate measuring machine (CMM)}, web_url = {http://www.sciencedirect.com/science/article/pii/S0007850615000979}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0007-8506}, DOI = {10.1016/j.cirp.2015.04.089}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Sun, W and Claverley, J. D. and Claverley, James} } @Techreport { , title = {A Guide to Bayesian Inference for Regression Problems}, journal = {-}, year = {2015}, month = {7}, day = {30}, volume = {-}, number = {-}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {-}, tags = {MAT}, web_url = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {PTB}, address = {Brunswick \& Berlin}, institution = {-}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, author = {Elster, C. and Klauenberg, K. and Walzel, M. and Wuebbeler, G. and Harris, P. and Cox, M. and Matthews, C. and Smith, I. and Wright, L. and Allard, A. and Fischer, N. and Cowen, S. and Ellison, S. and Wilson, P. and Pennecchi, F. and Kok, G. and Van der Veen, A. and Pendrill, L.R.} } @Article { , title = {Measuring Compositions in Organic Depth Profiling: Results from a VAMAS Interlaboratory Study}, journal = {Journal of Physical Chemistry (B)}, year = {2015}, month = {7}, day = {23}, volume = {119}, number = {33}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {10784–10797}, web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b05625}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ACS}, address = {Washington DC}, language = {30}, DOI = {10.1021/acs.jpcb.5b05625}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-6}, author = {Shard, A. and Havelund, R. and Spencer, S. and Gilmore, I. and Alexander, M.R. and Angerer, T.B. and Aoyagi, S. and Barnes, J.P. and Benayad, A. and Bernasik, A. and Ceccone, G. and Counsell, J.D.P and Deeks, C. and Fletcher, J.S. and Graham, D.J. and Heuser, C. and Lee, T.G. and Marie, C. and Marzec, M.M. and Mishra, G. and Rading, D. and Renault, O. and Scurr, D.J and Shon, H.K. and Spampinato, V. and Tian, H. and Wang, F. and Winograd, N. and Wu, K. and Wucher, A.} } @Article { , title = {How to use current practice, risk analysis and standards to define hospital-wide policies on the safe use of infusion technology}, journal = {Biomed. Eng.-Biomed.}, year = {2015}, month = {7}, day = {20}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {381-387}, keywords = {drug delivery; hospital policy; infusion; therapy; medical devices; metrology; multi-infusion; quality assurance; standards}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0147}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Timmerman, A.M.D.E. and Oliveira-Martens, S.M. and Snijder, R.A. and Niemann, A.K. and Egberts, T.C.} } @Proceedings { , title = {Investigation of perception at infrasound frequencies by functional magnetic resonance imaging (fMRI) and magnetoencephalography (MEG)}, journal = {Proceedings of International Conference on Sound and Vibration (ICSV22)}, year = {2015}, month = {7}, day = {16}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, keywords = {non-audible noise, functional magnetic resonance imaging, magnetoencephalography, infrasound}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Florence (Italy)}, event_name = {The 22nd International Congress on Sound and Vibration}, event_date = {12-16 July 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bauer, M and Sander-Th{\"o}mmes, T and Ihlenfeld, A and K{\"u}hn, S and K{\"u}hler, R and Koch, C} } @Article { , title = {On the relation between uncertainties of weighted frequency averages and the various types of Allan deviations}, journal = {Metrologia}, year = {2015}, month = {7}, day = {16}, volume = {52}, number = {n/a}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {565-574}, keywords = {frequency uncertainty, Allan deviation, clock comparison}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/4/565/meta}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {n/a}, DOI = {10.1088/0026-1394/52/4/565}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-7-16}, author = {Benkler, E and Lisdat, C and Sterr, U} } @Article { LalereGPRFESE2015, title = {Interaction of 15 priority substances for water monitoring at ng L−1 levels with glass, aluminium and fluorinated polyethylene bottles for the containment of water reference materials}, journal = {Accreditation and Quality Assurance}, year = {2015}, month = {7}, day = {11}, volume = {20}, number = {6}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {447-455}, keywords = {Water Framework Directive, Reference materials, Hydrophobic organic pollutants, Bottles, Adsorption, Glass, Aluminium, Fluorinated polyethylene}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-1775, 1432-0517}, DOI = {10.1007/s00769-015-1150-3}, stag_bib_extends_levelofaccess = {NA}, author = {Lal{\`e}re, B. and Gantois, F. and Philipp, R. and Richter, J. and Fettig, I. and Elordui-Zapatarietxe, S. and Swart, C. and Emteborg, H.} } @Article { , title = {Primary standards for measuring flow rates from 100 nl/min to 1 ml/min – gravimetric principle}, journal = {Biomed. Eng.-Biomed.}, year = {2015}, month = {7}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {301-316}, keywords = {dynamic gravimetric calibration; intercomparison; liquid; metrology for drug delivery; microflow; primary standard; validation.}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0145}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bissig, H. and Petter, H.T. and Lucas, P. and Batista, E. and Fillipe, E. and Almeida, N. and Ribeiro, L.F. and Gala, J. and Martins, R. and Savanier, B. and Ogheard, F. and Niemann, A.K. and L{\"o}tters, J. and Sparreboom, W.} } @Article { , title = {Flow variability and its physical causes in infusion technology: a systematic review of in vitro measurement and modeling studies}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {7}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {277-300}, keywords = {compliance; drug delivery; in vitro; infusion; metrology; pumps; review}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0148}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Snijder, R.A. and Koning, M.K. and Lucas, P. and Egberts, T.C. and Timmerman, A.M.D.E.} } @Article { , title = {Evaluation of HPGe spectrometric devices in monitoring the level of radioactive contamination in metallurgical industry}, journal = {Nuclear Instruments and Methods in Physics Research, Section A}, year = {2015}, month = {7}, day = {1}, volume = {797}, number = {not available}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {271-277}, keywords = {High Purity Germanium; Minimum detectable activity; Monte Carlo; Spectrometer; Standardisation; Steel factories}, web_url = {http://www.sciencedirect.com/science/article/pii/S0168900215008220}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2015.07.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Petrucci, Andrea and Arnold, Dirk and Burda, Oleksiy and De Felice, Pierino and Garc{\'i}a-Tora{\~n}o, Eduardo and Mejuto, Marco and Peyr{\'e}s, Virginia and Šolc, Jaroslav and Vodenik, Branko} } @Article { , title = {Tip-enhanced Raman spectroscopy: principles and applications}, journal = {EPJ Techniques and Instrumentation}, year = {2015}, month = {7}, day = {1}, volume = {2:9}, number = {2015}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {2:9}, keywords = {Tip-enhanced Raman spectroscopy; Nanotechnology; Nanophotonics}, web_url = {http://epjtechniquesandinstrumentation.springeropen.com/articles/10.1140/epjti/s40485-015-0019-5}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer Open}, address = {Heidelberg}, language = {30}, ISSN = {N/A}, DOI = {10.1140/epjti/s40485-015-0019-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-7-1}, author = {Kumar, N. and Mignuzzi, S. and Su, W. and Roy, D.} } @Proceedings { , title = {Stability of Standard Dynamic VOC Mixtures for atmospheric Measures}, journal = {5th IMEKO TC19 Symposium on Environmental Instrumentation and Measurements 2014}, year = {2015}, month = {7}, volume = {unique}, number = {unique}, number2 = {IND63: MetAMC: Metrology for airborne molecular contamination in manufacturing environments}, pages = {118-121}, keywords = {standard gas mixtures; VOC; concentration stability.}, web_url = {http://www.proceedings.com/25933.html}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Curran Associates, Inc}, address = {Red Hook, NY}, event_place = {Chemnitz, Germany}, event_name = {IMEKO TC19 Symposium on Environmental Instrumentation and Measurements 2014}, event_date = {23-24 September 2014}, language = {30}, ISBN = {978-1-5108-0139-4}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.proceedings.com/25933.html}, author = {Demichelis, A and Sassi, M and Lecuna, M and Sassi, G} } @Article { , title = {Online validation of comparison algorithms using the TraCIM system}, journal = {Journal of mechanical Engineering and Automation}, year = {2015}, month = {7}, volume = {2}, number = {7}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {312-327}, keywords = {Comparison, TraCIM, weighted mean, expanded measurement uncertainty, En value, largest consistent subset, En criterion, Grubbs’ test.}, tags = {MAT}, web_url = {http://www.ethanpublishing.com/uploadfile/2015/0806/20150806111104726.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Scientific \& Academic Publishing (SAP)}, address = {Rosemead}, language = {30}, ISSN = {2163-2413}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {H{\"a}rtig, FH and Tang, JT and Hutzschenreuter, DH and Wendt, KW and Kniel, KK and Shi, ZS} } @Proceedings { BlattnerKJSHB2015, title = {Measurement uncertainty of photometric measurements considering the requirements of the new international standard CIE S 025 / E:2015 ''Test Method for LED Lamps, LED Luminaires and LED Modules}, journal = {Proceedings of the 28th Session of the CIE Manchester, United Kingdom, 28 June – 4 July 2015}, year = {2015}, month = {7}, volume = {1}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {797-811}, keywords = {measurement uncertainty, LED, CIE S 025, Test Method for LED lamps, international standard}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Commission Internationale de L'Eclairage}, address = {CIE Central Bureau, Babenbergerstra{\ss}e 9/9A, 1010 Vienna, Austria}, event_place = {Manchester, UK}, event_name = {28th Session of the CIE}, event_date = {28-06-2015 to 04-07-2015}, language = {30}, ISBN = {978-3-902842-55-8}, stag_bib_extends_levelofaccess = {NA}, author = {Blattner, P. and Kr{\"u}ger, U. and Jordan, W. and Steudtner, W. and Hornischer, R. and Bechter, W.} } @Article { , title = {High-bandwidth transfer of phase stability through a fiber frequency comb}, journal = {Optics Express}, year = {2015}, month = {6}, day = {30}, volume = {23}, number = {15}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {19771-19776}, web_url = {http://arxiv.org/abs/1505.02084}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Scharnhorst, N. and W{\"u}bbena, J. B. and Hannig, S. and Jakobsen, K. and Kramer, J. and Leroux, I. D. and Schmidt, P. O.} } @Article { , title = {Primary standard for liquid flow rates between 30 and 1500 nl/min based on volume expansion}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {6}, day = {26}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {317-335}, keywords = {calibration; comparison; implanted infusion; pumps; micro and nano liquid flow rates; primary standard; uncertainty; validation; volumetric expansion}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0132}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lucas, P. and Ahrens, M. and Geršl, J. and Sparreboom, W. and L{\"o}tters, J.} } @Article { , title = {Effects of thermal drifts on the calibration of capacitive displacement probes at the nanometer level of accuracy}, journal = {Instrumentation and Measurement, IEEE Transactions}, year = {2015}, month = {6}, day = {26}, volume = {PP}, number = {99}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, pages = {1}, keywords = {thermal behavior and drift, capacitive displacement probe, dimensional metrology, evaluation}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2440563}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bouderbala, K and Nouira, H and Girault, M and Videcoq, E and Salgado, J} } @Article { , title = {High temperature measurement and characterisation of piezoelectric properties}, journal = {Journal of Materials Science: Materials in Electronics}, year = {2015}, month = {6}, day = {26}, volume = {26}, number = {12}, number2 = {NEW09: METCO: Metrology of electro-thermal coupling for new functional materials technology}, pages = {9268-9278}, keywords = {Piezoelectric, High Temperature, Measurement, Metrology, Interferometry}, web_url = {http://link.springer.com/article/10.1007\%2Fs10854-015-3285-8}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer US}, language = {30}, ISSN = {0957-4522}, DOI = {10.1007/s10854-015-3285-8}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Weaver, PMW and Stevenson, TS and Quast, TQ and Bartl, GB and Schmitz-Kempen, TSK and Wooliams, PW and Blumfield, AB and Stewart, MS and Cain, MGC} } @Article { , title = {Coherent precession in arrays of dipolar-coupled soft magnetic nanodots}, journal = {Journal of Applied Physics}, year = {2015}, month = {6}, day = {25}, volume = {117}, number = {24}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {7/243905}, keywords = {nanodot, VNA-FMR, precessional mode}, web_url = {http://scitation.aip.org/content/aip/journal/jap}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {AIP Publisching}, address = {NY}, language = {30}, ISSN = {0021-8979 (print) ; 1089-7550 (online)}, DOI = {10.1063/1.4923160}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hu, X.K and Dey, H. and Liebing, N. and Schumacher, H.W. and Csaba, G. and Orlov, A. and Bernstein, G.H. and Porod, W.} } @Article { , title = {Testing equivalency of an alternative method based on portable FTIR to the European Standard Reference Methods for monitoring emissions to air of CO, NOx, SO2, HCl, and H2O}, journal = {Journal of the Air \& Waste Management Association}, year = {2015}, month = {6}, day = {11}, volume = {Vol. 65}, number = {Iss. 8,2015}, number2 = {ENV60: IMPRESS: Metrology to underpin future regulation of industrial emissions}, pages = {1011-1019}, keywords = {CEN/TS 14793, FTIR, TGN M22, EN 15058, 2010/75/EU, Industrial, Emissions, pollution, SRMs, UNECE, CLRTAP, E-PRTR, CEMs, AMSs, BIPM, Fourier-transform infrared, measurement.}, web_url = {http://www.tandfonline.com/doi/full/10.1080/10962247.2015.1058868}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Taylor \& Francis}, address = {London}, language = {30}, ISSN = {1096-2247}, DOI = {10.1080/10962247.2015.1058868}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-6-11}, author = {Coleman, M.D. and Render, S. and Dimopoulos, C. and Lilley, A. and Robinson, R.A. and Smith, T.O.M. and Camm, R. and Standring, R.} } @Article { , title = {How physical infusion system parameters cause clinically relevant dose deviations after setpoint changes}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {6}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {365-376}, keywords = {drug delivery; metrology; multi-infusion; standards; syringe compliance}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0139}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Timmerman, A.M.D.E. and Snijder, R.A. and Lucas, P. and Lagerwij, M.C. and Radermacher, J.H. and Konings, M.K.} } @Proceedings { , title = {Sensitivity of VOC Sensors for Air Quality Monitoring within the EURAMET Key-VOC project}, journal = {AMA Science}, year = {2015}, month = {6}, day = {5}, volume = {Fourth Scientific Meeting EuNetAir}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, pages = {6 - 9}, keywords = {benzene, photo ionisation detectors, metal oxide sensors, electrochemical cells, micro GCs, electronic noses}, web_url = {http://www.ama-science.org/proceedings/details/2117}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {AMA Science (http://www.ama-science.org/ama-conferences)}, address = {Wunstorf}, event_place = {Linkoping University, Linkoping, Sweden}, event_name = {Fourth Scientific Meeting EuNetAir}, event_date = {03-06-2015 to 05-06-2015}, language = {30}, DOI = {10.5162/4EuNetAir2015/02}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Spinelle, L. and Gerboles, M. and Kok, G. and Sauerwald, T.} } @Article { , title = {Design and Calibration of a Compact Quasi-Optical System for Material Characterization in Millimeter/Sub-millimeter Wave Domain}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {1438-1445}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2014.2376115}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kazemipour, A. and Hudlicka, M. and Yee, S.-K. and Salhi, M. and Kleine-Ostmann, T. and Schrader, T.} } @Article { , title = {Topographical orientation effects on friction and wear in sliding DLC and steel contacts, Part 1: Experimental}, journal = {Wear}, year = {2015}, month = {6}, volume = {330–331}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {3–22}, keywords = {Friction, Wear, Topography, Orientation, Modelling}, web_url = {http://www.sciencedirect.com/science/article/pii/S0043164815001234}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, ISSN = {0043-1648}, DOI = {10.1016/j.wear.2015.02.014}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Holmberg, KH and Laukkanen, AL and Roikainen, HR and Waudby, RW and Stachowiak, GS and Wolski, MW and Podsiadlo, PP and Gee, MG and Nunn, JN and Gachot, CG and Li, LL} } @Article { , title = {Carrier type inversion in quasi-free standing graphene: studies of local electronic and structural properties}, journal = {Nature: Scientific reports}, year = {2015}, month = {6}, number = {5}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {10505}, keywords = {metrology, Kelvin, graphene, measurements,}, web_url = {http://www.nature.com/articles/srep10505}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Scientific reports}, language = {30}, DOI = {10.1038/srep10505}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Melios, C. and Panchal, V. and Giusca, C. E. and Strupinski, W. and Silva, S. Ravi P. and Kazakova, O.} } @Article { SuomalainenSNMMLLKHEDBHW2015, title = {Performance of a Modular Wideband HVDC Reference Divider for Voltages up to 1000 kV}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, volume = {64}, number = {6}, number2 = {ENG07: HVDC: Metrology for High Voltage Direct Current}, pages = {1390-1397}, keywords = {Voltage measurement, Calibration, Resistors, HVDC transmission, Uncertainty, Voltage control, Resistance}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2408795}, stag_bib_extends_levelofaccess = {NA}, author = {Suomalainen, E.P. and Schmidt, M. and Nieminen, T. and Merev, A. and Meisner, J. and Lucas, W. and Lehtonen, T. and Kl{\"u}ss, J. and Houtzager, E. and Elg, A.P. and Dedeoğlu, S. and Bergman, A. and H{\"a}llstr{\"o}m, J. and Weber, C.} } @Proceedings { , title = {Auditory cortex activation by infrasonic and low-frequency sound of equalized individual loudness}, journal = {Euronoise 2015}, year = {2015}, month = {5}, day = {31}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, pages = {2577-2582}, keywords = {Infrasound, loudness, MEG}, web_url = {http://www.conforg.fr/euronoise2015/output_directory/data/articles/000402.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Maastricht (Nederlands)}, event_name = {Euronoise 2015, Maastricht}, event_date = {3rd June 2015}, language = {30}, ISSN = {2226-5147}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {K{\"u}hler, Robert and Bauer, Martin and Hensel, Johannes and Koch, Christian and Sander-Th{\"o}mmes, Tillmann} } @Proceedings { , title = {MEG and fMRI localization of infrasonic and low-frequency sound}, journal = {Proccedings of the ISMRM 2015 - International Society for Magnetic Resonance in Medicine}, year = {2015}, month = {5}, day = {30}, number2 = {HLT01: Ears: Metrology for a universal ear simulator and the perception of non-audible sound}, web_url = {http://www.ismrm.org/15/}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Toronto, Ontario, Canada}, event_name = {ISMRM 23rd Annual Meeting \& Exhibition}, event_date = {30 May-05 June 2015}, language = {30}, ISSN = {1545-4428}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Weichenberger, M. and Br{\"u}hl, R. and Bauer, M. and K{\"u}hler, R. and Ihlenfeld, A. and Hensel, J. and Koch, C. and Ittermann, B. and K{\"u}hn, S. and Sander-Th{\"o}mmes, T.} } @Proceedings { , title = {Microstrip open: Problematic calibration standard}, journal = {Proc. of the 85th Microwave Measurement Conference (ARFTG)}, year = {2015}, month = {5}, day = {22}, volume = {n/a}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {microstrip open, calibration standard, radiation}, web_url = {http://ieeexplore.ieee.org/xpl/login.jsp?tp=\&arnumber=7162921}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Phoenix, Arizona, USA}, event_name = {Proc. of the 85th Microwave Measurement Conference (ARFTG)}, event_date = {22 May 2015}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/ARFTG.2015.7162921}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Haase, Martin and Hoffmann, Karel and Skvor, Zbynek} } @Article { , title = {Edge-Mode Resonance-Assisted Switching of Nanomagnet Logic Elements}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {5}, day = {21}, volume = {51}, number = {11}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, pages = {4/3401004}, keywords = {Ferromagnetic resonance (FMR) mode, microwave-assisted magnetization switching (MAS), nanomagnet logic (NML), simulation}, web_url = {http://ieeexplore.ieee.org/xpl/RecentIssue.jsp?punumber=20}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2015.2435901}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hu, X.K. and Dey, H. and Liebing, N. and Csaba, G. and Orlov, A. and Bernstein, G.H. and Porod, W. and Krzysteczko, P. and Sievers, S. and Schumacher, H.W.} } @Article { , title = {Signature properties of water: Their molecular electronic origins}, journal = {Proceedings of the National Academy of Sciences of the United States of America}, year = {2015}, month = {5}, day = {19}, volume = {112}, number = {20}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {6341-6346}, keywords = {subcritical water intermolecular interactions many-body dispersion coarse-grained model electronic responses}, web_url = {http://www.pnas.org/content/112/20/6341.full.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {PNAS}, address = {Washington}, language = {30}, DOI = {10.1073/pnas.1418982112}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Sokhan, Vlad P. and Jones, Andrew P. and Cipcigan, Flaviu S. and Crain, Jason and Martyna, Glenn J.} } @Article { , title = {The portable device for continual measurement of radon progenies on filter using the detector Timepix}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {19}, volume = {164}, number = {4}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {493-496}, keywords = {Timepix, EEC, radon progenies}, web_url = {http://rpd.oxfordjournals.org/content/164/4/493.long}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Oxford University Press}, address = {Oxford}, language = {30}, ISSN = {1742-3406}, DOI = {10.1093/rpd/ncv343}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://rpd.oxfordjournals.org/content/164/4/493.abstract}, author = {Bul{\'a}nek, BB and Hůlka, JH and J{\'i}lek, KJ and Štekl, IŠ} } @Proceedings { , title = {Investigation of verification artefacts in rectangular waveguides up to 325 GHz}, journal = {Proceedings Radio Science Conference (URSI AT-RASC), 2015 1st URSI Atlantic}, year = {2015}, month = {5}, day = {16}, volume = {n.a.}, number = {n.a.}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1}, keywords = {verification, waveguide}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Danvers}, event_place = {Gran Canaria}, event_name = {Radio Science Conference (URSI AT-RASC), 2015 1st URSI Atlantic}, event_date = {16-05-2015 to 24-05-2015}, language = {30}, ISBN = {n.a.}, ISSN = {n.a.}, DOI = {10.1109/URSI-AT-RASC.2015.7302818}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Shoaib, N. and Kuhlmann, K. and Judaschke, R.} } @Article { SuranKBAMSHTLT2015, title = {A new large-volume metal reference standard for radioactive waste management}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {13}, volume = {168}, number = {3}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {293-299}, keywords = {reference materials, calibration, ionizing radiation, free release measurement}, web_url = {http://rpd.oxfordjournals.org}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv309}, stag_bib_extends_levelofaccess = {NA}, author = {Šur{\'a}ň, J. and Kov{\'a}ř, P. and Burda, O. and Arnold, D. and Marissens, G. and Stroh, H. and Hult, M. and Tzika, F. and Listkowska, A. and Tyminski, Z.} } @Article { , title = {Frequency and time transfer for metrology and beyond using telecommunication network fibres}, journal = {Comptes Rendus Physique}, year = {2015}, month = {5}, day = {8}, volume = {16}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {531–539}, keywords = {Time and frequency metrology Optical links Frequency stabilized lasers Fibre optics}, web_url = {www.sciencedirect.com}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1016/j.crhy.2015.04.005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopez, O. and K{\'e}f{\'e}lian, F. and Jiang, H. and Haboucha, A. and Bercy, A. and Stefani, F. and Chanteau, B. and Kanj, A. and Rovera, D. and Achkar, J. and Chardonnet, C and Pottie, P.-O. and Amy-Klein, A. and Santarelli, G.} } @Article { , title = {Characterization of a large-area pyroelectric detector from 300 GHz to 30 THz}, journal = {Journal of Infrarred, Millimeter, and Terahertz Waves}, year = {2015}, month = {5}, day = {5}, volume = {36}, number = {7}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {654-661}, keywords = {Far infrared detectors, Terahertz detectors, Radiometry, Metrological instrumentation, Infrared and far infrared lasers, Optics}, web_url = {http://link.springer.com/article/10.1007\%2Fs10762-015-0163-7}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Springer US}, address = {New York}, language = {30}, ISSN = {1866-6892}, DOI = {10.1007/s10762-015-0163-7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {M{\"u}ller, Ralf and Gutschwager, Berndt and Hollandt, J{\"o}rg and Kehrt, Mathias and Monte, Christian and M{\"u}ller, Ralph and Steiger, Andreas} } @Article { , title = {8 \(\times\) 10−17 fractional laser frequency instability with a long room-temperature cavity}, journal = {Optics Letters}, year = {2015}, month = {5}, volume = {40}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {2112 - 2115}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-9-2112}, web_url2 = {https://arxiv.org/abs/1502.02608}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1364/OL.40.002112}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-5-31}, author = {Hafner, Sebastian and Falke, Stephan and Grebing, Christian and Vogt, Stefan and Legero, Thomas and Merimaa, Mikko and Lisdat, Christian and Sterr, Uwe} } @Article { , title = {Heavy ion Beams for Radiobiology: Dosimetry and Nanodosimetry at HIL}, journal = {Acta Physica Polonica A}, year = {2015}, month = {5}, volume = {127}, number = {5}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {1516-1519}, keywords = {PACS numbers: 87.53.Bn, 87.53.-j}, web_url = {http://przyrbwn.icm.edu.pl/APP/ABSTR/127/a127-5-18.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.12693/APhysPolA.127.1516}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kamierczak, U. and Bantsar, A. and Banas, D. and Braziewicz, J. and Czub, J. and Jask{\'o}la, M. and Korman, A. and Kruszewski, M. and Lankoff, A. and Lisowska, H. and Pietrzak, M. and Pszona, S. and Stepkowski, T. and Szeflinski, Z. and Wojew{\'o}dzka, M.} } @Proceedings { , title = {Approaches for assigning numerical uncertainty to reference data pairs for software validation}, journal = {Advanced Mathematical and Computational Tools in Metrology and Testing X}, year = {2015}, month = {5}, volume = {86}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {195-202}, keywords = {Numerical uncertainty, numerical accuracy, condition number, numerical sensitivity, performance metric, software validation}, tags = {MAT}, web_url = {http://www.worldscientific.com/doi/abs/10.1142/9789814678629_0023}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {World Scientific Publishing}, address = {Singapore}, event_place = {St Petersburg, Russia}, event_name = {Advanced Mathematical and Computational Tools in Metrology and Testing 2014 - Traceability for computationally-intensive metrology}, event_date = {09-09-2014 to 12-09-2014}, language = {30}, ISBN = {978-981-4678-63-6}, DOI = {10.1142/9789814678629_0023}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kok, GJPK and Smith, IMS} } @Article { , title = {Calibration of freeform standard}, journal = {Proceedings of the15th International Conference of the European Society for Precision Engineering and Nanotechnology}, year = {2015}, month = {5}, volume = {1}, number = {-}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {147-148}, keywords = {Freeform measurement, freeform standard, freeform standard calibration, free-from surface, 3D line, normal vector}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {euspen}, address = {Delft}, language = {30}, ISBN = {978-0-9566790-7-9}, ISSN = {978-0-9566790-7-9}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Zelen{\'y}, V and Linkeov{\'a}, I and Skaln{\'i}k, P} } @Article { , title = {First on-line isotopic characterization of N2O above intensively managed grassland}, journal = {Biogeosciences}, year = {2015}, month = {4}, day = {29}, volume = {12}, number = {N/A}, number2 = {ENV52: HIGHGAS: Metrology for high-impact greenhouse gases}, pages = {2517-2531}, keywords = {None supplied.}, web_url = {http://www.biogeosciences.net/12/2517/2015/}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus Publications}, address = {Gottingen}, language = {30}, ISSN = {1726-4189}, DOI = {10.5194/bg-12-2517-2015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wolf, B and Merbold, L and Decock, C and Tuzson, B and Harris, E and Six, J and Emmenegger, L and Mohn, J} } @Article { , title = {Mapping the Optical Absorption of a Substrate-Transferred Crystalline AlGaAs Coating at 1.5um}, journal = {Classical and Quantum Gravity}, year = {2015}, month = {4}, day = {27}, volume = {32}, number = {10}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {105008}, keywords = {gravitational wave detectors, absorption, crystalline coating}, web_url = {http://iopscience.iop.org/article/10.1088/0264-9381/32/10/105008/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0264-9381}, DOI = {10.1088/0264-9381/32/10/105008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Steinlechner, J and Martin, I W and Bell, A and Cole, G and Hough, J and Penn, S and Rowan, S and Steinlechner, S} } @Article { , title = {A novel type N coaxial air-line verification standard}, journal = {Metrologia}, year = {2015}, month = {4}, day = {24}, volume = {52}, number = {4}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {469–477}, keywords = {VNA verification standard, coaxial air-line, type N coaxial connector}, web_url = {http://stacks.iop.org/0026-1394/52/i=4/a=469}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing on behalf of BIPM}, address = {Bristol}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/0026-1394/52/4/469}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shoaib, N. and Kuhlmann, K. and Judaschke, R.} } @Article { , title = {Development of a primary thoron activity standard for the calibration of thoron measurement instruments}, journal = {Radiation Protection and Dosimetry}, year = {2015}, month = {4}, day = {24}, number = {167}, number2 = {IND57: MetoNORM: Metrology for processing materials with high natural radioactivity}, pages = {70-74}, keywords = {thoron, radon}, web_url = {http://rpd.oxfordjournals.org/content/167/1-3/70.abstract?maxtoshow=\&hits=10\&RESULTFORMAT=\&fulltext=thoron+sabot\&searchid=1\&FIRSTINDEX=0\&resourcetype=HWCIT}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Oxford Journals}, address = {Oxford University}, language = {30}, ISSN = {1742-3406}, DOI = {10.1093/rpd/ncv221}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sabot, B and Cassette, P and Pierre, S and Michielsen, N and Bondiguel, S} } @Article { , title = {Critical Review of Industrial Techniques for Thermal Conductivity Measurements of Thermal Protection Materials}, journal = {International Journal of Thermophysics}, year = {2015}, month = {4}, day = {23}, volume = {36}, number = {7}, number2 = {SIB52: Thermo: Metrology for thermal protection materials}, pages = {1530-1544}, keywords = {Guarded heat-flow meter, Guarded hot-plate apparatus, High temperature, Laser-flash instrument, Measuring device, Thermal conductivity, Thermal insulation material, Transient hot wire, Transient plane source}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1863-x}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Link}, language = {30}, ISSN = {1572-9567}, DOI = {10.1007/s10765-015-1863-x}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hammerschmidt, UHS and Hameury, JH and Strnad, RS and Turz{\'o}-Andras,, ETA and Wu, JW} } @Article { , title = {EXPERIMENTAL INVESTIGATION OF IONISATION TRACK STRUCTURE OF CARBON IONS AT HIL WARSAW}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {4}, day = {20}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, web_url = {http://rpd.oxfordjournals.org/content/early/2015/04/20/rpd.ncv191.abstract}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1093/rpd/ncv191}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bantsar, A and Hilgers, G. and Pszona, S. and Rabus, H. and Szeflinski, Z.} } @Article { , title = {Epitaxial graphene on SiC: Modification of structural and electron transport properties by substrate pretreatment}, journal = {Epitaxial graphene on SiC: modification of structural and electron transport properties by substrate pretreatment}, year = {2015}, month = {4}, day = {20}, volume = {27}, number = {18}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {185303}, keywords = {Epitaxial graphene, step bunching, graphene buffer layer, graphene bilayer, resistance anisotropy, quantum Hall resistance, hydrogen, argon, pretreatment, transport properties, SiC substrate, annealing, shallowly stepped}, web_url = {http://iopscience.iop.org/article/10.1088/0953-8984/27/18/185303/meta}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {0953-8984}, DOI = {10.1088/0953-8984/27/18/185303}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kruskopf, M. and Pierz, K. and Wundrack, S. and Stosch, R. and Dziomba, T. and Kalmbach, C.C. and M{\"u}ller, A. and Ahlers, F.J. and Schumacher, H.W. and Baringhaus, J. and Tegenkamp, C.} } @Article { , title = {Quantum Hall resistance standard in graphene devices under relaxed experimental conditions}, journal = {Nature Nanotechnology}, year = {2015}, month = {4}, day = {20}, volume = {10}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {965-971}, keywords = {graphene, QHR, measurement}, web_url = {https://www.ptb.de/emrp/resources/documents/graphohm/Sonstige_Fotos/NatureComms7806-2015-Lafont.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Macmillan Publishers}, language = {30}, DOI = {10.1038/ncomms7806}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lafont, F. and Ribeiro-Palau, R. and Kazazis, D. and Michon, A. and Couturaud, O. and Consejo, C. and Chassagne, T. and Zielinski, M. and Portrail, M. and Jouault, B. and Schopfer, F. and Poirier, W.} } @Article { , title = {INFLUENCE OF THE PHYSICAL DATA TO CALIBRATE}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {4}, day = {15}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, web_url = {http://rpd.oxfordjournals.org/content/early/2015/04/15/rpd.ncv140.abstract}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1093/rpd/ncv140}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Chiriotti, S. and Moro, D. and Conte, V. and Colautti, P. and Grosswendt, B. and Sterpin, E. and Vynckier, S.} } @Article { KleineOstmannSS2015, title = {Antenna Characterization and Channel Measurements in the mmWave and Sub-mmWave Region}, journal = {Microwave Journal}, year = {2015}, month = {4}, day = {15}, volume = {58}, number = {4}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {124-134}, keywords = {SCANNING systemsm WAVEGUIDE antennas, TELECOMMUNICATION systems, MICROSTRIP antennas, BROADBAND antennas}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Horizon House Publications Inc.}, language = {30}, ISSN = {0192-6225}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {0192-6225}, author = {Kleine-Ostmann, T. and Schrader, T. and Salhi, M.} } @Article { , title = {Interaction-free measurements by quantum Zeno stabilization of ultracold atoms}, journal = {Nature Communications}, year = {2015}, month = {4}, day = {14}, volume = {6}, number = {1}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {6811}, keywords = {Physical sciences Atomic and molecular physics}, web_url = {http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html\#affil-auth}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Macmillan Publishers Limited}, address = {Basingstoke, Hampshire RG21 6XS, United Kingdom}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms7811}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html\#affil-auth}, author = {Peise, J and L{\"u}cke, B and Pezze, L and Deuretzbacher, F and Ertmer, W and Arlt, J and Smerzi, A and Santos, L and Klempt, C} } @Article { , title = {Tackling the limits of optical fiber links}, journal = {J. Opt. Soc. Am. B}, year = {2015}, month = {4}, day = {9}, volume = {32}, number = {5}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {787 - 797}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/JOSAB.32.000787}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stefani, F. and Lopez, O. and Bercy, A. and Lee, W.-K. and Chardonnet, C. and Santarelli, G. and Pottie, P.-E. and Amy-Klein, A.} } @Article { , title = {Outgassing rate measurements with the difference method in framework of EMRP IND12}, journal = {Vacuum}, year = {2015}, month = {4}, day = {8}, number2 = {IND12: Vacuum: Vacuum metrology for production environments}, keywords = {Outgassing rate measurement, Outgassing reference probes, Outgassing reference samples}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2015.03.033}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hauer, V. and Battes, K. and Fl{\"a}mmich, M. and Lerardi, V. and Jousten, K. and Šetina, J.} } @Article { , title = {Sensing earth's rotation with a helium-neon ring laser operating at 1.15 \(\mu\)m}, journal = {Opt. Lett.}, year = {2015}, month = {4}, day = {8}, volume = {40}, number = {8}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {1705}, keywords = {(120.5790) Sagnac effect; (140.3370) Laser gyroscopes; (140.3560) Lasers, ring.}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-8-1705}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington, DC, USA}, language = {30}, ISSN = {1539-4794}, DOI = {10.1364/OL.40.001705}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schreiber, U and Thirkettle, R and Hurst, R and Follman, D and Cole, G and Aspelmeyer, M and Wells, J-P} } @Article { , title = {Evaluation and Selection of High-Temperature Fixed-Point Cells for Thermodynamic Temperature Assignment}, journal = {Int J Thermophys}, year = {2015}, month = {4}, day = {5}, volume = {36}, number = {8}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1834-1847}, keywords = {High-temperature fixed points · Metal-carbon eutectics · Radiation thermometry · Temperature standards · Thermodynamic temperature}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1860-0}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Link}, address = {Europe/Asia/Africa}, language = {30}, ISSN = {NA}, DOI = {10.1007/s10765-015-1860-0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yamada, Y and Anhalt, K and Battuello, M and Bloembergen, P and Khlevnoy, B and Machin, G and Matveyev, M and Sadli, M and Todd, A and Wang, T} } @Article { SchallesFF2015, title = {PCM-sh