% % This file was created by the TYPO3 extension % bib % --- Timezone: CEST % Creation date: 2022-08-16 % Creation time: 12-15-50 % --- Number of references % 717 % @Article { ZanovelloCBBAAZCB2022, subid = {2823}, title = {Classification Scheme of Heating Risk during MRI Scans on Patients with Orthopaedic Prostheses}, journal = {Diagnostics}, year = {2022}, month = {8}, volume = {12}, number = {8}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {1873}, keywords = {MRI heating risk, MRI safety, orthopaedic implants, radiofrequency-induced heating, gradient-induced heating.}, web_url = {https://www.mdpi.com/2075-4418/12/8/1873}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {2075-4418}, DOI = {10.3390/diagnostics12081873}, stag_bib_extends_levelofaccess = {NA}, author = {Zanovello, U. and Chiampi, M. and Bordini, B. and Baruffaldi, F. and Ancarani, C. and Arduino, A. and Zilberti, L. and Clementi, V. and Bottauscio, O.} } @Article { KurizkiKOGPAVGCDG2022, subid = {2818}, title = {Quantum Zeno and Anti-Zeno Probes of Noise Correlations in Photon Polarization}, journal = {Physical Review Letters}, year = {2022}, month = {7}, day = {13}, volume = {129}, number = {3}, number2 = {19NRM06: MeTISQ: Metrology for testing the implementation security of quantum key distribution hardware}, keywords = {Quantum measurements, Weak measurements}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.129.030401}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.129.030401}, stag_bib_extends_levelofaccess = {NA}, author = {Kurizki, G. and Kofman, A.G. and Opatrn{\'y}, T. and Gramegna, M. and Piacentini, F. and Avella, A. and Virz{\`i}, S. and Gherardini, S. and Caruso, F. and Degiovanni, I.P. and Genovese, M.} } @Article { AmicoTPSN2022, subid = {2720}, title = {Recent applications and novel strategies for mercury determination in environmental samples using microextraction-based approaches: A review}, journal = {Journal of Hazardous Materials}, year = {2022}, month = {7}, volume = {433}, number2 = {19NRM03: SI-Hg: Metrology for traceable protocols for elemental and oxidised mercury concentrations}, pages = {128823}, keywords = {Mercury determination, Microextraction techniques, Environmental monitoring, Exposomics studies, Green analytical chemistry (GAC), Sample preparation}, web_url = {https://doi.org/10.1016/j.jhazmat.2022.128823}, misc2 = {EMPIR 2019: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3894}, DOI = {10.1016/j.jhazmat.2022.128823}, stag_bib_extends_levelofaccess = {NA}, author = {Amico, D. and Tassone, A. and Pirrone, N. and Sprovieri, F. and Naccarato, A.} } @Article { ChenKKSA2022, subid = {2782}, title = {Diamagnetically levitating resonant weighing scale}, journal = {arXiv}, year = {2022}, month = {6}, day = {15}, volume = {arXiv:2105}, number = {June 2022}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {1-16}, keywords = {Resonant sensor, diamagnetic levitation, mass sensor, liquid sensing}, web_url = {https://arxiv.org/abs/2105.12444}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Cornell University}, language = {30}, ISSN = {arXiv:2105.12444v2}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2105.12444}, author = {Chen, X. and Kothari, N. and Keskekler, A. and Steeneken, P.G. and Alijani, F.} } @Article { ChenKAS2022, subid = {2783}, title = {Rigid body dynamics of diamagnetically levitating graphite resonators}, journal = {arXiv}, year = {2022}, month = {6}, day = {15}, volume = {arXiv:2006}, number = {June 2022}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {1-6}, keywords = {diamagnetically levitating resonators, low-noise oscillators and sensors}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Cornell University}, language = {30}, ISSN = {arXiv:2006.01733v3}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2006.01733}, author = {Chen, X. and Keskekler, A. and Alijani, F. and Steeneken, P.G.} } @Article { VolkovaHTBCMARERBPN2022, subid = {2712}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {color centers, optical quantum technology}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { VolkovaHTBCMARERBPN2022_2, subid = {2721}, title = {Optical and Spin Properties of NV Center Ensembles in Diamond Nano-Pillars}, journal = {Nanomaterials}, year = {2022}, month = {4}, day = {29}, volume = {12}, number = {9}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {1516}, keywords = {NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano12091516}, stag_bib_extends_levelofaccess = {NA}, author = {Volkova, K. and Heupel, J. and Trofimov, S. and Betz, F. and Colom, R. and MacQueen, R.W. and Akhundzada, S. and Reginka, M. and Ehresmann, A. and Reithmaier, J.P. and Burger, S. and Popov, C. and Naydenov, B.} } @Article { RubinSZHFABKLZA2022, subid = {2709}, title = {Thermodynamic effects in a gas modulated Invar-based dual Fabry–P{\'e}rot cavity refractometer}, journal = {Metrologia}, year = {2022}, month = {4}, day = {14}, volume = {59}, number = {3}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {035003}, keywords = {quantumpascal, GAMOR, optical pressure standard, gas refractometry, pV-work, Invar-based}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac5ef9}, stag_bib_extends_levelofaccess = {NA}, author = {Rubin, T. and Silander, I. and Zakrisson, J. and Hao, M. and Forss{\'e}n, C. and Asbahr, P. and Bernien, M. and Kussicke, A. and Liu, K. and Zelan, M. and Axner, O.} } @Article { UrbanA2022, subid = {2687}, title = {Dynamic Measurement of Specific Heat Above 1000 K}, journal = {International Journal of Thermophysics}, year = {2022}, month = {3}, day = {19}, volume = {43}, number = {5}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Specific heat, High-temperature, Hi-Trace, Induction heating, Uncertainty}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-022-03005-0}, stag_bib_extends_levelofaccess = {NA}, author = {Urban , D. and Anhalt, K.} } @Article { KronerABBBCPSSUW2022, subid = {2643}, title = {Evaluation of the measurement performance of water meters depending on water quality}, journal = {Water Supply}, year = {2022}, month = {3}, day = {14}, number2 = {17IND13: Metrowamet: Metrology for real-world domestic water metering}, keywords = {cold water meters, test regime, water quality, water meter accuracy}, misc2 = {EMPIR 2017: Industry}, publisher = {IWA Publishing}, language = {30}, ISSN = {1606-9749, 1607-0798}, DOI = {10.2166/ws.2022.133}, stag_bib_extends_levelofaccess = {NA}, author = {Kroner, C. and Akselli, B. and Benkova, M. and Borchling, A. and B{\"u}ker, O. and Christoffersen, N. and Pavlas, J. and Schumann, D. and Seypka, V. and Unsal, B. and Warnecke, H.} } @Article { MarlettoVKPBRAGDG2022, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2020: Industry}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { MarlettoVKPBRAGDG20220, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { MarlettoVKPBRAGDG20221, subid = {2679}, title = {Emergence of Constructor-Based Irreversibility in Quantum Systems: Theory and Experiment}, journal = {Physical Review Letters}, year = {2022}, month = {2}, day = {23}, volume = {128}, number = {8}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {080401}, keywords = {Quantum Foundations, Quantum Measurements, Quantum thermodynamics}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401}, misc2 = {EMPIR 2020: Fundamental}, publisher = {American Physical Society (APS)}, address = {Ridge, NY, United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.128.080401}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Knoll, L.T. and Piacentini, F. and Bernardi, E. and Rebufello, E. and Avella, A. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { AguirreSM2022, subid = {2580}, title = {SPICE Implementation of the Dynamic Memdiode Model for Bipolar Resistive Switching Devices}, journal = {Micromachines}, year = {2022}, month = {2}, day = {19}, volume = {13}, number = {2}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {330}, keywords = {memristor; resistive switching; memory; memdiode}, web_url = {https://doi.org/10.3390/mi13020330}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-666X}, DOI = {10.3390/mi13020330}, stag_bib_extends_levelofaccess = {NA}, author = {Aguirre, F.L. and Su{\~n}{\'e}, J. and Miranda, E.} } @Article { ForssenSZZA2022, subid = {2600}, title = {An optical pascal in Sweden}, journal = {Journal of Optics}, year = {2022}, month = {2}, day = {17}, volume = {24}, number = {3}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {033002}, keywords = {optical, pascal, Sweden, refractometry, pressure, Fabry–Perot}, web_url = {https://iopscience.iop.org/article/10.1088/2040-8986/ac4ea2}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {2040-8978, 2040-8986}, DOI = {10.1088/2040-8986/ac4ea2}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Article { XuZAPB2022, subid = {2576}, title = {Using a Tip Characterizer to Investigate Microprobe Silicon Tip Geometry Variation in Roughness Measurements}, journal = {Sensors}, year = {2022}, month = {2}, volume = {22}, number = {3}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, pages = {1298}, keywords = {roughness measurement, piezoresistive microprobe, silicon fracture, tip characterization}, web_url = {https://www.mdpi.com/1424-8220/22/3/1298}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s22031298}, stag_bib_extends_levelofaccess = {NA}, author = {XU, M. and Zhou, Z. and Ahbe, T. and Peiner, E. and Brand, U.} } @Article { ArrheniusFB2022, subid = {2685}, title = {Sampling methods for renewable gases and related gases: challenges and current limitations}, journal = {Analytical and bioanalytical chemistry}, year = {2022}, month = {2}, number2 = {20IND10: Decarb: Metrology for decarbonising the gas grid}, keywords = {Material compatibility, Renewable gases, Sampling}, misc2 = {EMPIR 2020: Industry}, publisher = {Springer}, language = {30}, DOI = {10.1007/s00216-022-03949-0}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Francini, L. and B{\"u}ker, O.} } @Article { GuilloryTWA2022, subid = {2169}, title = {Absolute multilateration-based coordinate measurement system using retroreflecting glass spheres}, journal = {Precision Engineering}, year = {2022}, month = {1}, volume = {73}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {214-227}, keywords = {Large volume metrologyAbsolute distance metreRetroreflecting glass spheresCoordinate measurement systemMultilateration technique with self-calibration}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2021.09.009}, stag_bib_extends_levelofaccess = {NA}, author = {Guillory, J. and Truong, D. and Wallerand, J.-P. and Alexandre, C.} } @Article { GuilloryTWA2022_2, subid = {2172}, title = {Absolute multilateration-based coordinate measurement system using retroreflecting glass spheres}, journal = {Precision Engineering}, year = {2022}, month = {1}, volume = {73}, number2 = {17IND03: LaVA: Large Volume Metrology Applications}, pages = {214-227}, keywords = {Large Volume Metrology; Absolute Distance Metre; retroreflecting glass spheres; coordinate measurementsystem; multilateration technique with self-calibration.}, web_url = {https://hal.archives-ouvertes.fr/hal-03349168v1}, misc2 = {EMPIR 2017: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2021.09.009}, stag_bib_extends_levelofaccess = {NA}, author = {Guillory, J. and Truong, D. and Wallerand, J-P. and Alexandre, C.} } @Article { MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022, subid = {2764}, title = {Versailles project on advanced materials and standards (VAMAS) interlaboratory study on measuring the number concentration of colloidal gold nanoparticles}, journal = {Nanoscale}, year = {2022}, volume = {14}, number = {12}, number2 = {18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration}, pages = {4690-4704}, keywords = {nanoparticle, concentration, standardization, VAMAS, interlaboratory}, misc2 = {EMPIR 2018: Support for Impact}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/D1NR07775A}, stag_bib_extends_levelofaccess = {NA}, author = {Minelli, C. and Wywijas, M. and Bartczak, D. and Cuello-Nu{\~n}ez, S. and Infante, H.G. and Deumer, J. and Gollwitzer, C. and Krumrey, M. and Murphy, K.E. and Johnson, M.E. and Montoro Bustos, A.R. and Strenge, I.H. and Faure, B. and H{\o}gh{\o}j, P. and Tong, V. and Burr, L. and Norling, K. and H{\"o}{\"o}k, F. and Roesslein, M. and Kocic, J. and Hendriks, L. and Kestens, V. and Ramaye, Y. and Contreras Lopez, M.C. and Auclair, G. and Mehn, D. and Gilliland, D. and Potthoff, A. and Oelschl{\"a}gel, K. and Tentschert, J. and Jungnickel, H. and Krause, B.C. and Hachenberger, Y.U. and Reichardt, P. and Luch, A. and Whittaker, T.E. and Stevens, M.M. and Gupta, S. and Singh, A. and Lin, F-h. and Liu, Y-H. and Costa, A.L. and Baldisserri, C. and Jawad, R. and Andaloussi, S.E.L. and Holme, M.N. and Lee, T.G. and Kwak, M. and Kim, J. and Ziebel, J. and Guignard, C. and Cambier, S. and Contal, S. and Gutleb, A.C. and “Kuba” Tatarkiewicz, J. and Jankiewicz, B.J. and Bartosewicz, B. and Wu, X. and Fagan, J.A. and Elje, E. and Rund{\'e}n-Pran, E. and Dusinska, M. and Kaur, I.P. and Price, D. and Nesbitt, I. and O\(\prime\) Reilly, S. and Peters, R.J.B. and Bucher, G. and Coleman, D. and Harrison, A.J. and Ghanem, A. and Gering, A. and McCarron, E. and Fitzgerald, N. and Cornelis, G. and Tuoriniemi, J. and Sakai, M. and Tsuchida, H. and Maguire, C. and Prina-Mello, A. and Lawlor, A.J. and Adams, J. and Schultz, C.L. and Constantin, D. and Thanh, N.T.K. and Tung, L.D. and Panariello, L. and Damilos, S. and Gavriilidis, A. and Lynch, I. and Fryer, B. and Carrazco Quevedo, A. and Guggenheim, E. and Briffa, S. and Valsami-Jones, E. and Huang, Y. and Keller, A.A. and Kinnunen, V-T. and Per{\"a}m{\"a}ki, S. and Krpetic, Z. and Greenwood, M. and Shard, A.G.} } @Article { ArrheniusBSCGBB2021, subid = {2487}, title = {Detection of Contaminants in Hydrogen Fuel for Fuel Cell Electrical Vehicles with Sensors—Available Technology, Testing Protocols and Implementation Challenges}, journal = {Processes}, year = {2021}, month = {12}, day = {24}, volume = {10}, number = {1}, number2 = {19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2}, pages = {20}, keywords = {sensors, hydrogen quality, FCEV, testing protocols}, misc2 = {EMPIR 2019: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2227-9717}, DOI = {10.3390/pr10010020}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Bacquart, T. and Schr{\"o}ter, K. and Carr{\'e}, M. and Gozlan, B. and Beurey, C. and Blondeel, C.} } @Article { MiloroABBZFR2021, subid = {2444}, title = {A standard test phantom for the performance assessment of magnetic resonance guided high intensity focused ultrasound (MRgHIFU) thermal therapy devices}, journal = {International Journal of Hyperthermia}, year = {2021}, month = {12}, day = {22}, volume = {39}, number = {1}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {57-68}, keywords = {HIFU; thermal ablation; quality control; phantom; thermal dosimetry}, web_url = {https://www.tandfonline.com/doi/full/10.1080/02656736.2021.2017023}, misc2 = {EMPIR 2018: Health}, publisher = {Informa UK Limited}, language = {30}, ISSN = {0265-6736, 1464-5157}, DOI = {10.1080/02656736.2021.2017023}, stag_bib_extends_levelofaccess = {NA}, author = {Miloro, P and Ambrogio, S. and Bosio, F. and Ba{\^e}sso, R.M. and Zeqiri, B. and Fedele, F. and Ramnarine, K.V.} } @Article { WooldridgeAZZCCB2021, subid = {2546}, title = {Gradient coil and radiofrequency induced heating of orthopaedic implants in MRI: influencing factors}, journal = {Physics in Medicine \& Biology}, year = {2021}, month = {12}, day = {21}, volume = {66}, number = {24}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {245024}, keywords = {MRI; finite element modelling; implant heating}, web_url = {https://iopscience.iop.org/article/10.1088/1361-6560/ac3eab}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/1361-6560/ac3eab}, stag_bib_extends_levelofaccess = {NA}, author = {Wooldridge, J. and Arduino, A. and Zilberti, L. and Zanovello, U. and Chiampi, M. and Clementi, V. and Bottauscio, O.} } @Article { ForssenSZZA2021, subid = {2351}, title = {Fabry–Perot-cavity-based refractometry without influence of mirror penetration depth}, journal = {Journal of Vacuum Science \& Technology B}, year = {2021}, month = {12}, volume = {39}, number = {6}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {065001}, keywords = {Refractometry, Fabry-Perot cavity, Penetration depth}, web_url = {https://avs.scitation.org/doi/10.1116/6.0001501}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/6.0001501}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Article { DizdarAV2021, subid = {2673}, title = {Establishment of continuous force calibration system at TUBITAK UME force laboratory in Turkey}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18SIB08: ComTraForce: Comprehensive traceability for force metrology services}, pages = {100216}, keywords = {Piezoelectric force sensor; Continuous force calibration}, web_url = {https://www.sciencedirect.com/science/article/pii/S2665917421001793}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100216}, stag_bib_extends_levelofaccess = {NA}, author = {Dizdar, H. and Aydemir, B. and Vatan, C.} } @Article { ZelenkaAHKPZM2021, subid = {2205}, title = {Why and how to improve the subdivision technique in mass metrology}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {19RPT02: RealMass: Improvement of the realisation of the mass scale}, pages = {100228}, keywords = {Mass scale, Weights, Kilogram, Multiples and submultiples, Subdivision, OIML R111}, misc2 = {EMPIR 2019: Research Potential}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100228}, stag_bib_extends_levelofaccess = {NA}, author = {Zelenka, Z. and Alisic, S. and Hanrahan, R. and Kolozinsky, I. and Popa, G. and Zůda, J. and Malengo, A.} } @Article { LieberherrACCCGKMMMOSSTV2021, subid = {2368}, title = {Assessment of real-time bioaerosol particle counters using reference chamber experiments}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {12}, volume = {14}, number = {12}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {7693-7706}, keywords = {bioaerosol monitors, calibration, counting efficiency, fluorescence}, web_url = {https://amt.copernicus.org/articles/14/7693/2021/}, misc2 = {EMPIR 2019: Environment}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-14-7693-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Lieberherr, G. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Gysel-Beer, M. and Konzelmann, T. and Manzano, J. and Mihajlovic, A. and Moallemi, A. and O'Connor, D. and Sikoparija, B. and Sauvageat , E. and Tummon, F. and Vasilatou, K.} } @Article { BatistaFFGAAM2021, subid = {2277}, title = {Uncertainty calculations in optical methods used for micro flow measurement}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {100155}, keywords = {MicroflowFront trackingMethodPending drop methodMeasurement uncertainty}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100155}, stag_bib_extends_levelofaccess = {NA}, author = {Batista, E. and Furtado, A. and Ferreira, M. do C. and Godinho, I. and Alvares, M. and Afonso, J. and Martins, R.F.} } @Article { BatistaSAAM2021, subid = {2276}, title = {Development of an experimental setup for micro flow measurement using the front tracking method}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {100152}, keywords = {Microflow measurementFront trackingCalibrationMeasurement uncertainty}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100152}, stag_bib_extends_levelofaccess = {NA}, author = {Batista, E. and Sousa, J.A. and Alvares, M. and Afonso, J. and Martins, R.F.} } @Article { AssoulineJBWTJGKRPR2021, subid = {2371}, title = {Excitonic nature of magnons in a quantum Hall ferromagnet}, journal = {Nature Physics}, year = {2021}, month = {12}, volume = {17}, number = {12}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {1369-1374}, keywords = {Graphene, mangons, interferometry, p-n-junction}, web_url = {https://arxiv.org/abs/2102.02068}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-021-01411-z}, stag_bib_extends_levelofaccess = {NA}, author = {Assouline, A. and Jo, M. and Brasseur, P. and Watanabe, K. and Taniguchi, T. and Jolicoeur, Th. and Glattli, D.C. and Kumada, N. and Roche, P. and Parmentier, F.D. and Roulleau, P.} } @Article { OgrincRDBMBKOAGQMUOG2021, subid = {2701}, title = {Support for a European metrology network on food safety Food-MetNet}, journal = {Measurement: Sensors}, year = {2021}, month = {12}, volume = {18}, number2 = {20NET02: Food-MetNet: Support for a European Metrology Network on Food Safety}, pages = {100285}, keywords = {Food; Metrology; Network; Safety; Stakeholders}, misc2 = {EMPIR 2020: Support for Networks}, publisher = {Elsevier BV}, language = {30}, ISSN = {2665-9174}, DOI = {10.1016/j.measen.2021.100285}, stag_bib_extends_levelofaccess = {NA}, author = {Ogrinc, N. and Rossi, A.M. and Durbiano, F. and Becker, R. and Milavec, M. and Bogožalec Košir, A. and Kakoulides, E. and Ozer, H. and Ak\c{c}adag, F. and Goenaga-Infante, H. and Quaglia, M. and Mallia, S. and Umbricht, G. and O'Connor, G. and Guettler, B.} } @Article { RottgerVSPDISBAGGBWPiN2021, subid = {2317}, title = {Metrology for radiation protection: a new European network in the foundation phase}, journal = {Advances in Geosciences}, year = {2021}, month = {11}, day = {17}, volume = {57}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, pages = {1-7}, keywords = {supportBSS, EMN for Radiation Protection, metrology, regulation, EURAMET, EURATOM}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7359}, DOI = {10.5194/adgeo-57-1-2021}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and Veres, A. and Sochor, V. and Pinto, M. and Derlacinski, M. and Ioan, M-R. and Sabeta, A. and Bernat, R. and Adam-Guillermin, C. and Gracia Alves, J.H. and Glavič-Cindro, D. and Bell, S. and Wens, B. and Persson, L. and Živanović, M. and Nylund, R.} } @Article { RiemannAEBMSSRIF2021, subid = {2569}, title = {Assessment of measurement precision in single‐voxel spectroscopy at 7 T: Toward minimal detectable changes of metabolite concentrations in the human brain in vivo}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {11}, day = {16}, volume = {87}, number = {3}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {1119-1135}, keywords = {CRLBs, measurement precision, minimal detectable change, MR spectroscopy, reproducibility/repeatability, SPECIAL}, web_url = {https://onlinelibrary.wiley.com/doi/10.1002/mrm.29034}, misc2 = {EMPIR 2018: Health}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.29034}, stag_bib_extends_levelofaccess = {NA}, author = {Riemann, L.T. and Aigner, C.S. and Ellison, S.L.R. and Br{\"u}hl, R. and Mekle, R. and Schmitter, S. and Speck, O. and Rose, G. and Ittermann, B. and Fillmer, A.} } @Article { RagusaAFd2021, subid = {2397}, title = {Anisotropy of losses in grain-oriented Fe–Si}, journal = {AIP Advances}, year = {2021}, month = {11}, volume = {11}, number = {11}, number2 = {19ENG06: HEFMAG: Metrology of magnetic losses in electrical steel sheets for high-efficiency energy conversion}, pages = {115208}, keywords = {Magnetic hysteresis,Magnetic properties,Electrical grid,Magnetization dynamics,Eddy current,Magnetic materials,Magneto-optical imaging,Transformer Ferromagnetic materials}, misc2 = {EMPIR 2019: Energy}, publisher = {AIP}, address = {College Park, Maryland}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/5.0066131}, stag_bib_extends_levelofaccess = {NA}, author = {Ragusa, C. and Appino, C. and Ferrara, E. and de la Barri{\`e}re, O.} } @Article { HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021, subid = {2336}, title = {Frequency drift in MR spectroscopy at 3T}, journal = {NeuroImage}, year = {2021}, month = {11}, volume = {241}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, pages = {118430}, keywords = {Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1053-8119}, DOI = {10.1016/j.neuroimage.2021.118430}, stag_bib_extends_levelofaccess = {NA}, author = {Hui, S.C.N. and Mikkelsen, M. and Z{\"o}llner, H.J. and Ahluwalia, V. and Alcauter, S. and Baltusis, L. and Barany, D.A. and Barlow, L.R. and Becker, R. and Berman, J.I. and Berrington, A. and Bhattacharyya, P.K. and Blicher, J.U. and Bogner, W. and Brown, M.S. and Calhoun, V.D. and Castillo, R. and Cecil, K.M. and Choi, Y.B. and Chu, W.C.W. and Clarke, W.T. and Craven, A.R. and Cuypers, K. and Dacko, M. and de la Fuente-Sandoval, C. and Desmond, P. and Domagalik, A. and Dumont, J. and Duncan, N.W. and Dydak, U. and Dyke, K. and Edmondson, D.A. and Ende, G. and Ersland, L. and Evans, C.J. and Fermin, A.S.R. and Ferretti, A. and Fillmer, A. and Gong, T. and Greenhouse, I. and Grist, J.T. and Gu, M. and Harris, A.D. and Hat, K. and Heba, S. and Heckova, E. and Hegarty, J.P. and Heise, K-F. and Honda, S. and Jacobson, A. and Jansen, J.F.A. and Jenkins, C.W. and Johnston, S.J. and Juchem, C. and Kangarlu, A. and Kerr, A.B. and Landheer, K. and Lange, T. and Lee, P. and Levendovszky, S.R. and Limperopoulos, C. and Liu, F. and Lloyd, W. and Lythgoe, D.J. and Machizawa, M.G. and MacMillan, E.L. and Maddock, R.J. and Manzhurtsev, A.V. and Martinez-Gudino, M.L. and Miller, J.J. and Mirzakhanian, H. and Moreno-Ortega, M. and Mullins, P.G. and Nakajima, S. and Near, J. and Noeske, R. and Nordh{\o}y, W. and Oeltzschner, G. and Osorio-Duran, R. and Otaduy, M.C.G. and Pasaye, E.H. and Peeters, R. and Peltier, S.J. and Pilatus, U. and Polomac, N. and Porges, E.C. and Pradhan, S. and Prisciandaro, J.J. and Puts, N.A. and Rae, C.D. and Reyes-Madrigal, F. and Roberts, T.P.L. and Robertson, C.E. and Rosenberg, J.T. and Rotaru, D-G. and O'Gorman Tuura, R.L. and Saleh, M.G. and Sandberg, K. and Sangill, R. and Schembri, K. and Schrantee, A. and Semenova, N.A. and Singel, D. and Sitnikov, R. and Smith, J. and Song, Y. and Stark, C. and Stoffers, D. and Swinnen, S.P. and Tain, R. and Tanase, C. and Tapper, S. and Tegenthoff, M. and Thiel, T. and Thioux, M. and Truong, P. and van Dijk, P. and Vella, N. and Vidyasagar, R. and Vovk, A. and Wang, G. and Westlye, L.T. and Wilbur, T.K. and Willoughby, W.R. and Wilson, M. and Wittsack, H-J. and Woods, A.J. and Wu, Y-C. and Xu, J. and Lopez, M.Y. and Yeung, D.K.W. and Zhao, Q. and Zhou, X. and Zupan, G. and Edden, R.A.E.} } @Article { DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021, subid = {2365}, title = {A Comprehensive Description of Multi-Term LSM for Applying Multiple a Priori Constraints in Problems of Atmospheric Remote Sensing: GRASP Algorithm, Concept, and Applications}, journal = {Frontiers in Remote Sensing}, year = {2021}, month = {10}, day = {19}, volume = {2}, number2 = {19ENV04: MAPP: Metrology for aerosol optical properties}, keywords = {GRASP, Radiative Transfer, Inversion model}, web_url = {https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full}, misc2 = {EMPIR 2019: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-6187}, DOI = {10.3389/frsen.2021.706851}, stag_bib_extends_levelofaccess = {NA}, author = {Dubovik, O. and Fuertes, D. and Litvinov, P. and Lopatin, A. and Lapyonok, T. and Doubovik, I. and Xu, F. and Ducos, F. and Chen, C. and Torres, B. and Derimian, Y. and Li, L. and Herreras-Giralda, M. and Herrera, M. and Karol, Y. and Matar, C. and Schuster, G.L. and Espinosa, R. and Puthukkudy, A. and Li, Z. and Fischer, J. and Preusker, R. and Cuesta, J. and Kreuter, A. and Cede, A. and Aspetsberger, M. and Marth, D. and Bindreiter, L. and Hangler, A. and Lanzinger, V. and Holter, C. and Federspiel, C.} } @Article { ArrheniusABMBWBGLCSBNR2021, subid = {2482}, title = {Strategies for the sampling of hydrogen at refuelling stations for purity assessment}, journal = {International Journal of Hydrogen Energy}, year = {2021}, month = {10}, day = {11}, volume = {46}, number = {70}, number2 = {19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2}, pages = {34839-34853}, keywords = {Hydrogen,Refuelling stations,Sampling device,Fuel quality assessment}, web_url = {https://www.sciencedirect.com/science/article/pii/S0360319921031694}, misc2 = {EMPIR 2019: Energy}, publisher = {Elsevier}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2021.08.043}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Aarhaug, T.A. and Bacquart, T. and Morris, A. and Bartlett, S. and Wagner, L. and Blondeel, C. and Gozlan, B. and Lescornes, Y. and Chramosta, N. and Spitta, C. and Basset, E. and Nouvelot, Q. and Rizand, M.} } @Article { FrigoA2021, subid = {2322}, title = {Calibration of a Digital Current Transformer Measuring Bridge: Metrological Challenges and Uncertainty Contributions}, journal = {Metrology}, year = {2021}, month = {10}, volume = {1}, number = {2}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {93-106}, keywords = {measuring bridge; calibration; non-conventional instrument transformer; sampled values;digital output; synchronization}, web_url = {https://www.mdpi.com/2673-8244/1/2/7}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, address = {Basel, Switzerland}, language = {30}, ISSN = {2673-8244}, DOI = {10.3390/metrology1020007}, stag_bib_extends_levelofaccess = {NA}, author = {Frigo, G. and Agustoni, M.} } @Article { SteindlSABK2021, subid = {2345}, title = {On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001)}, journal = {New Journal of Physics}, year = {2021}, month = {10}, volume = {23}, number = {10}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {103029}, keywords = {Quantum Dots, carrier dynamics, optical spectroscopy, memory devices}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac2bd6}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { SteindlSABK20210, subid = {2345}, title = {On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001)}, journal = {New Journal of Physics}, year = {2021}, month = {10}, volume = {23}, number = {10}, number2 = {20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology}, pages = {103029}, keywords = {Quantum Dots, carrier dynamics, optical spectroscopy, memory devices}, misc2 = {EMPIR 2020: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac2bd6}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { SteindlSABK20211, subid = {2345}, title = {On the importance of antimony for temporal evolution of emission from self-assembled (InGa) (AsSb)/GaAs quantum dots on GaP(001)}, journal = {New Journal of Physics}, year = {2021}, month = {10}, volume = {23}, number = {10}, number2 = {20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology}, pages = {103029}, keywords = {Quantum Dots, carrier dynamics, optical spectroscopy, memory devices}, misc2 = {EMPIR 2020: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ac2bd6}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { CorderoVALPP2021, subid = {2259}, title = {Equivalence regimes for geometric quantum discord and local quantum uncertainty}, journal = {Phys. Rev. A}, year = {2021}, month = {10}, volume = {104}, number = {4}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {042401}, keywords = {Quantum Optics, non-classical correlations, quantum metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {2469-9934}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/2107.14265}, author = {Cordero, O. and Villegas, A. and Alvarez, J.R. and Leon Montiel, R. de J. and Passos, M.H.M. and P. Torres, Juan} } @Article { AguirrePPMSM2021, subid = {2451}, title = {Assessment and Improvement of the Pattern Recognition Performance of Memdiode-Based Cross-Point Arrays with Randomly Distributed Stuck-at-Faults}, journal = {Electronics}, year = {2021}, month = {10}, volume = {10}, number = {19}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {2427}, keywords = {stuck-at fault; RRAM; pattern recognition; memristor; QMM; neural network; neuromorphics}, web_url = {https://www.mdpi.com/2079-9292/10/19/2427}, misc2 = {EMPIR 2020: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2079-9292}, DOI = {10.3390/electronics10192427}, stag_bib_extends_levelofaccess = {NA}, author = {Aguirre, F.L. and Pazos, S.M. and Palumbo, F. and Morell, A. and Su{\~n}{\'e}, J. and Miranda, E.} } @Article { RottgerRGVCOHCCBIRKCAYFMM2021, subid = {2224}, title = {New metrology for radon at the environmental level}, journal = {Measurement Science and Technology}, year = {2021}, month = {9}, day = {23}, number2 = {19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level}, keywords = {radon, metrology, tracer, environmental measurements}, misc2 = {EMPIR 2019: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac298d}, stag_bib_extends_levelofaccess = {NA}, author = {R{\"o}ttger, A. and R{\"o}ttger, S. and Grossi, C. and Vargas, A. and Curcoll, R. and Ot{\'a}hal, P. and Hern{\'a}ndez-Ceballos, M.{\'A}. and Cinelli, G. and Chambers, S. and Barbosa, S.A. and Ioan, M-R. and Radulescu, I. and Kikaj, D. and Chung, E. and Arnold, T. and Yver Kwok, C. and Fuente, M. and Mertes, F. and Morosh, V.} } @Article { AguirrePPSM2021, subid = {2450}, title = {SPICE Simulation of RRAM-Based Cross-Point Arrays Using the Dynamic Memdiode Model}, journal = {Frontiers in Physics}, year = {2021}, month = {9}, day = {23}, volume = {9}, number2 = {20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology}, pages = {735021}, keywords = {RRAM, resistive switching, cross-point, memristor, neuromorphic, pattern recognition, write-verify,frequency}, web_url = {https://www.frontiersin.org/articles/10.3389/fphy.2021.735021/full}, misc2 = {EMPIR 2020: Fundamental}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2021.735021}, stag_bib_extends_levelofaccess = {NA}, author = {Aguirre, F.L. and Pazos, S.M. and Palumbo, F. and Su{\~n}{\'e}, J. and Miranda, E.} } @Article { ForssenSZAZ2021, subid = {2174}, title = {The Short-Term Performances of Two Independent Gas Modulated Refractometers for Pressure Assessments}, journal = {Sensors}, year = {2021}, month = {9}, day = {18}, volume = {21}, number = {18}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {6272}, keywords = {refractometry,pressure, short-term performance,Fabry–Perot cavity, gas modulation, modulation techniques, metrology}, web_url = {https://www.mdpi.com/1424-8220/21/18/6272}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21186272}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Zakrisson, J. and Axner, O. and Zelan, M.} } @Article { ArduiniMSEH2021, subid = {2199}, title = {Development and Evaluation of an Improved Apparatus for Measuring the Emissivity at High Temperatures}, journal = {Sensors}, year = {2021}, month = {9}, day = {17}, volume = {21}, number = {18}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, pages = {6252}, keywords = {emissivity, reflectivity, infrared radiation, high temperature, FTIR-spectrometer, blackbody,uncertainty, X-point, inductive heating, direct radiative method}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21186252}, stag_bib_extends_levelofaccess = {NA}, author = {Arduini, M. and Manara, J. and Stark, T. and Ebert, H-P. and Hartmann, J.} } @Article { LainelaLHCACS2021, subid = {2180}, title = {Toward Unified pH of Saline Solutions}, journal = {Water}, year = {2021}, month = {9}, day = {15}, volume = {13}, number = {18}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {2522}, keywords = {acidity;seawater;pH scales; unified scaleabsolute pHdifferential potentiometric measurementsminimization of liquid junction potential ionic liquid salt bridgesresidual liquid junction potential}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4441}, DOI = {10.3390/w13182522}, stag_bib_extends_levelofaccess = {NA}, author = {Lainela, S. and Leito, I. and Heering, A. and Capitaine, G. and Anes, B. and Cam{\~o}es, F. and Stoica, D.} } @Article { LainelaLHCACS2021_2, subid = {2288}, title = {Toward Unified pH of Saline Solutions}, journal = {Water}, year = {2021}, month = {9}, day = {15}, volume = {13}, number = {18}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {2522}, keywords = {acidity; seawater; pH scales; unified scale; absolute pH; differential potentiometric measurements; minimization of liquid junction potential; ionic liquid salt bridges; residual liquid junction potential}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-4441}, DOI = {10.3390/w13182522}, stag_bib_extends_levelofaccess = {NA}, author = {Lainela, S. and Leito, I. and Heering, A. and Capitaine, G. and Anes, B. and Cam{\~o}es, F. and Stoica, D.} } @Article { VasilatouWKHISSSWA2021, subid = {2082}, title = {Calibration of optical particle size spectrometers against a primary standard: Counting efficiency profile of the TSI Model 3330 OPS and Grimm 11-D monitor in the particle size range from 300 nm to 10 \(\mu\)m}, journal = {Journal of Aerosol Science}, year = {2021}, month = {9}, volume = {157}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {105818}, keywords = {calibration, aerosol spectrometers, PSL particles, primary standard, particle number concentration}, misc2 = {EMPIR 2019: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-8502}, DOI = {10.1016/j.jaerosci.2021.105818}, stag_bib_extends_levelofaccess = {NA}, author = {Vasilatou, K. and W{\"a}lchli, C. and Koust, S. and Horender, S. and Iida, K. and Sakurai, H. and Schneider, F. and Spielvogel, J. and Wu, T.Y. and Auderset, K.} } @Article { YamakawaATBFBKRD2021, subid = {2038}, title = {Hg isotopic composition of one-year-old spruce shoots: Application to long-term Hg atmospheric monitoring in Germany}, journal = {Chemosphere}, year = {2021}, month = {9}, volume = {279}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {130631}, keywords = {Hg isotopic composition, spruce shoots, Hg atmospheric monitoring}, misc2 = {EMPIR 2016: Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0045-6535}, DOI = {10.1016/j.chemosphere.2021.130631}, stag_bib_extends_levelofaccess = {NA}, author = {Yamakawa, A. and Amouroux, D. and Tessier, E. and B{\'e}rail, S. and Fettig, I. and Barre, J.P.G. and Koschorreck, J. and R{\"u}del, H. and Donard, O.F.X.} } @Article { AlegriaL2021, subid = {2166}, title = {Efficiency calculation by Monte Carlo simulation for the rapidly-deployable spectrometric air-sampling system (MARE)}, journal = {Journal of Instrumentation}, year = {2021}, month = {9}, volume = {16}, number = {09}, number2 = {16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident}, pages = {P09018}, keywords = {Radiation monitoring; Real-time monitoring; Spectrometers; Scintillators and scintillatingfibres and light guides}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, language = {30}, ISSN = {1748-0221}, DOI = {10.1088/1748-0221/16/09/P09018}, stag_bib_extends_levelofaccess = {NA}, author = {Alegria, N. and Legarda, F.} } @Article { FerreroBCVHYACMT2021, subid = {2146}, title = {Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes}, journal = {Nanomaterials}, year = {2021}, month = {8}, day = {25}, volume = {11}, number = {9}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {2179}, keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI}, language = {30}, ISSN = {2079-4991}, DOI = {10.3390/nano11092179}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Barrera, G. and Celegato, F. and Vicentini, M. and H{\"u}seyin, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.} } @Article { SteenekenDDAv2021, subid = {2239}, title = {Dynamics of 2D material membranes}, journal = {2D Materials}, year = {2021}, month = {8}, day = {12}, volume = {8}, number = {4}, number2 = {17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry}, pages = {042001}, keywords = {2D material, dynamics, mechanics, graphene, NEMS}, web_url = {https://arxiv.org/ct?url=https\%3A\%2F\%2Fdx.doi.org\%2F10.1088\%2F2053-1583\%2Fac152c\&v=8246bcbf}, misc2 = {EMPIR 2017: Fundamental}, publisher = {IOP Publishing}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/ac152c}, stag_bib_extends_levelofaccess = {NA}, author = {Steeneken, P.G. and Dolleman, R.J. and Davidovikj, D. and Alijani, F. and van der Zant, H.S.J.} } @Article { AhlawatSGTW2021, subid = {2479}, title = {Observation of systematic deviations between Faraday cup aerosol electrometers for varying particle sizes and flowrates—results of the AEROMET FCAE workshop}, journal = {Metrologia}, year = {2021}, month = {8}, day = {5}, volume = {58}, number = {5}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {8}, keywords = {Faraday cup aerosol electrometer, CPC calibration, inter-comparison}, web_url = {https://iopscience.iop.org/journal/0026-1394}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/1681-7575/ac0710}, stag_bib_extends_levelofaccess = {NA}, author = {Ahlawat, A. and Seeger, S. and Gottschalk, M. and Tuch, T. and Wiedensohler, A.} } @Article { EdlerBGJTAASZ2021, subid = {2137}, title = {Pt-40\%Rh Versus Pt-6\%Rh Thermocouples: An emf-Temperature Reference Function for the Temperature Range 0 \(^{\circ}\)C to 1769 \(^{\circ}\)C}, journal = {International Journal of Thermophysics}, year = {2021}, month = {8}, volume = {42}, number = {11}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {1-13}, keywords = {Noble metal thermocouples, Reference function, Thermoelectric stability and homogeneity}, web_url = {https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf.}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-021-02895-w}, stag_bib_extends_levelofaccess = {NA}, author = {Edler, F. and Bojkovski, J. and Garcia Izquerdo, C. and Jose Martin, M. and Tucker, D. and Arifovic, N. and Andersen, S.L. and Šindel{\'a}rov{\'a}, L. and Žužek, V.} } @Article { RadtkeCKLSDAHNVRQLDBUL2021, subid = {2285}, title = {A unified pH scale for all solvents: part I – intention and reasoning (IUPAC Technical Report)}, journal = {Pure and Applied Chemistry}, year = {2021}, month = {7}, day = {30}, volume = {93}, number = {9}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1049-1060}, keywords = {Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {0033-4545, 1365-3075}, DOI = {10.1515/pac-2019-0504}, stag_bib_extends_levelofaccess = {NA}, author = {Radtke, V. and Cam{\~o}es, F. and Krossing, I. and Leito, I. and Stoica, D. and Deleebeeck, L. and Anes, B. and Heering, A. and N{\"a}ykki, T. and Veltz{\'e}, S. and Rozikov{\'a}, M. and Quendera, R. and Liv, L. and D{\'a}niel, N. and Bastkowski, F. and Uysal, E. and Lawrence, N.} } @Article { RibeiroACSMLBSS2021, subid = {2198}, title = {Role of measurement uncertainty in the comparison of average areal rainfall methods}, journal = {Metrologia}, year = {2021}, month = {7}, day = {23}, volume = {58}, number = {4}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, pages = {044001}, keywords = {measurement uncertainty, rainfall, precipitation, estimating, arithmetic mean method, Thiessen polygon method, isohyetal method}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IOP Publishing}, address = {Bristol, United Kingdom}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ac0d49}, stag_bib_extends_levelofaccess = {NA}, author = {Ribeiro, A.S. and Almeida, M.C. and Cox, M.G. and Sousa, J.A. and Martins, L. and Loureiro, D. and Brito, R. and Silva, M. and Soares, A.C.} } @Article { tenHaveAHPMSL2021, subid = {2120}, title = {Estimation of Static Energy Meter Interference in Waveforms Obtained in On-Site Scenarios}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2021}, month = {7}, day = {12}, volume = {1}, number = {1}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {1-8}, keywords = {Electromagnetic interference (EMI), nonlinear waveforms, on-site survey, static energy meters, time domain.}, tags = {SEG}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2021.3089877}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Azpurua, M.A. and Hartman, T. and Pous, M. and Moonen, N. and Silva, F. and Leferink, F.} } @Article { SilanderFZZA2021, subid = {2110}, title = {Optical realization of the pascal—Characterization of two gas modulated refractometers}, journal = {Journal of Vacuum Science \& Technology B}, year = {2021}, month = {7}, volume = {39}, number = {4}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {044201}, keywords = {Refractomtery, Fabry-Perot cavity, GAMOR, Accuracy}, web_url = {https://avs.scitation.org/doi/10.1116/6.0001042}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/6.0001042}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Article { AxnerFSZZ2021, subid = {2135}, title = {Ability of gas modulation to reduce the pickup of drifts in refractometry}, journal = {Journal of the Optical Society of America B}, year = {2021}, month = {7}, volume = {38}, number = {8}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {2419-2436}, keywords = {Refractometry, Pascal, Pressure, Fabry-Perot cavity, Gas modulation, GAMOR, drifts,}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society of America}, language = {30}, ISSN = {0740-3224, 1520-8540}, DOI = {10.1364/JOSAB.420982}, stag_bib_extends_levelofaccess = {NA}, author = {Axner, O. and Forss{\'e}n, C. and Silander, I. and Zakrisson, J. and Zelan, M.} } @Article { CrouzierDDASH2021, subid = {2045}, title = {Influence of electron landing energy on the measurement of the dimensional properties of nanoparticle populations imaged by SEM}, journal = {Ultramicroscopy}, year = {2021}, month = {7}, volume = {226}, number = {July}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {113300}, keywords = {SEMElectron landing energyNanoparticlesDimensional propertiesMetrology}, web_url = {https://reader.elsevier.com/reader/sd/pii/S0304399121000875?token=909C79CE3C3F38B3A66DB9C19F03753326F07A8C27AA6D2752B29C970B6044F466C12F79E394D396CE7598E6F1497E2E\&originRegion=eu-west-1\&originCreation=20210517160957}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2021.113300}, stag_bib_extends_levelofaccess = {NA}, author = {Crouzier, L. and Delvall{\'e}e, A. and Devoille, L. and Artous, S. and Saint-Antonin, F. and Feltin, N.} } @Article { AmerWJA2021, subid = {2343}, title = {Evaluation of Shock Tube Retrofitted with Fast-Opening Valve for Dynamic Pressure Calibration}, journal = {Sensors}, year = {2021}, month = {6}, day = {29}, volume = {21}, number = {13}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {4470}, keywords = {dynamic pressure, shock tube, fast-opening valve, repeatability}, web_url = {https://www.mdpi.com/1424-8220/21/13/4470}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21134470}, stag_bib_extends_levelofaccess = {NA}, author = {Amer, E. and Wozniak, M. and J{\"o}nsson, G. and Arrh{\'e}n, F.} } @Article { PrzyklenkBOEYAFPZCMRB2021, subid = {2104}, title = {New European Metrology Network for Advanced Manufacturing}, journal = {Measurement Science and Technology}, year = {2021}, month = {6}, day = {21}, number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing}, keywords = {Advance Manufacturing, Metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), Stakeholder}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ac0d25}, stag_bib_extends_levelofaccess = {NA}, author = {Przyklenk, A. and Balsamo, A. and O'Connor, D. and Evans, A. and Yandayan, T. and Akg{\"o}z, A. and Flys, O. and Phillips, D. and Zelen{\'y}, V. and Czułek, D. and Meli, F. and Ragusa, C. and Bosse, H.} } @Proceedings { PrzyklenkBOEYAFZCPMRB2021, subid = {2123}, title = {AdvManuNet: Support for a European Metrology Network for Advanced Manufacturing}, journal = {Proceedings 21st euspen International Conference and Exhibition}, year = {2021}, month = {6}, volume = {2021}, number2 = {19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing}, keywords = {advanced manufacturing, metrology, European metrology networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0}, misc2 = {EMPIR 2019: Support for Networks}, event_place = {Online Conference}, event_name = {21st euspen International Conference and Exhibition}, event_date = {07-06-2021 to 10-06-2021}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.euspen.eu/knowledge-base//ICE21292.pdf}, author = {Przyklenk, A. and Balsamo, A. and O’Connor, D. and Evans, A. and Yandayan, T. and Akg{\"o}z, S. and Flys, O. and Zelen{\'y}, V. and Czułek, D. and Phillips, D. and Meli, F. and Ragusa, C. and Bosse, H.} } @Article { KhamlichiGOAR2021, subid = {2488}, title = {Error in the measurement of partial discharge pulses according to the frequency response of HFCT sensors}, journal = {2021 IEEE Electrical Insulation Conference (EIC)}, year = {2021}, month = {6}, volume = {.}, number = {.}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {.}, keywords = {sensor phenomena and characterization, performance evaluation, partial discharges, insulation testing,condition monitoring}, tags = {SEG}, web_url = {https://zenodo.org/record/5906679}, misc2 = {EMPIR 2019: Energy}, publisher = {IEEE}, language = {30}, ISSN = {2576-6791}, DOI = {10.1109/EIC49891.2021.9612353}, stag_bib_extends_levelofaccess = {NA}, author = {Khamlichi, A. and Garnacho, F. and Ortego, J. and Alvarez, F. and Rovira, J.} } @Proceedings { ArsovicMS2021, subid = {2610}, title = {An approach to improve accuracy and productivity of industrial CMM measurements at high scanning speed}, journal = {euspen’s 21st International Conference \& Exhibition, Copenhagen, DK, June 2021}, year = {2021}, month = {6}, number2 = {17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry}, keywords = {Coordinate measuring machine, measurement uncertainty, contact scanning probing mode}, web_url = {https://www.euspen.eu/knowledge-base/ICE21150.pdf}, misc2 = {EMPIR 2017: Pre-Co-Normative}, event_place = {Virtual Conference - Copenhagen, Denmark}, event_name = {euspen’s 21st International Conference \& Exhibition}, event_date = {07-06-2021 to 10-06-2021}, language = {30}, DOI = {10.5281/zenodo.6323538}, stag_bib_extends_levelofaccess = {NA}, author = {Arsovic, A. and Menoncin, M. and Savio, E.} } @Article { RebufelloPASGDCVDG2021, subid = {2446}, title = {Anomalous weak values via a single photon detection}, journal = {Light: Science \& Applications}, year = {2021}, month = {5}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Quantum Measurement, Weak Values, Single Photons, Quantum Metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2047-7538}, DOI = {10.1038/s41377-021-00539-0}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and Avella, A. and Souza, M.A. de and Gramegna, M. and Dziewior, J. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { XuLAP2021, subid = {2295}, title = {Non-reciprocity in optical fiber links: experimental evidence}, journal = {Journal of Lightwave Technology}, year = {2021}, month = {5}, day = {21}, volume = {39}, number = {10}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {3106-3111}, keywords = {Optical fiber link, ultrastable frequency transfer, two-way noise compensation, polarization mode dispersion, reciprocity, non-reciprocity.}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Paul-Eric Pottie}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.420661}, stag_bib_extends_levelofaccess = {NA}, author = {Xu, D. and Lopez, O. and Amy-Klein, A. and Pottie, P-E.} } @Article { XuLAP2021_2, subid = {2294}, title = {Polarization Scramblers to Solve Practical Limitations of Frequency Transfer}, journal = {Journal of Lightwave Technology}, year = {2021}, month = {5}, day = {15}, volume = {39}, number = {10}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {3106-3111}, keywords = {Optical fiber link, ultrastable frequency trans- fer, two-way noise compensation, polarization mode dispersion, polarization scrambler}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Paul-Eric Pottie}, language = {30}, ISSN = {0733-8724, 1558-2213}, DOI = {10.1109/JLT.2021.3057804}, stag_bib_extends_levelofaccess = {NA}, author = {Xu, D. and Lopez, O. and Amy-Klein, A. and Pottie, P-E.} } @Proceedings { PhungA2021_2, subid = {2287}, title = {Impact of Chuck Boundary Conditions on Wideband On-Wafer Measurements}, journal = {2021 IEEE 25th Workshop on Signal and Power Integrity (SPI)}, year = {2021}, month = {5}, day = {10}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1-4}, keywords = {coplanar waveguides, leakage, radiation, surface waves}, web_url = {https://oar.ptb.de/files/download/618907218e2a000011003f97}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Siegen, Germany}, event_name = {2021 IEEE 25th Workshop on Signal and Power Integrity (SPI)}, event_date = {10-05-2021 to 12-05-2021}, language = {30}, DOI = {10.1109/SPI52361.2021.9505192}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Arz, U.} } @Article { KazemipourHWHRSAGZ2021, subid = {2048}, title = {Standard Load Method: A New Calibration Technique for Material Characterization at Terahertz Frequencies}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, month = {5}, volume = {70}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1007310}, keywords = {Material characterization, measurement uncertainty, parameter extraction, standard load, vector network analyzer (VNA) time gating}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2021.3077660}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Hudlicka, M. and R{\"u}fenacht, J. and Stalder, D. and Allal, D. and G{\"a}umann, G. and Zeier, M.} } @Article { RebufelloPALVTGBCVDG2021, subid = {2447}, title = {Protective Measurement—A New Quantum Measurement Paradigm: Detailed Description of the First Realization}, journal = {Applied Sciences}, year = {2021}, month = {5}, volume = {11}, number = {9}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {4260}, keywords = {Quantum Measurement, Weak Measurement, Quantum Metrology, Single Photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11094260}, stag_bib_extends_levelofaccess = {NA}, author = {Rebufello, E. and Piacentini, F. and Avella, A. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { AxnerSFZZ2021, subid = {1990}, title = {Assessment of gas molar density by gas modulation refractometry: A review of its basic operating principles and extraordinary performance}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2021}, month = {5}, volume = {179}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {106121}, keywords = {Gas modulation refractometry (GAMOR)Fabry-Perot cavityPrecisionAccuracyGas molar (or number) density}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2021.106121}, stag_bib_extends_levelofaccess = {NA}, author = {Axner, O. and Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Zelan, M.} } @Article { NagelLASDL2021, subid = {2440}, title = {Non-Invasive and Quantitative Estimation of Left Atrial Fibrosis Based on P Waves of the 12-Lead ECG—A Large-Scale Computational Study Covering Anatomical Variability}, journal = {Journal of Clinical Medicine}, year = {2021}, month = {4}, day = {20}, volume = {10}, number = {8}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, keywords = {electrophysiological simulation, atrial cohort modeling, 12-lead ECG, P wave, atrial fibrosis, atrial fibrillation}, web_url = {https://www.mdpi.com/2077-0383/10/8/1797/htm}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI}, language = {30}, DOI = {10.3390/jcm10081797}, stag_bib_extends_levelofaccess = {NA}, author = {Nagel, C. and Luongo, G. and Azzolin, L. and Schuler, S. and D{\"o}ssel, O. and Loewe, A.} } @Article { Arduino2021, subid = {2004}, title = {EPTlib: An Open-Source Extensible Collection of Electric Properties Tomography Techniques}, journal = {Applied Sciences}, year = {2021}, month = {4}, number = {Latest Adv}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, keywords = {electric properties tomography; open-source software; magnetic resonance imaging; quantitative imaging}, misc2 = {EMPIR 2018: Health}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11073237}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A.} } @Article { ChaudharyMAOMPB2021, subid = {2656}, title = {Radiobiology Experiments With Ultra-high Dose Rate Laser-Driven Protons: Methodology and State-of-the-Art}, journal = {Frontiers in Physics}, year = {2021}, month = {4}, volume = {9}, number = {1}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, keywords = {protontherapy, cancer, radiobiology, laser-driven ions, particle accelerator, ultra-high dose rate}, misc2 = {EMPIR 2018: Health}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2296-424X}, DOI = {10.3389/fphy.2021.624963}, stag_bib_extends_levelofaccess = {NA}, author = {Chaudhary, P. and Milluzzo, G. and Ahmed, H. and Odlozilik, B. and McMurray, A. and Prise, K.M. and Borghesi, M.} } @Article { JoBAFSWTDRGKPR2021, subid = {2125}, title = {Quantum Hall Valley Splitters and a Tunable Mach-Zehnder Interferometer in Graphene}, journal = {Physical Review Letters}, year = {2021}, month = {4}, volume = {126}, number = {14}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {146803}, keywords = {Graphene, electron interferometer, Mach-Zehnder, Quantum Hall Valley Beam Splitter}, web_url = {https://arxiv.org/abs/2011.04958}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.146803}, stag_bib_extends_levelofaccess = {NA}, author = {Jo, M. and Brasseur, P. and Assouline, A. and Fleury, G. and Sim, H-S. and Watanabe, K. and Taniguchi, T. and Dumnernpanich, W. and Roche, P. and Glattli, D.C. and Kumada, N. and Parmentier, F.D. and Roulleau, P.} } @Article { GruberBALBPCPDTCFSQ2021, subid = {2028}, title = {Comparison of radon mapping methods for the delineation of radon priority areas – an exercise}, journal = {Journal of the European Radon Association}, year = {2021}, month = {3}, day = {31}, volume = {2}, number = {2021}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {1-14}, keywords = {radon, mapping, prediction, interpolation, radon priority areas, risk, hazard}, web_url = {https://radonjournal.net/index.php/radon/article/view/5755}, misc2 = {EMPIR 2016: Environment}, publisher = {European Radon Association}, language = {30}, ISSN = {2736-2272}, DOI = {10.35815/radon.v2.5755}, stag_bib_extends_levelofaccess = {NA}, author = {Gruber, V. and Baumann, S. and Alber, O. and Laubichler, C. and Bossew, P. and Petermann, E. and Ciotoli, G. and Pereira , A. and Domingos, F. and Tondeur, F. and Cinelli, G. and Fernandez , A. and Sainz, C. and Quindos-Poncela, L.} } @Article { PanuTTMAKF2021, subid = {2201}, title = {Real-time HCl gas detection at parts-per-billion level concentrations utilising a diode laser and a bismuth-doped fibre amplifier}, journal = {Measurement Science and Technology}, year = {2021}, month = {3}, day = {26}, volume = {32}, number = {5}, number2 = {17IND09: MetAMCII: Metrology for Airborne Molecular Contaminants II}, pages = {055206}, keywords = {gas sensing, photoacoustic spectroscopy, laser, bismuth, fibre, cleanroom}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/abd651}, stag_bib_extends_levelofaccess = {NA}, author = {Panu, H. and Timo, R. and Thomas, F. and Makkonen, J. and Alyshev, S. and Kharakhordin, A. and Firstov, S.} } @Article { SilvaniATC2021, subid = {2021}, title = {Effect of the Interfacial Dzyaloshinskii–Moriya Interaction on the Spin Waves Eigenmodes of Isolated Stripes and Dots Magnetized In-Plane: A Micromagnetic Study}, journal = {Applied Sciences}, year = {2021}, month = {3}, day = {25}, volume = {11}, number = {7}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {2929}, keywords = {Micromagnetism, DMI, Magnetic dots}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app11072929}, stag_bib_extends_levelofaccess = {NA}, author = {Silvani, R. and Alunni, M. and Tacchi, S. and Carlotti, G.} } @Article { AsconeKWKK2021_2, subid = {2541}, title = {A longitudinal, randomized experimental pilot study to investigate the effects of airborne ultrasound on human mental health, cognition, and brain structure}, journal = {Scientific Reports}, year = {2021}, month = {3}, day = {12}, volume = {11}, number = {1}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {5814-5823}, keywords = {air-borne ultrasound, noise assessment, functional magnetic resonance imaging}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-83527-z}, stag_bib_extends_levelofaccess = {NA}, author = {Ascone, L. and Kling, C. and Wieczorek, J. and Koch, C. and K{\"u}hn, S.} } @Article { SeegerOCGSSOALGFGKB2021, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SeegerOCGSSOALGFGKB20210, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Article { SeegerOCGSSOALGFGKB20211, subid = {2069}, title = {Quantification of Element Mass Concentrations in Ambient Aerosols by Combination of Cascade Impactor Sampling andMobile Total Reflection X-ray Fluorescence Spectroscopy}, journal = {Atmosphere}, year = {2021}, month = {2}, day = {21}, volume = {12}, number = {3}, number2 = {19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality}, pages = {309-326}, keywords = {TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS}, misc2 = {EMPIR 2019: Environment}, publisher = {MDPI}, language = {30}, ISSN = {EISSN 2073-4433}, DOI = {10.3390/atmos12030309}, stag_bib_extends_levelofaccess = {NA}, author = {Seeger, S. and Os{\'a}n, J. and Cz{\"o}mp{\"o}ly, O. and Gross, A. and Sto{\ss}nach, H. and Stabile, L. and Ochsenkuehn-Petropoulou, M. and Areti Tsakanika, L. and Lymperopoulou, T. and Goddard, S. and Fiebig, M. and Gaie-Levrel, F. and Kayser, Y. and Beckhoff, B.} } @Manual { BrunaRomeroPLHFCBAZZG2021, subid = {1907}, title = {Best practice guide for the assessment of EMF exposure from vehicle Wireless Power Transfer systems}, year = {2021}, month = {2}, day = {17}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, keywords = {Dosimetry, Guidelines, Magnetic field measurements, Magnetic field calculation, Numerical models, Uncertainty, Wireless Power Transfer, Electric Vehicle}, web_url = {https://www.micev.eu/theme/inrim/assets/doc/BPG_Micev_2021.pdf}, misc2 = {EMPIR 2016: Energy}, publisher = {INRIM}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISBN: 978-88-945324-1-8}, author = {Bruna Romero, J. and Pichon, L. and Laporta, E. and Harmon, S. and Freschi, F. and Clarke, B. and Bottauscio, O. and Ankarson, P. and Zilberti, L. and Zucca, M. and Guilizzoni, R.} } @Article { HorenderAQSNDSWAKGV2021, subid = {1901}, title = {Facility for production of ambient-like model aerosols (PALMA) in the laboratory: application in the intercomparison of automated PM monitors with the reference gravimetric method}, journal = {Atmospheric Measurement Techniques}, year = {2021}, month = {2}, day = {16}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, keywords = {ambient-like aerosols, particulate matter, calibration , PM monitors}, web_url = {https://amt.copernicus.org/articles/14/1225/2021/amt-14-1225-2021.html}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.5194/amt-14-1225-2021}, stag_bib_extends_levelofaccess = {NA}, author = {Horender, S. and Auderset, K. and Quincey, P. and Seeger, S. and Nielsen Skov, S. and Dirscherl, K. and Smith, T.O.M. and Williams, K. and Aegerter, C.C. and Kalbermatter, D.M. and Gaie-Levrel, F. and Vasilatou, K.} } @Article { FernandezScarioniBCSHALRCKS2021, subid = {2055}, title = {Thermoelectric Signature of Individual Skyrmions}, journal = {Physical Review Letters}, year = {2021}, month = {2}, day = {16}, volume = {126}, number = {7}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {1-6/077202}, keywords = {Magnetism, Nernst effect, Skyrmions, Thermomagnetic effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.126.077202}, stag_bib_extends_levelofaccess = {NA}, author = {Fern{\'a}ndez Scarioni, A. and Barton, C. and Corte-Le{\'o}n, H. and Sievers, S. and Hu, X. and Ajejas, F. and Legrand, W. and Reyren, N. and Cros, V. and Kazakova, O. and Schumacher, H.W.} } @Article { GarciaAsenjoBAG2021, subid = {1924}, title = {Development of a Submillimetric GNSS-Based Distance Meter for Length Metrology}, journal = {Sensors}, year = {2021}, month = {2}, volume = {21}, number = {4}, number2 = {18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy}, pages = {1145}, keywords = {Global Navigation Satellite Systems (GNSS), length; metrology, multipath}, web_url = {https://www.mdpi.com/1424-8220/21/4/1145}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s21041145}, stag_bib_extends_levelofaccess = {NA}, author = {Garc{\'i}a-Asenjo, L. and Baselga, S. and Atkins, C. and Garrigues, P.} } @Article { AsconeKWKK2021, subid = {2540}, title = {A longitudinal, randomized experimental pilot study to investigate the effects of airborne infrasound on human mental health, cognition, and brain structure}, journal = {Scientific Reports}, year = {2021}, month = {2}, volume = {11}, number = {1}, number2 = {15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources}, pages = {3190 - 3199}, keywords = {infrasound, long-time study, functional magnetic resonance imaging}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-021-82203-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ascone, L. and Kling, C. and Wieczorek, J. and Koch, C. and K{\"u}hn, S.} } @Article { ShalmZBSSMAAMAFOMNK2021, subid = {2736}, title = {Device-independent randomness expansion with entangled photons}, journal = {Nature Physics}, year = {2021}, month = {1}, day = {28}, volume = {17}, number = {4}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {452-456}, keywords = {Bell inequality test, Entangled photons}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1745-2473, 1745-2481}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1912.11158}, author = {Shalm, L.K. and Zhang, Y. and Bienfang, J.C. and Schlager, C. and Stevens, M.J. and Mazurek, M.D. and Abell{\'a}n, C. and Amaya, W. and Mitchell, M.W. and Alhejji, M.A. and Fu, H. and Ornstein, J. and Mirin, R.P. and Nam, S.W. and Knill, E.} } @Article { ArduinoZHZBCB2021, subid = {1867}, title = {Heating of hip joint implants in MRI: The combined effect of RF and switched‐gradient fields}, journal = {Magnetic Resonance in Medicine}, year = {2021}, month = {1}, day = {22}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {gradient coil heating, hip prosthesis, MRI safety, numerical simulation, radiofrequency heating}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28666}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Zanovello, U. and Hand, J. and Zilberti, L. and Br{\"u}hl, R. and Chiampi, M. and Bottauscio, O.} } @Proceedings { PhungA2021, subid = {2286}, title = {Anomalies in multiline-TRL-corrected measurements of short CPW lines}, journal = {2021 96th ARFTG Microwave Measurement Conference (ARFTG)}, year = {2021}, month = {1}, day = {18}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1-4}, keywords = {calibration, coplanar waveguides, on-wafer, probes}, web_url = {https://oar.ptb.de/files/download/6189062f8e2a000011003f89}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {San Diego, CA, USA}, event_name = {2021 96th ARFTG Microwave Measurement Conference (ARFTG)}, event_date = {18-01-2021 to 22-01-2021}, language = {30}, DOI = {10.1109/ARFTG49670.2021.9425345}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Arz, U.} } @Article { JenningerABBDGISJKRSSSTTW2021, subid = {1775}, title = {Development of a design for an ionisation vacuum gauge suitable as a reference standard}, journal = {Vacuum}, year = {2021}, month = {1}, volume = {183}, number2 = {16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge}, pages = {109884}, keywords = {Ionisation gauge, Hot cathode, Sensitivity, Simulation, Reference standard}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0042-207X}, DOI = {10.1016/j.vacuum.2020.109884}, stag_bib_extends_levelofaccess = {NA}, author = {Jenninger, B. and Anderson, J. and Bernien, M. and Bundaleski, N. and Dimitrova, H. and Granovskij, M. and Illgen, C. and Šetina, J. and Jousten, K. and Kucharski, P. and Reinhardt, C. and Scuderi, F. and Silva, R.A.S. and St{\"o}ltzel, A. and Teodoro, O.M.N.D. and Trzpil-Jurgielewicz, B. and W{\"u}est, M.} } @Inbook { BELLGAABSIDPSVRIWPNKSD2021, subid = {2552}, title = {A NEW EUROPEAN RADIATION PROTECTION NETWORK DEVELOPED BY THE SUPPORT BSS JOINT NETWORK PROJECT}, year = {2021}, month = {1}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {radiation protection, metrology, national regulation, European regulation, supportBSS, ENM for Radiation Protection}, web_url = {https://vinar.vin.bg.ac.rs/bitstream/handle/123456789/10125/309-314.pdf}, misc2 = {EMPIR 2019: Support for Networks}, booktitle = {RADIATION PROTECTION SOCIETY OF SERBIA AND MONTENEGRO, PROCEEDINGS, XXXI SYMPOSIUM RPSSM, 2021}, language = {30}, ISBN = {78-86-7306-161-0}, stag_bib_extends_levelofaccess = {NA}, author = {Bell, S. and Glavič-Cindro, D. and ALVES, J. and Adam-Guillermin, C. and Bernat, R. and Sabeta, A. and Ioan, M-R. and DERLACINSKI, M. and Pinto, M. and Sochor, V. and Veres, A. and R{\"O}TTGER, .A. and Živanović, M. and Wens, B. and Persson, L. and Nylund, R. and Kržanović, N. and STANKOVIĆ, S. and DIMOVIĆ, S.} } @Proceedings { KhanbabaeeRBRFHZTLdBGGCA2021, subid = {2377}, title = {SUPPORT FOR A EUROPEAN METROLOGY NETWORK ON RELIABLE RADIATION PROTECTION: GAPS IN RADIATION PROTECTION AND RELATED METROLOGY}, journal = {RAD Conference Proceedings}, year = {2021}, number2 = {19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation}, keywords = {Activity standards, new operational quantities in radiation protection, type testing, calibration, radon,reference field, pulsed radiation, dosimetry, standards, radiological emergency response}, misc2 = {EMPIR 2019: Support for Networks}, publisher = {RAD Centre}, event_place = {Herceg Novi, Montenegro}, event_name = {9th international conference on Radiation in various fields of research}, event_date = {14-06-2021 to 18-06-2021}, language = {30}, DOI = {10.21175/RadProc.2021.04}, stag_bib_extends_levelofaccess = {NA}, author = {Khanbabaee, B. and R{\"o}ttger, A. and Behrens, R. and R{\"o}ttger, S. and Feige, S. and Hupe, O. and Zutz, H. and Toroi, P. and Leonard, P. and de la Fuente Rosales, L. and Burgess, P. and Gressier, V. and Guti{\'e}rrez Villanueva, J–L. and Cruz Su{\'a}rez, R. and Arnold, D.} } @Article { AgustoniF2021, subid = {2321}, title = {Characterization of DAC Phase Offset in IEC 61850-9-2 Calibration Systems}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2021}, volume = {70}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-10}, keywords = {Digital-to-analog converter (DAC) phase offset,discrete Fourier transform (DFT) interpolation, IEC 61850, phasereference signal (PRS), sampled values (SVs)}, misc2 = {EMPIR 2017: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2021.3084294}, stag_bib_extends_levelofaccess = {NA}, author = {Agustoni, M. and Frigo, G.} } @Proceedings { FrigoA2021_2, subid = {2385}, title = {Phasor Measurement Unit and Sampled Values: Measurement and Implementation Challenges}, journal = {Proceedings of 2021 IEEE AMPS}, year = {2021}, volume = {1}, number = {1}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1-6}, keywords = {Instrument transformers, Electric potential, Power measurement, Substations, Instruments, Merging, Prototypes}, web_url = {https://zenodo.org/record/5703145}, misc2 = {EMPIR 2017: Industry}, publisher = {IEEE}, address = {Austin}, event_place = {Cagliari}, event_name = {2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS)}, event_date = {29-09-2021 to 01-10-2021}, language = {30}, ISBN = {978-1-7281-6923-1}, ISSN = {2475-2304}, DOI = {10.5281/zenodo.5703144}, stag_bib_extends_levelofaccess = {NA}, author = {Frigo, G. and Agustoni, M.} } @Article { HaveAHPMSL2021, subid = {2088}, title = {Waveform Model to Characterize Time-Domain Pulses Resulting in EMI on Static Energy Meters}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2021}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {1-8}, keywords = {Electromagnetic interference (EMI), metering errors, nonlinear, static energy meters, time-domain, waveformmodel}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2021.3062948}, stag_bib_extends_levelofaccess = {NA}, author = {Have, B.t. and Azpurua, M.A. and Hartman, T. and Pous, M. and Moonen, N. and Silva, F. and Leferink, F.} } @Proceedings { FordRA2021, subid = {2705}, title = {A Study of the stability exhibited by hydrophones when exposed to variations in temperature and hydrostatic pressure}, journal = {6th Underwater Acoustics Conference and Exhibition}, year = {2021}, volume = {Volume 44}, number = {1}, number2 = {19ENV03: Infra-AUV: Metrology for low-frequency sound and vibration}, pages = {070024}, keywords = {stability exhibited by hydrophones, variations in temperature, hydrostatic pressure}, web_url = {https://asa.scitation.org/doi/abs/10.1121/2.0001491}, misc2 = {EMPIR 2019: Environment}, publisher = {ASA}, event_place = {Teddington, Surrey}, event_name = {Meetings on Acoustics}, event_date = {03-09-2021 to 04-09-2021}, language = {30}, ISSN = {1939-800X}, DOI = {10.1121/2.0001491}, stag_bib_extends_levelofaccess = {NA}, author = {Ford, B. and Robinson, S. and Ablitt, J.} } @Article { VentonHSSA2021, subid = {2249}, title = {Robustness of convolutional neural networks to physiological electrocardiogram noise}, journal = {Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences}, year = {2021}, volume = {379}, number = {2212}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {-}, keywords = {electrocardiogram, physiological noise, robustness, deep learning, convolutional neural network, symmetric projection attractor reconstruction}, web_url = {https://royalsocietypublishing.org/doi/10.1098/rsta.2020.0262}, misc2 = {EMPIR 2018: Health}, publisher = {Royal Society Publishing}, language = {30}, ISSN = {-}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.1098/rsta.2020.0262}, author = {Venton, J. and Harris, P.M. and Sundar, A. and Smith, N.A.S. and Aston, P.J. } } @Article { SilanderFZZA2020_2, subid = {1785}, title = {An Invar-based Fabry-Perot cavity refractometer with a gallium fixed-point cell for assessment of pressure}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {293-298}, keywords = {Refractometry, Fabry-Perot cavity, Temperature, Gallium, Gas Modulation}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-60}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.987}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Article { ZelanSFZA2020, subid = {1784}, title = {Recent advances in Fabry-Perot-based refractometry utilizing gas modulation for assessment of pressure}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {299-304}, keywords = {Refractometry, Gas Modulation, GAMOR, Pressure}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-61}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.988}, stag_bib_extends_levelofaccess = {NA}, author = {Zelan, M. and Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Axner, O.} } @Article { ForssenSSJBHAZ2020, subid = {1786}, title = {A transportable refractometer for assessment of pressure in the kPa range with ppm level precision}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {287-292}, keywords = {Refractometry; Pressure; Gas Modulation, GAMOR; Transportable}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-59}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.986}, stag_bib_extends_levelofaccess = {NA}, author = {Forss{\'e}n, C. and Silander, I. and Szabo, D. and J{\"o}nsson, G. and Bjerling, M. and Hausmaninger, T. and Axner, O. and Zelan, M.} } @Article { ZakrissonSFSMPKARA2020, subid = {1787}, title = {Simulation of pressure-induced cavity deformation – the 18SIB04 Quantumpascal EMPIR project}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {281-286}, keywords = {EMPIR; QuantumPascal; FEM; Pressure; Refractometry; Deformation.}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09\%20\%282020\%29-05-58}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.985}, stag_bib_extends_levelofaccess = {NA}, author = {Zakrisson, J. and Silander, I. and Forss{\'e}n, C. and Silvestri, Z. and Mari, D. and Pasqualin, S. and Kussicke, A. and Asbahr, P. and Rubin, T. and Axner, O.} } @Proceedings { FurtadoPQSLMAARLBCLA2020, subid = {1898}, title = {First density comparison on viscoelastic samples by oscillation-type densimetry}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements}, pages = {79}, keywords = {EMPIR rhoLiq Project; oscillation-type density meter; viscoelasticity; comparison}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IMEKO International Measurement Confederation}, event_place = {-}, event_name = {IMEKO TC3, TC5, TC16 and TC2}, event_date = {16-11-2020 to 18-11-2020}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.943}, stag_bib_extends_levelofaccess = {NA}, author = {Furtado, A. and Pereira, J. and Quendera, R. and Schiebl, M. and Lenard, E. and Malejczyk, E. and Alic, A. and Alisic, S. and Rauch, J. and Lorenz, F. and Bescupschii, A. and Ciubara, A. and Laky, B. and Ams{\"u}ss, R.} } @Article { ZelenkaASHKPPDZCM2020, subid = {2108}, title = {Improvement of the realisation of the mass scale}, journal = {ACTA IMEKO}, year = {2020}, month = {12}, day = {31}, volume = {9}, number = {5}, number2 = {19RPT02: RealMass: Improvement of the realisation of the mass scale}, pages = {4}, keywords = {Mass realisation, kilogram, multiplies and sub-multiplies, subdivision and multiplication, OIML R111}, web_url = {https://acta.imeko.org/index.php/acta-imeko/index}, misc2 = {EMPIR 2019: Research Potential}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v9i5.928}, stag_bib_extends_levelofaccess = {NA}, author = {Zelenka, Z. and Alisic, S. and Stoilkovska, B. and Hanrahan, R. and Kolozinsky, I. and Popa, G. and Pantic, D. and Dikov, V. and Zůda, J. and Coenegrachts, M. and Malengo, A.} } @Article { NaccaratoTMMMZPAPNMWSMMSBPSW2020, subid = {2035}, title = {A field intercomparison of three passive air samplers for gaseous mercury in ambient air}, journal = {Atmospheric Measurement Techniques}, year = {2020}, month = {12}, day = {29}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {atmnospheric gaseous mercury, passive samplers, intercomparison}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus GmbH}, language = {30}, DOI = {10.5194/amt-2020-455}, stag_bib_extends_levelofaccess = {NA}, author = {Naccarato, A. and Tassone, A. and Martino, M. and Moretti, S. and Macagnano, A. and Zampetti, E. and Papa, P. and Avossa, J. and Pirrone, N. and Nerentorp, M. and Munthe, J. and W{\"a}ngberg, I. and Stupple, G.W. and Mitchell, C.P.J. and Martin, A.R. and Steffen, A. and Babi, D. and Prestbo, E.M. and Sprovieri, F. and Wania, F.} } @Proceedings { ElgGAMMHHLMPMSV2020, subid = {2062}, title = {Research Project EMPIR 19ENG02 Future Energy}, journal = {VDE High Voltage Technology 2020; ETG-Symposium}, year = {2020}, month = {12}, volume = {N/A}, number = {N/A}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {N/A}, keywords = {UHVDC, traceability, Lightning Impulse, linearity, voltage dependence, HVAC, DC partial discharge, GIS Partial discharge}, tags = {SEG}, web_url = {https://ieeexplore.ieee.org/servlet/opac?punumber=9275417}, misc2 = {EMPIR 2019: Energy}, publisher = {VDE}, event_place = {Berlin, Germany}, event_name = {VDE High Voltage Technology 2020; ETG-Symposium}, event_date = {09-11-2020 to 11-11-2020}, language = {30}, ISBN = {978-3-8007-5353-6}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4769653}, author = {Elg, A-P. and Garnacho, F. and Agazar, M. and Meisner, J. and Merev, A. and Houtzager, E. and H{\"a}llstr{\"o}m, J. and Lahti, K. and Mier Escurra, C. and Platinero, C. and Micand, T. and Steiner, T. and Voss, A.} } @Article { DitaliaTchernijLCSPTBCPPDMAOSMGF2020, subid = {1730}, title = {Fluorine-based color centers in diamond}, journal = {Scientific Reports}, year = {2020}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {21537}, keywords = {Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-78436-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Corte, E. and Sardi, F. and Picollo, F. and Traina, P. and Brajković, M. and Crnjac, A. and Pezzagna, S. and Pastuović, Ž. and Degiovanni, I.P. and Moreva, E. and Apr{\`a}, P. and Olivero, P. and Siketić, Z. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { DitaliaTchernijLCSPTBCPPDMAOSMGF2020_2, subid = {1806}, title = {Fluorine-based color centers in diamond}, journal = {Scientific Reports}, year = {2020}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-78436-6}, stag_bib_extends_levelofaccess = {NA}, author = {Ditalia Tchernij, S. and L{\"u}hmann, T. and Corte, E. and Sardi, F. and Picollo, F. and Traina, P. and Brajković, M. and Crnjac, A. and Pezzagna, S. and Pastuović, Ž. and Degiovanni, I.P. and Moreva, E. and Apr{\`a}, P. and Olivero, P. and Siketić, Z. and Meijer, J. and Genovese, M. and Forneris, J.} } @Article { SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020, subid = {1841}, title = {The European Joint Research Project UHDpulse – Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, journal = {Physica Medica}, year = {2020}, month = {12}, volume = {80}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {134-150}, keywords = {Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project}, misc2 = {EMPIR 2018: Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {1120-1797}, DOI = {10.1016/j.ejmp.2020.09.020}, stag_bib_extends_levelofaccess = {NA}, author = {Sch{\"u}ller, A. and Heinrich, S. and Fouillade, C. and Subiel, A. and De Marzi, L. and Romano, F. and Peier, P. and Trachsel, M. and Fleta, C. and Kranzer, R. and Caresana, M. and Salvador, S. and Busold, S. and Sch{\"o}nfeld, A. and McEwen, M. and Gomez, F. and Solc, J. and Bailat, C. and Linhart, V. and Jakubek, J. and Pawelke, J. and Borghesi, M. and Kapsch, R-P. and Knyziak, A. and Boso, A. and Olsovcova, V. and Kottler, C. and Poppinga, D. and Ambrozova, I. and Schmitzer, C-S. and Rossomme, S. and Vozenin, M-C.} } @Article { BarreQSDBTESdA2020, subid = {2036}, title = {Comparison of the Isotopic Composition of Hg and Pb in Two Atmospheric Bioaccumulators in a Pyrenean Beech Forest (Iraty Forest, Western Pyrenees, France/Spain)}, journal = {Frontiers in Environmental Chemistry}, year = {2020}, month = {11}, day = {23}, volume = {1}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, keywords = {isotopic composition, mercury, biomonitoring}, misc2 = {EMPIR 2016: Environment}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2673-4486}, DOI = {10.3389/fenvc.2020.582001}, stag_bib_extends_levelofaccess = {NA}, author = {Barre, J.P.G. and Queipo-Abad, S. and Sola-Larra{\~n}aga, C. and Deletraz, G. and B{\'e}rail, S. and Tessier, E. and Elustondo Valencia, D. and Santamar{\'i}a, J.M. and de Diego, A. and Amouroux, D.} } @Article { AqeelSTMMBBGPB2020, subid = {2388}, title = {Microwave Spectroscopy of the Low-Temperature Skyrmion State in Cu2OSeO3}, journal = {Physical Review Letters}, year = {2020}, month = {11}, day = {17}, volume = {126}, number = {1}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {017202-1 - 017202-7}, keywords = {Lattice dynamics, Magnetic order, Magnetism, Magnetization dynamics, Skyrmions, Spin waves}, web_url = {https://arxiv.org/abs/2011.07826}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.126.017202}, stag_bib_extends_levelofaccess = {NA}, author = {Aqeel, A. and Sahliger, J. and Taniguchi, T. and M{\"a}ndl, S. and Mettus, D. and Berger, H. and Bauer, A. and Garst, M. and Pfleiderer, C. and Back, C.H.} } @Article { IstrateATRG2020, subid = {1755}, title = {Traceable measurements of harmonic (2 to 150) kHz emissions in smart grids: uncertainty calculation}, journal = {Journal of Sensors and Sensor Systems}, year = {2020}, month = {11}, day = {10}, volume = {9}, number = {2}, number2 = {18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods}, pages = {375-381}, keywords = {Supraharmonics, Measurement, Uncertainty, Smart Grids}, web_url = {https://jsss.copernicus.org/articles/9/375/2020/}, misc2 = {EMPIR 2018: Pre-Co-Normative}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-9-375-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Istrate, D. and Amaripadath, D. and Toutain, E. and Roche, R. and Gao, F.} } @Miscellaneous { ArduinoPZKC, subid = {1667}, title = {EMUE-D5-3-EPT Tissue Characterization}, year = {2020}, month = {11}, day = {6}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Electric Properties Tomography; Magnetic Resonance Imaging; Variance-covariance matrix; Shrinkage estimation; Law of propagation of uncertainty}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.4248879}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Pennecchi, F. and Zilberti, L and Katscher, U. and Cox, M.G.} } @Miscellaneous { PennecchiRAE, subid = {1659}, title = {EMUE-D2-3-TSP Concentration}, year = {2020}, month = {11}, day = {3}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Conformity assessment; Producer’s and consumer’s risk; Total suspended particulates in air; Mass Concentration; Measurement uncertainty; Log-normal prior distribution}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.4242988}, stag_bib_extends_levelofaccess = {NA}, author = {Pennecchi, F. and Rolle, F. and Allard, A. and Ellison, S.L.R.} } @Article { BlakesleyKDHTMSA2020, subid = {1949}, title = {Effective Spectral Albedo from Satellite Data for Bifacial Gain Calculations of PV Systems}, journal = {37th European Photovoltaic Solar Energy Conference and Exhibition}, year = {2020}, month = {11}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, pages = {1292 - 1297}, keywords = {Albedo, Bificial PV Module}, web_url = {https://zenodo.org/record/4055920}, misc2 = {EMPIR 2016: Energy}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {3-936338-73-6}, author = {Blakesley, J.C. and Koutsourakis, G. and Douglas, S. and Holder, J.K.L. and Torry, J. and Mukadam, F. and Schmid, A. and Abrams, R.S.J.} } @Article { AlveseSousaGFFMMBA2020, subid = {1674}, title = {Calibration of Syringe Pumps Using Interferometry and Optical Methods}, journal = {International Journal of Biomedical and Biological Engineering}, year = {2020}, month = {10}, day = {23}, volume = {14}, number = {10}, number2 = {18HLT08: MEDDII: Metrology for drug delivery}, pages = {10011517}, keywords = {Calibration, interferometry, syringe pump, optical method, uncertainty}, web_url = {https://publications.waset.org/10011517/pdf}, misc2 = {EMPIR 2018: Health}, publisher = {WASET}, language = {30}, ISSN = {ISNI:0000000091950263}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISNI:0000000091950263}, author = {Alves e Sousa, J. and Godinho, I. and Ferreira, M. do C. and Furtado, A. and Mendes, R. and Martins, R. and Batista, E. and Alvares, M.} } @Article { DorscherABSHSL2020, subid = {1719}, title = {Dynamical decoupling of laser phase noise in compound atomic clocks}, journal = {Communications Physics}, year = {2020}, month = {10}, day = {20}, volume = {3}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {1-8}, keywords = {optical atomic clocks,dynamic decoupling,coherence time,decoherence}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-020-00452-9}, stag_bib_extends_levelofaccess = {NA}, author = {D{\"o}rscher, S. and Al-Masoudi, A. and Bober, M. and Schwarz, R. and Hobson, R. and Sterr, U. and Lisdat, C.} } @Article { AlajiAGOLGDG2020, subid = {1703}, title = {Design of tunable power detector towards 5G applications}, journal = {Microwave and Optical Technology Letters}, year = {2020}, month = {10}, volume = {-}, number = {-}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {-}, keywords = {5G and IoT sensors, 55-nm BiCMOS, tunablepower detector, Millimeterwave, PN diode}, web_url = {https://zenodo.org/record/4300488}, misc2 = {EMPIR 2016: Energy}, publisher = {Wiley}, language = {30}, ISSN = {0895-2477, 1098-2760}, DOI = {10.1002/mop.32685}, stag_bib_extends_levelofaccess = {NA}, author = {Alaji, I. and Aouimeur, W. and Ghanem, H. and Okada, E. and L{\'e}pilliet, S. and Gloria, D. and Ducournau, G. and Gaquiere, C.} } @Article { RomanoSMLPTMMBMAFGS2020, subid = {1839}, title = {Challenges in dosimetry of particle beams with ultra-high pulse dose rates}, journal = {Journal of Physics: Conference Series}, year = {2020}, month = {10}, volume = {1662}, number2 = {18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates}, pages = {012028}, keywords = {ultra-high pulse dose rates, dosimetry, metrology, electrons}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1662/1/012028}, stag_bib_extends_levelofaccess = {NA}, author = {Romano, F. and Subiel, A. and McManus, M. and Lee, N. D. and Palmans, H. and Thomas, R. and McCallum, S. and Milluzzo, G. and Borghesi, M. and McIlvenny, A. and Ahmed, H. and Farabolini, W. and Gilardi, A. and Sch{\"u}ller, A.} } @Article { JandaGOPUHRSMRNCHWEACDMORONJKZ2020, subid = {1683}, title = {Magneto-Seebeck microscopy of domain switching in collinear antiferromagnet CuMnAs}, journal = {Physical Review Materials}, year = {2020}, month = {9}, day = {28}, volume = {4}, number = {9}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {094413-1 to 094413-9}, keywords = {-}, web_url = {https://arxiv.org/abs/2004.05460}, misc2 = {EMPIR 2016: Energy}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {2475-9953}, DOI = {10.1103/PhysRevMaterials.4.094413}, stag_bib_extends_levelofaccess = {NA}, author = {Janda, T. and Godinho, J. and Ostatnicky, T. and Pfitzner, E. and Ulrich, G. and Hoehl, A. and Reimers, S. and Šob{\'a}ň, Z. and Metzger, T. and Reichlov{\'a}, H. and Nov{\'a}k, V. and Campion, R. P. and Heberle, J. and Wadley, P. and Edmonds, K. W. and Amin, O. J. and Chauhan, J. S. and Dhesi, S. S. and Maccherozzi, F. and Otxoa, R. M. and Roy, P. E. and Olejn{\'i}k, K. and Němec, P. and Jungwirth, T. and Kaestner, B. and Ziade, Francois} } @Proceedings { tenHaveAPSL2020, subid = {2085}, title = {On-Site Waveform Survey in LV Distribution Network using a Photovoltaic Installation}, journal = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2020}, month = {9}, day = {23}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Conducted electromagnetic interference, Distribution network, Non-linear, Photovoltaic installation, Static energy meter}, web_url = {https://research.utwente.nl/en/publications/on-site-waveform-survey-in-lv-distribution-network-using-a-photov}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Barcelona}, event_name = {2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {23-09-2020 to 25-09-2020}, language = {30}, DOI = {10.1109/EMCEUROPE48519.2020.9245831}, stag_bib_extends_levelofaccess = {NA}, author = {ten Have, B. and Azpurua, M.A. and Pous, M. and Silva, F. and Leferink, F.} } @Article { ZilbertiZABZ2020, subid = {1668}, title = {RF‐induced heating of metallic implants simulated as PEC: Is there something missing?}, journal = {Magnetic Resonance in Medicine}, year = {2020}, month = {9}, day = {16}, volume = {85}, number = {2}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {583-586}, keywords = {MR safetyMedical implantsRF-induced heatingMagnetic Resonance ImagingSpecific Absorption Rate}, web_url = {https://onlinelibrary.wiley.com/doi/full/10.1002/mrm.28512}, misc2 = {EMPIR 2017: Industry}, publisher = {Wiley}, language = {30}, ISSN = {0740-3194, 1522-2594}, DOI = {10.1002/mrm.28512}, stag_bib_extends_levelofaccess = {NA}, author = {Zilberti, L. and Zanovello, U. and Arduino, A. and Bottauscio, O. and Zilberti, L.} } @Article { ZakrissonSFZA2020, subid = {1678}, title = {Procedure for robust assessment of cavity deformation in Fabry–P{\'e}rot based refractometers}, journal = {Journal of Vacuum Science \& Technology B}, year = {2020}, month = {9}, volume = {38}, number = {5}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {054202}, keywords = {Cavity Deformation, Fabry-Perot, refractomtery, Gas Modulation refractomtery (GAMOR)}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/6.0000375}, stag_bib_extends_levelofaccess = {NA}, author = {Zakrisson, J. and Silander, I. and Forss{\'e}n, C. and Zelan, M. and Axner, O.} } @Article { CrottivMTLSACMMA2020, subid = {2130}, title = {Measurement Methods and Procedures for Assessing Accuracy of Instrument Transformers for Power Quality Measurements}, journal = {Conference on Precision Electromagnetic Measurements CPEM 2020 Proceedings}, year = {2020}, month = {8}, day = {24}, number2 = {19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements}, keywords = {Instrument transformers, calibration, measurement standards, measurement techniques, measurementuncertainty, precision measurements}, tags = {SEG}, misc2 = {EMPIR 2019: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.5136547}, stag_bib_extends_levelofaccess = {NA}, author = {Crotti, G. and van den Brom, H.E. and Mohns, E. and Tinarelli, R. and Luiso, M. and Styblikova, R. and Agazar, M. and \c{C}aycı, H. and Mazza, P. and Meyer, J. and Almutairi, M. } } @Article { ClivatiABBDDMMMNLPRRSSSTC2020, subid = {1773}, title = {Common-clock very long baseline interferometry using a coherent optical fiber link}, journal = {Optica}, year = {2020}, month = {8}, day = {20}, volume = {7}, number = {8}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {1031}, keywords = {fiber links, coherent phase transfer, frequency dissemination with fibers, VLBI}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.393356}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Aiello, R. and Bianco, G. and Bortolotti, C. and De Natale, P. and Di Sarno, V. and Maddaloni, P. and Maccaferri, G. and Mura, A. and Negusini, M. and Levi, F. and Perini, F. and Ricci, R. and Roma, M. and Santamaria Amato, L. and Siciliani de Cumis, M. and Stagni, M. and Tuozzi, A. and Clivati, C.} } @Article { SchwarzDABLSWRLL2020, subid = {1570}, title = {Long term measurement of the 87Sr clock frequency at the limit of primary Cs clocks}, journal = {Physical Review Research}, year = {2020}, month = {8}, day = {11}, volume = {2}, number = {3}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, pages = {033242}, keywords = {Atomic spectra, optical clocks, gravitation}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {American Physical Society (APS)}, address = {Ricklinger Stadtweg 4c}, language = {30}, DOI = {10.1103/PhysRevResearch.2.033242}, stag_bib_extends_levelofaccess = {NA}, author = {Schwarz, R and D{\"o}rscher, S and Al-Masoud, A and Benkler, E and Legero, T and Sterr, U and Weyers, S and Rahm, J and Lipphardt, B and Lisdat, C} } @Proceedings { KazemipourHWAHRSZ2020, subid = {1663}, title = {VNA-Based Material Characterization in THz Domain without Classic Calibration and Time-Gating}, journal = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, year = {2020}, month = {8}, volume = {N/A}, number = {N/A}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, pages = {1-2}, keywords = {Material characterization, parameter extraction, VNA time-gating, RF metrology, measurement uncertainty}, web_url = {https://doi.org/10.5281/zenodo.4243044}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Denver, CO, USA}, event_name = {2020 Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {24-08-2020 to 28-08-2020}, language = {30}, ISBN = {978-1-7281-5898-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM49742.2020.9191818}, stag_bib_extends_levelofaccess = {NA}, author = {Kazemipour, A. and Hoffmann, J. and Wollensack, M. and Allal, D. and Hudlicka, M. and Ruefenacht, J. and Stalder, D. and Zeier, M.} } @Article { MauryADdBM2020, subid = {1818}, title = {Hydrogen refuelling station calibration with a traceable gravimetric standard}, journal = {Flow Measurement and Instrumentation}, year = {2020}, month = {8}, volume = {74}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {101743}, keywords = {Refuelling station; Hydrogen; Primary standard; Uncertainties; High pressure}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0955-5986}, DOI = {10.1016/j.flowmeasinst.2020.101743}, stag_bib_extends_levelofaccess = {NA}, author = {Maury, R. and Auclercq, C. and Devilliers, C. and de Huu, M. and B{\"u}ker, O. and MacDonald, M.} } @Article { LiuACA2020, subid = {1608}, title = {Reply to “Comment on Liu et al. ‘Discrepancies of Measured SAR between Traditional and Fast Measuring Systems’ Int. J. Environ. Res. Public Health, 2020, 17, 2111”}, journal = {International Journal of Environmental Research and Public Health}, year = {2020}, month = {7}, day = {24}, volume = {17}, number = {15}, number2 = {16NRM07: Vector SAR: SAR measurement using vector probes}, pages = {5355}, keywords = {specific absorption rate; fast SAR measurement; field reconstruction; plane-wave expansion; traditional SAR measurement; measurement discrepancy}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {MDPI AG}, language = {30}, ISSN = {1660-4601}, DOI = {10.3390/ijerph17155355}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, Z. and Allal, D. and Cox, M. and Allal, D.} } @Article { ShuVZAF2020, subid = {1544}, title = {Experimental and Modeling Studies on the Correlation Between Auto-Ignition Delays and the Methane Number of Liquefied Natural Gas (LNG) and Liquefied Biogas (LBG)}, journal = {Frontiers in Mechanical Engineering}, year = {2020}, month = {7}, day = {24}, volume = {6}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, keywords = {liquefied natural gas, liquefied biogas, rapid compression machine, auto-ignition delays, chemical kinetics, modeling, shock tube}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Frontiers Media SA}, language = {30}, ISSN = {2297-3079}, DOI = {10.3389/fmech.2020.00047}, stag_bib_extends_levelofaccess = {NA}, author = {Shu, B. and Vallabhuni, S.K. and Zheng, J. and Agarwal, S. and Fernandes, R.X.} } @Article { MayerBTOPAGMIMSK2020, subid = {1600}, title = {Flexible numerical simulation framework for dynamic PET-MR data}, journal = {Physics in Medicine \& Biology}, year = {2020}, month = {7}, day = {21}, volume = {65}, number = {14}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, pages = {145003}, keywords = {PET-MR,motion correction,simulation,image registration,open source}, misc2 = {EMPIR 2018: Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab7eee}, stag_bib_extends_levelofaccess = {NA}, author = {Mayer, J. and Brown, R. and Thielemans, K. and Ovtchinnikov, E. and Pasca, E. and Atkinson, D. and Gillman, A. and Marsden, P. and Ippoliti, M. and Makowski, M. and Schaeffter, T. and Kolbitsch, C.} } @Article { AlKhafajiGWBV2020, subid = {1714}, title = {Particle Size Distribution of Bimodal Silica Nanoparticles: A Comparison of Different Measurement Techniques}, journal = {Materials}, year = {2020}, month = {7}, day = {11}, volume = {13}, number = {14}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {3101}, keywords = {silica nanoparticle; size distribution; light scattering; small-angle X-ray scattering; microfluidic resistive pulse sensing}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI AG}, language = {30}, ISSN = {1996-1944}, DOI = {10.3390/ma13143101}, stag_bib_extends_levelofaccess = {NA}, author = {Al-Khafaji, M.A. and Ga{\'a}l, A. and Wacha, A. and B{\'o}ta, A. and Varga, Z.} } @Article { HeeringSCANNQRBBNSLLURVSDRKL2020, subid = {1554}, title = {Symmetric Potentiometric Cells for the Measurement of Unified pH Values}, journal = {Symmetry}, year = {2020}, month = {7}, volume = {12}, number = {7}, number2 = {17FUN09: UnipHied: Realisation of a Unified pH Scale}, pages = {1150}, keywords = {unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid}, misc2 = {EMPIR 2017: Fundamental}, publisher = {MDPI AG}, language = {30}, ISSN = {2073-8994}, DOI = {10.3390/sym12071150}, stag_bib_extends_levelofaccess = {NA}, author = {Heering, Agnes and Stoica, Daniela and Cam{\~o}es, Filomena and Anes, B{\'a}rbara and Nagy, D{\'a}niel and Nagyn{\'e} Szil{\'a}gyi, Zs{\'o}fia and Quendera, Raquel and Ribeiro, Luis and Bastkowski, Frank and Born, Rasmus and Nerut, Jaak and Saame, Jaan and Lainela, Silvie and Liv, Lokman and Uysal, Emrah and Rozikov{\'a}, Matilda and Vičarov{\'a}, Martina and Snedden, Alan and Deleebeeck, Lisa and Radtke, Valentin and Krossing, Ingo and Leito, Ivo} } @Article { SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020, subid = {1522}, title = {Determination of consensus kQ values for megavoltage photon beams for the update of IAEA TRS-398}, journal = {Physics in Medicine and Biology}, year = {2020}, month = {6}, day = {22}, volume = {65}, number = {9}, number2 = {16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398}, pages = {095011}, keywords = {TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Institute of Physics}, address = {London}, language = {30}, DOI = {10.5281/zenodo.3903294}, stag_bib_extends_levelofaccess = {NA}, author = {Seuntjens, J. and de Prez, L.A. and Pinto, M. and Pimpinella, M. and Oliver, C.P. and Ojala, J. and Muir, B. and Mirzakhanian, L. and Hanlon, M.D. and Francescon, P. and Delaunay, F. and Borbinha, J. and Ballester, F. and Andersen, C.E. and Vatnitsky, S. and McEwen, M. and Kapsch, R.P. and Burns, D.T. and Andreo, P. and Sommier, L. and Teles, P. and Tikkanen, J. and Vijande, J. and Zink, K.} } @Article { HarmonFBAGBLZ2020, subid = {1514}, title = {Assessment of Exposure to Electric Vehicle Inductive Power Transfer Systems: Experimental Measurements and Numerical Dosimetry}, journal = {Sustainability}, year = {2020}, month = {6}, volume = {12}, number = {11}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {4573}, keywords = {basic restrictions; electric vehicle; exposure; guidelines; inductive power transfer (IPT); magnetic field measurements; numerical dosimetry}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2071-1050}, DOI = {10.3390/su12114573}, stag_bib_extends_levelofaccess = {NA}, author = {Liorni, I. and Bottauscio, O. and Guilizzoni, R. and Ankarson, P. and Bruna, J. and Fallahi, A. and Harmon, S. and Zucca, M.} } @Article { PradyumnaLRTZJADGG2020, subid = {1574}, title = {Twin beam quantum-enhanced correlated interferometry for testing fundamental physics}, journal = {Communications Physics}, year = {2020}, month = {6}, volume = {3}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {104}, keywords = {Optical physicsQuantum metrologyQuantum optics}, web_url = {https://www.nature.com/articles/s42005-020-0368-5\#Bib1}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Nature Research}, address = {233 Spring St. New York NY 10013 United States}, language = {30}, ISSN = {2399-3650}, DOI = {10.1038/s42005-020-0368-5}, stag_bib_extends_levelofaccess = {NA}, author = {Pradyumna, S. T. and Losero, E. and Ruo-Berchera, I. and Traina, P. and Zucco, M. and Jacobsen, C. S. and Andersen, U. L. and Degiovanni, I. P. and Genovese, M. and Gehring, T.} } @Article { LucasCTDABLYSMPF2020, subid = {1611}, title = {Dynamic piezoelectric response of relaxor single crystal under electrically driven inter-ferroelectric phase transformations}, journal = {Applied Physics Letters}, year = {2020}, month = {6}, volume = {116}, number = {22}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {222903}, keywords = {-}, web_url = {https://livrepository.liverpool.ac.uk/3091334/}, misc2 = {EMPIR 2016: Energy}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0007820}, stag_bib_extends_levelofaccess = {NA}, author = {Lucas, C.A. and Cain, M.G. and Thompson, P.B.J. and Damjanovic, D. and Antonelli, L. and Blackmon, F. and Lofland, S.E. and Young, S. and Staruch, M. and Matis, B.R. and Patterson, E.A. and Finkel, P.} } @Article { RuoBercheraMLASG2020, subid = {1576}, title = {Improving resolution-sensitivity trade off in sub-shot noise quantum imaging}, journal = {Applied Physics Letters}, year = {2020}, month = {5}, day = {26}, volume = {116}, number = {21}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {214001}, keywords = {Optical metrology, Quantum correlations, Signal processing, Quantum efficiency, Quantum limit, Charge coupled devices}, misc2 = {EMPIR 2017: Fundamental}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/5.0009538}, stag_bib_extends_levelofaccess = {NA}, author = {Ruo-Berchera, I. and Meda, A. and Losero, E. and Avella, A. and Samantaray, N. and Genovese, M.} } @Article { QueleverGAJ2020, subid = {1530}, title = {Validation of a Broadband Tissue-Equivalent Liquid for SAR Measurement and Monitoring of Its Dielectric Properties for Use in a Sealed Phantom}, journal = {Sensors}, year = {2020}, month = {5}, day = {23}, volume = {20}, number = {10}, number2 = {16NRM07: Vector SAR: SAR measurement using vector probes}, pages = {2956}, keywords = {dielectric measurement; process monitoring; open-ended coaxial probe; specificabsorption rate (SAR); tissue-equivalent materials}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {MDPI AG}, language = {30}, ISSN = {1424-8220}, DOI = {10.3390/s20102956}, stag_bib_extends_levelofaccess = {NA}, author = {Gregory, Andrew P. and Qu{\'e}l{\'e}ver, Kristell and Allal, Djamel and Jawad, Ourouk } } @Article { YamakawaBATBSNKYD2020, subid = {2039}, title = {Hg isotopic composition and total Hg mass fraction in NIES Certified Reference Material No. 28 Urban Aerosols}, journal = {Analytical and Bioanalytical Chemistry}, year = {2020}, month = {5}, day = {18}, volume = {412}, number = {19}, number2 = {16ENV01: MercOx: Metrology for oxidised mercury}, pages = {4483-4493}, keywords = {Hg isotopic composition, Certified Reference Material, Urban Aerosols}, misc2 = {EMPIR 2016: Environment}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-020-02691-9}, stag_bib_extends_levelofaccess = {NA}, author = {Yamakawa, A. and B{\'e}rail, S. and Amouroux, D. and Tessier, E. and Barre, J. and Sano, T. and Nagano, K. and Kanwal, S. and Yoshinaga, J. and Donard, O.F.X.} } @Article { MoranMezaDAP2020, subid = {1613}, title = {A substitution method for nanoscale capacitance calibration using scanning microwave microscopy}, journal = {Measurement Science and Technology}, year = {2020}, month = {5}, volume = {31}, number = {7}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {074009}, keywords = {-}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab82c1}, stag_bib_extends_levelofaccess = {NA}, author = {Mor{\'a}n-Meza, J.A. and Delvall{\'e}e, A. and Allal, D. and Piquemal, F.} } @Proceedings { PhungA2020, subid = {1646}, title = {Parasitic Probe Effects in Measurements of Coplanar Waveguides with Narrow Ground Width}, journal = {2020 IEEE 24th Workshop on Signal and Power Integrity (SPI)}, year = {2020}, month = {5}, number2 = {18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies}, keywords = {calibration, coplanar waveguides, multiline Thru-Reflect Line (mTRL), probes}, web_url = {https://oar.ptb.de/files/download/5f92a12a4c93902ba0000843}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IEEE}, event_place = {Cologne}, event_name = {2020 IEEE 24th Workshop on Signal and Power Integrity}, event_date = {17-05-2020 to 20-05-2020}, language = {30}, DOI = {10.1109/SPI48784.2020.9218166}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Arz, U.} } @Article { ArrheniusBFPM2020, subid = {1821}, title = {Development and evaluation of a novel analyser for ISO14687 hydrogen purity analysis}, journal = {Measurement Science and Technology}, year = {2020}, month = {5}, volume = {31}, number = {7}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {075010}, keywords = {hydrogen, hydrogen purity, analyser, OFCEAS, gas chromatography}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab7cf3}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and B{\"u}ker, O. and Fischer, A. and Persijn, S. and Murugan, A.} } @Proceedings { SilvaPA2020, subid = {1612}, title = {Uncertainty Analysis in the Measurement of Switching Losses in GaN FETs Power Converters}, journal = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2020}, month = {5}, volume = {2020}, number = {-}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {1-6}, keywords = {-}, web_url = {https://ieeexplore.ieee.org/document/9129552}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Dubrovnik, Croatia}, event_name = {2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {25-05-2020 to 28-05-2020}, language = {30}, ISBN = {Electronic ISBN: 978-1-7281-44}, ISSN = {Electronic ISSN: 2642-2077}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://hdl.handle.net/2117/328678}, author = {Silva, F. and Pous, M. and Azpurua, M.A.} } @Article { SilanderFZZA2020, subid = {1679}, title = {Invar-based refractometer for pressure assessments}, journal = {Optics Letters}, year = {2020}, month = {4}, day = {30}, volume = {45}, number = {9}, number2 = {18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal}, pages = {2652}, keywords = {Gas Modulation Refractometry (GAMOR), Fabry-Perot, Invar}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {0146-9592, 1539-4794}, DOI = {10.1364/OL.391708}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Forss{\'e}n, C. and Zakrisson, J. and Zelan, M. and Axner, O.} } @Article { MartinezABNVJHKVKL2020, subid = {1488}, title = {Step height standards based on self-assembly for 3D metrology of biological samples}, journal = {Measurement Science and Technology}, year = {2020}, month = {4}, day = {23}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, keywords = {nanometrology, transfer standard, calibration, CSI, SWLI, AFM, traceability}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab8c6a}, stag_bib_extends_levelofaccess = {NA}, author = {Heikkinen, V. and Kassamakov, I. and Viitala, T. and J{\"a}rvinen, M. and Vainikka, T. and Nolvi, A. and Bermudez, C. and Artigas, R. and Martinez, P. and Korpelainen, V. and Lassila, A.} } @Miscellaneous { SilvaALSCRMBS_2, subid = {1486}, title = {EMUE-D6-4-Mobile Optical Measurement}, year = {2020}, month = {4}, day = {18}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Calibration; Mobile optical measurement system}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3756658}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, M.A. and Almeida, M.C. and Loureiro, D. and Sousa, J.A. and Cox, M.G. and Ribeiro, A.S. and Martins, L.L. and Brito, R. and Soares, A.C.} } @Miscellaneous { SilvaALSCRMBS, subid = {1484}, title = {EMUE-D1-3-Single Burning Item}, year = {2020}, month = {4}, day = {1}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Measurement model; SBI – Single Burning Item; Reaction to fire test}, misc2 = {EMPIR 2017: Pre-Co-Normative}, language = {30}, DOI = {10.5281/zenodo.3736602}, stag_bib_extends_levelofaccess = {NA}, author = {Silva, M.A. and Almeida, M.C. and Loureiro, D. and Sousa, J.A. and Cox, M.G. and Ribeiro, A.S. and Martins, L.L. and Brito, R. and Soares, A.C.} } @Article { WiartCAL2020, subid = {1529}, title = {Discrepancies of Measured SAR between Traditional and Fast Measuring Systems}, journal = {International Journal of Environmental Research and Public Health}, year = {2020}, month = {3}, day = {22}, volume = {17}, number = {6}, number2 = {16NRM07: Vector SAR: SAR measurement using vector probes}, pages = {2111}, keywords = {specific absorption rate; fast SARmeasurement; field reconstruction; plane-wave expansion;traditional SAR measurement; measurement discrepancy; uncertainty analysis}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {MDPI AG}, language = {30}, ISSN = {1660-4601}, DOI = {10.3390/ijerph17062111}, stag_bib_extends_levelofaccess = {NA}, author = {Liu, Z. and Allal, D. and Cox, M. and Wiart, J.} } @Article { GaudinoCASCPC2020, subid = {1537}, title = {Robust optical frequency dissemination with a dual-polarization coherent receiver}, journal = {Optics Express}, year = {2020}, month = {3}, day = {10}, volume = {28}, number = {6}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {8494}, keywords = {Frequency dissemination, optical fiber, polarization}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.378602}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Savio, P. and Abrate, S. and Curri, V. and Gaudino, R. and Pizzocaro, M. and Calonico, D.} } @Article { LanevskiMVHKMAKI2020, subid = {1876}, title = {Determining the shape of reflectance reference samples for curved surface reflectors}, journal = {Measurement Science and Technology}, year = {2020}, month = {3}, volume = {31}, number = {5}, number2 = {16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials}, pages = {054010}, keywords = {reflectance, Monte-Carlo, reflective insulators, foil, curved surface, reference sample,additive manufacturing}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/ab68bf}, stag_bib_extends_levelofaccess = {NA}, author = {Lanevski, D. and Manoocheri, F. and Vaskuri, A. and Hameury, J. and Kersting, R. and Monte, C. and Adibekyan, A. and Kononogova, E. and Ikonen, E.} } @Proceedings { TeniouJPA2020, subid = {1617}, title = {A Fast and Rigorous Assessment of the Specific Absorption Rate (SAR) for MIMO Cellular Equipment Based on Vector Near-Field Measurements}, journal = {2020 14th European Conference on Antennas and Propagation (EuCAP)}, year = {2020}, month = {3}, number = {2020 14th}, number2 = {16NRM07: Vector SAR: SAR measurement using vector probes}, pages = {1-5}, keywords = {SAR, RF Exposure, MIMO, Planar near field measurement, Vector field measurements, Active- Antenna Measurement}, web_url = {https://hal.archives-ouvertes.fr/hal-02954816}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Copenhagen}, event_name = {2020 14th European Conference on Antennas and Propagation (EuCAP)}, event_date = {15-03-2020 to 20-03-2020}, language = {30}, DOI = {10.23919/EuCAP48036.2020.9135506}, stag_bib_extends_levelofaccess = {NA}, author = {Teniou, M. and Jawad, O. and Pannetrat, S. and Aberbour, L.} } @Article { LerouxHHJA2020, subid = {1483}, title = {Number-resolved imaging of 88 Sr atoms in a long working distance optical tweezer}, journal = {SciPost Physics}, year = {2020}, month = {3}, volume = {8}, number = {3}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {optical tweezers, atomic imaging}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Stichting SciPost}, language = {30}, ISSN = {2542-4653}, DOI = {10.21468/SciPostPhys.8.3.038}, stag_bib_extends_levelofaccess = {NA}, author = {Jackson, N. and Hanley, R. and Hill, M. and Leroux, F. and Adams, C.} } @Article { TxoperenaRLFERAPCCCCHMZK2020, subid = {1505}, title = {Towards standardisation of contact and contactless electrical measurements of CVD graphene at the macro-, micro- and nano-scale}, journal = {Scientific Reports}, year = {2020}, month = {2}, day = {21}, volume = {10}, number = {1}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, pages = {3223}, keywords = {Characterization and analytical techniques,Electronic properties and devices,Imaging techniques,Materials science,Nanoscience and technology,Physics,Graphene}, web_url = {https://www.nature.com/articles/s41598-020-59851-1}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-020-59851-1}, stag_bib_extends_levelofaccess = {NA}, author = {Melios, C. and Huang, N. and Callegaro, L. and Centeno, A. and Cultrera, A. and Cordon, A. and Panchal, V. and Arnedo, I. and Redo-Sanchez, A. and Etayo, D. and Fernandez, M. and Lopez, A. and Rozhko, S. and Txoperena, O. and Zurutuza, A. and Kazakova, O.} } @Article { HuynhMOKABKI2020, subid = {1432}, title = {Measurement setup for differential spectral responsivity of solar cells}, journal = {Optical Review}, year = {2020}, month = {2}, day = {12}, number2 = {16ENG02: PV-Enerate: Advanced PV energy rating}, keywords = {Radiometry, Solar cell, Spectral responsivity, Efficacy, Electricity, Bifacial}, web_url = {https://link.springer.com/article/10.1007\%2Fs10043-020-00584-x}, misc2 = {EMPIR 2016: Energy}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1340-6000, 1349-9432}, DOI = {10.1007/s10043-020-00584-x}, stag_bib_extends_levelofaccess = {NA}, author = {K{\"a}rh{\"a}, P. and Baumgartner, H. and Askola, J. and Kylm{\"a}nen, K. and Oksanen, B. and Maham, K. and Huynh, V. and Ikonen, E.} } @Manual { PearceABEdIKS2020, subid = {1766}, title = {Guidelines on the Calibration of Thermocouples: EURAMET Calibration Guide No. 8}, year = {2020}, month = {2}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, keywords = {Thermocouples, calibration, thermoelectric, thermometry, ITS-90, EMPRESS 2}, web_url = {https://www.euramet.org/publications-media-centre/calibration-guidelines/}, misc2 = {EMPIR 2017: Industry}, publisher = {EURAMET}, address = {Braunschweig}, language = {30}, ISBN = {ISBN 978-3-942992-57-2}, ISSN = {N/A}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISBN 978-3-942992-57-2}, author = {Pearce, J. and Arifovic, N. and Bojkovski, J. and Edler, F. and de Groot, M. and Izquierdo, G.G. and Kalemci, M. and Strnad, R.} } @Proceedings { ObatonKRMBACD2020, subid = {1759}, title = {Reference standards for XCT measurements of additively manufactured parts }, journal = {Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020}, year = {2020}, month = {2}, number2 = {17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry}, pages = {152}, keywords = {X-ray computed tomography (XCT), dimensional metrology, reference standards, additive manufacturing}, web_url = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf}, misc2 = {EMPIR 2017: Industry}, event_place = {Wels, Austria}, event_name = {10th Conference on Industrial Computed Tomography (iCT 2020)}, event_date = {04-02-2020 to 07-02-2020}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf}, author = {Obaton, A. and Klingaa, C. and Rivet, C. and Mohaghegh, K. and Baier, S. and Andreasen, J. and Carli, L. and De Chiffre, L.} } @Article { BiaekVGAGFU2020, subid = {1904}, title = {Monte Carlo–Based Quantification of Uncertainties in Determining Ocean Remote Sensing Reflectance from Underwater Fixed-Depth Radiometry Measurements}, journal = {Journal of Atmospheric and Oceanic Technology}, year = {2020}, month = {2}, volume = {37}, number = {2}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {177-196}, keywords = {Monte Carlo, Ocean colour, Uncertainty evaluation, Radiometry}, misc2 = {EMPIR 2016: Environment}, publisher = {American Meteorological Society}, language = {30}, ISSN = {0739-0572, 1520-0426}, DOI = {10.1175/JTECH-D-19-0049.1}, stag_bib_extends_levelofaccess = {NA}, author = {Białek, A. and Vellucci, V. and Gentil, B. and Antoine, D. and Gorro{\~n}o, J. and Fox, N. and Underwood, C.} } @Article { SantosCMGPAMI2020, subid = {1338}, title = {Overview and calculation of X‐ray K‐shell transition yields for comprehensive data libraries}, journal = {X-Ray Spectrometry}, year = {2020}, month = {1}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, keywords = {X-ray K-shell transition yields}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {0049-8246, 1097-4539}, DOI = {10.1002/xrs.3123}, stag_bib_extends_levelofaccess = {NA}, author = {Martins, L. and Amaro, P. and Pessanha, S. and Guerra, M. and Machado, J. and Carvalho, M. L. and Santos, J. P. and Indelicato, P.} } @Article { MinkMFMZSBSMNAAL2020, subid = {1399}, title = {Experimental Low-Latency Device-Independent Quantum Randomness}, journal = {Physical Review Letters}, year = {2020}, month = {1}, volume = {124}, number = {1}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, keywords = {quantum randomness}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, address = {1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.124.010505}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1812.07786}, author = {Zhang, Y. and Shalm, L.K. and Bienfang, J.C. and Stevens, M.J. and Mazurek, M.D. and Nam, S.W. and Abell{\'a}n, C. and Amaya, W. and Mitchell, M.W. and Fu, H. and Miller, C.A. and Mink, A. and Knill, E.} } @Article { AkoWHS2020, subid = {1673}, title = {Communication and validation of smart data in IoT-networks}, journal = {Advances in Production Engineering \& Management}, year = {2020}, volume = {15}, number = {Number 1}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, pages = {pp 107–117}, keywords = {Metrology; Measurement metadata; Information and communication technology (ICT); Smart Data; Data communication; IoT-communication; IoT-networking; Digital calibration certificate}, web_url = {http://apem-journal.org/Archives/2020/Abstract-APEM15-1_107-117.html}, misc2 = {EMPIR 2017: Industry}, publisher = {Advances in Production Engineering \& Management}, language = {30}, DOI = {10.14743/apem2020.1.353}, stag_bib_extends_levelofaccess = {NA}, author = {Acko, B. and Weber, H. and Hutzschenreuter, D. and Smith, I.} } @Article { ZilbertiKLGCBAZ2020, subid = {1334}, title = {Accuracy Assessment of Numerical Dosimetry for the Evaluation of Human Exposure to Electric Vehicle Inductive Charging Systems}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2020}, volume = {ea}, number = {ea}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-12}, keywords = {Basic restrictions, electric vehicles, electro-magnetic fields, inductive charging, numerical dosimetry, safety}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9375, 1558-187X}, DOI = {10.1109/TEMC.2019.2954111}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Bottauscio, O. and Chiampi, M. and Giaccone, L. and Liorni, I. and Kuster, N. and Zilberti, L. and Zucca, M.} } @Article { KendigVUMZ2020, subid = {1438}, title = {Dynamic Temperature Measurements of a GaN DC/DC Boost Converter at MHz Frequencies}, journal = {IEEE Transactions on Power Electronics}, year = {2020}, volume = {Not yet pr}, number = {Not yet pr}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {1-1}, keywords = {Thermoreflectance measurement , boost converter , gallium nitride, power transistor}, web_url = {http://epubs.surrey.ac.uk/853825/}, misc2 = {EMPIR 2016: Energy}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0885-8993, 1941-0107}, DOI = {10.1109/TPEL.2020.2964996}, stag_bib_extends_levelofaccess = {NA}, author = {Matei, C. and Urbonas, J. and Votsi, H. and Kendig, D. and Aaen, P.H.} } @Article { ArrheniusFBAELR2020, subid = {1602}, title = {Analytical methods for the determination of oil carryover from CNG/biomethane refueling stations recovered in a solvent}, journal = {RSC Advances}, year = {2020}, volume = {10}, number = {20}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, pages = {11907-11917}, keywords = {Biomethane oilcarryoveranaytical method}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2046-2069}, DOI = {10.1039/D0RA01399D}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, K. and Fischer, A. and B{\"u}ker, O. and Adrien, H. and El Masri, A. and Lestremau, F. and Robinson, T.} } @Article { TummonLKCCCAZSV2020, subid = {1472}, title = {Real-time pollen monitoring using digital holography}, journal = {Atmospheric Measurement Techniques}, year = {2020}, volume = {13}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {1539–1550}, keywords = {pollen monitoring, digital holography,}, web_url = {https://www.atmos-meas-tech.net/13/1539/2020/}, misc2 = {EMPIR 2016: Environment}, publisher = {Copernicus Publications}, language = {30}, DOI = {10.5194/amt-13-1539-2020}, stag_bib_extends_levelofaccess = {NA}, author = {Sauvageat , E. and Zeder, Y. and Auderset, K. and Calpini, B. and Clot, B. and Crouzy, B. and Konzelmann, T. and Lieberherr, G. and Tummon, F. and Vasilatou, K.} } @Article { GoenagaInfantePRdBAC2020, subid = {1417}, title = {The accurate determination of number concentration of inorganic nanoparticles using spICP-MS with the dynamic mass flow approach}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, keywords = {nanoparticles, nanoparticle number concentration, spICP-MS, inorganic nanoparticles, Au nanoparticles, TiO2 nanoparticles}, web_url = {https://pubs.rsc.org/en/content/articlepdf/2020/ja/c9ja00415g}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, DOI = {10.1039/c9ja00415g}, stag_bib_extends_levelofaccess = {NA}, author = {Cuello-Nu{\~n}ez, S. and Abad-{\'A}lvaro, I. and Bartczak, D. and del Castillo Busto, M.E. and Ramsay, D.A. and Pellegrino, F. and Goenaga-Infante, H.} } @Article { CuelloNunezABdRPG2020, subid = {1848}, title = {The accurate determination of number concentration of inorganic nanoparticles using spICP-MS with the dynamic mass flow approach}, journal = {Journal of Analytical Atomic Spectrometry}, year = {2020}, volume = {35}, number = {9}, number2 = {18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration}, pages = {1832-1839}, keywords = {number concentration, spICP-MS, nanoparticle}, misc2 = {EMPIR 2018: Support for Impact}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {0267-9477, 1364-5544}, DOI = {10.1039/C9JA00415G}, stag_bib_extends_levelofaccess = {NA}, author = {Cuello-Nu{\~n}ez, S. and Abad-{\'A}lvaro, I. and Bartczak, D. and Del Castillo Busto, M.E. and Ramsay, D.A. and Pellegrino, F. and Goenaga-Infante, H.} } @Article { HorenzTBNAGV2020, subid = {1716}, title = {A Study on the Analysis of Particle Size Distribution for Bimodal Model Nanoparticles by Electron Microscopy}, journal = {Microscopy and Microanalysis}, year = {2020}, volume = {26}, number = {S2}, number2 = {17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements}, pages = {2282}, keywords = {nanoparticles, size traceability, bi-modal distribution, silica, gold, electron microscoopy}, web_url = {https://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/study-on-the-analysis-of-particle-size-distribution-for-bimodal-model-nanoparticles-by-electron-microscopy/B9157A370AC198219A734770694340F3}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {Cambridge University Press}, address = {Cambridge}, language = {30}, ISSN = {1435-8115}, DOI = {10.1017/S1431927620021054}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"o}renz, C. and Tache, O. and Bartczak, D. and Nunez, S. and Abad Alvaro, I. and Goenaga-Infante, H. and Vasile-Dan Hodoroaba, V-D.} } @Proceedings { NedialkovSA2020, subid = {1890}, title = {MetForTC Traceable Measurement Capabilities for Monitoring Thermocouple Performance}, journal = {Metrology and Metrology Assurance 2020 - Proceedings}, year = {2020}, volume = {30th Inter}, number = {130 Issues}, number2 = {18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance}, pages = {15-18}, keywords = {metrology, thermocouple, traceable measurement, MetForTC}, web_url = {http://metrology-bg.org/fulltextpapers/Proceedings_MMO_2020.pdf}, misc2 = {EMPIR 2018: Research Potential}, publisher = {Sasho Nedialkov; Snezhana Spasova; Kostadin Aldev}, event_place = {Sozopol, Bulgaria}, event_name = {Metrology and Metrology Assurance 2020}, event_date = {07-09-2020 to 11-09-2020}, language = {30}, ISSN = {ISSN 2603-3194}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {ISSN: 2603-3194}, author = {Nedialkov, S. and Spasova, S. and Aldev, K.} } @Proceedings { ZhangHLBAJN2019, subid = {1422}, title = {Deep Learning Applied to Attractor Images Derived from ECG Signals for Detection of Genetic Mutation}, journal = {2019 Computing in Cardiology Conference (CinC)}, year = {2019}, month = {12}, day = {30}, volume = {46}, number2 = {18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management}, pages = {097}, keywords = {Symmetric Projection Attractor Reconstruction, ECG signals, transfer learning}, web_url = {http://www.cinc.org/archives/2019/pdf/CinC2019-097.pdf}, misc2 = {EMPIR 2018: Health}, publisher = {Computing in Cardiology}, event_place = {Singapore}, event_name = {Computing in Cardiology}, event_date = {08-09-2019 to 11-09-2019}, language = {30}, ISSN = {2325-887X}, DOI = {10.22489/CinC.2019.097}, stag_bib_extends_levelofaccess = {NA}, author = {Aston, P. and Lyle, J. and Bonet-Luz, E. and Huang, C. and Zhang, Y. and Jeevaratnam, K. and Nandi, M.} } @Article { ArrheniusBBdHM2019, subid = {1820}, title = {Hydrogen Purity Analysis: Suitability of Sorbent Tubes for Trapping Hydrocarbons, Halogenated Hydrocarbons and Sulphur Compounds}, journal = {Applied Sciences}, year = {2019}, month = {12}, day = {23}, volume = {10}, number = {1}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {120}, keywords = {hydrogen; fuel cells; hydrogen vehicle; sorbent; thermal desorption; hydrogen quality}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {MDPI AG}, language = {30}, ISSN = {2076-3417}, DOI = {10.3390/app10010120}, stag_bib_extends_levelofaccess = {NA}, author = {Arrhenius, Karine and Bohlen, Haleh and B{\"u}ker, Oliver and de Krom, Iris and Heikens, Dita and Murugan, Arul} } @Article { CalinALSSR2019, subid = {1770}, title = {Education and training tradition at IFIN-HH in radon measurement and evaluation of radiological impact}, journal = {Romanian Reports in Physics}, year = {2019}, month = {12}, day = {20}, volume = {71}, number = {4}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, pages = {906}, keywords = {Radon measurement, 222Rn standard system, Radon chamber, Indoor and outdoor radon, education and training, ANNETTE, EU project}, misc2 = {EMPIR 2016: Environment}, publisher = {Editura Academiei Romane}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {http://www.rrp.infim.ro/2019/AN71906.pdf}, author = {Calin, M.R. and Antohe, A. and Luca, A. and Stanescu, G. and Sahagia, M. and Radulescu, I.} } @Article { PottieAQCLRWKKG2019, subid = {1393}, title = {Combining fiber Brillouin amplification with a repeater laser station for fiber-based optical frequency dissemination over 1400 km}, journal = {New Journal of Physics}, year = {2019}, month = {12}, day = {13}, volume = {21}, number = {.}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {123017}, keywords = {optical frequency dissemination}, web_url = {https://iopscience.iop.org/article/10.1088/1367-2630/ab5d95}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {IOPscience}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/ab5d95}, stag_bib_extends_levelofaccess = {NA}, author = {Koke, S. and Kuhl, A. and Waterholter, T. and Raupach, S.M.F. and Lopez, O. and Cantin, E. and Quintin, N. and Amy-Klein, A. and Pottie, P.-E. and Grosche, G.} } @Article { ZilbertiCBBA2019, subid = {1328}, title = {In silico evaluation of the thermal stress induced by MRI switched gradient fields in patients with metallic hip implant}, journal = {Physics in Medicine \& Biology}, year = {2019}, month = {12}, day = {13}, volume = {64}, number = {24}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, pages = {245006}, keywords = {dosimetry, magnetic resonance imaging (MRI), MR safety, gradient coils, medical implants, prostheses, numerical simulation}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {1361-6560}, DOI = {10.1088/1361-6560/ab5428}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, A. and Bottauscio, O. and Br{\"u}hl, R. and Chiampi, M. and Zilberti, L.} } @Article { LoseroRMASG2019, subid = {1573}, title = {Quantum differential ghost microscopy}, journal = {Physical Review A}, year = {2019}, month = {12}, day = {10}, volume = {100}, number = {6}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {063818}, keywords = {Quantum Optics, Ghost Imaging, Quantum Correlations}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.100.063818}, stag_bib_extends_levelofaccess = {NA}, author = {Losero, E. and Ruo-Berchera, I. and Meda, A. and Avella, A. and Sambataro, O. and Genovese, M.} } @Article { RanitzschABBBEKKLMNPRW2019, subid = {1729}, title = {MetroMMC: Electron-Capture Spectrometry with Cryogenic Calorimeters for Science and Technology}, journal = {Journal of Low Temperature Physics}, year = {2019}, month = {12}, volume = {199}, number = {1-2}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {441-450}, keywords = {Electron-capture decay, Metallic magnetic calorimeter, Radionuclide metrology}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {0022-2291, 1573-7357}, DOI = {10.1007/s10909-019-02278-4}, stag_bib_extends_levelofaccess = {NA}, author = {Ranitzsch, P.C-O. and Arnold, D. and Beyer, J. and Bockhorn, L. and Bonaparte, J.J. and Enss, C. and Kossert, K. and Kempf, S. and Loidl, M. and Mariam, R. and N{\"a}hle, O. J. and Paulsen, M. and Rodrigues, M. and Wegner, M.} } @Article { GomezFGLDBMFMMGARPABCDH2019, subid = {1260}, title = {Hydrogen fuel quality from two main production processes: Steam methane reforming and proton exchange membrane water electrolysis}, journal = {Journal of Power Sources}, year = {2019}, month = {12}, volume = {444}, number2 = {15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications}, pages = {227170}, keywords = {Fuel cell electrical vehicles, ISO14687, Gas analysis, Hydrogen production, Hydrogen quality}, web_url = {https://www.sciencedirect.com/science/article/pii/S0378775319311632}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0378-7753}, DOI = {10.1016/j.jpowsour.2019.227170}, stag_bib_extends_levelofaccess = {NA}, author = {Bacquart, T. and Arrhenius, K. and Persijn, S. and Rojo, A. and Aupr{\^e}tre, F. and Gozlan, B. and Moore, N. and Morris, A. and Fischer, A. and Murugan, A. and Bartlett, S. and Doucet, G. and Laridant, F. and Gernot, E. and Fern{\'a}ndez, T. E. and G{\'o}mez, C. and Carr{\'e}, M. and De Reals, G. and Haloua, F.} } @Article { TrusheimFGBA2019, subid = {1315}, title = {Quantum nanophotonics with group IV defects in diamond}, journal = {Nature Communications}, year = {2019}, month = {12}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {5625}, keywords = {diamond, photonics, quantum optics, color centers, quantum technologies}, web_url = {https://www.nature.com/articles/s41467-019-13332-w}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-019-13332-w}, stag_bib_extends_levelofaccess = {NA}, author = {Bradac, C. and Gao, W. and Forneris, J. and Trusheim, M. E. and Aharonovich, I.} } @Article { HorenderSIDVA2019, subid = {1333}, title = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm−3}, journal = {Metrologia}, year = {2019}, month = {11}, day = {27}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, keywords = {aerosol, optical particle counter, calibration, clean room, counting efficiency}, misc2 = {EMPIR 2016: Environment}, publisher = {IOP Publishing}, booktitle = {Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 \(\mu\)m and number concentrations up to 2 cm\(^{−3}\)}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/ab5c84}, stag_bib_extends_levelofaccess = {NA}, author = {Vasilatou, Konstantina and Dirscherl, Kai and Iida, Kenjiro and Sakurai, Hiromu and Horender, Stefan and Auderset, Kevin} } @Article { BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019, subid = {2340}, title = {The Metrological Traceability, Performance and Precision of European Radon Calibration Facilities}, journal = {International Journal of Environmental Research and Public Health}, year = {2019}, month = {11}, day = {21}, number2 = {16ENV10: MetroRADON: Metrology for radon monitoring}, keywords = {radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability}, misc2 = {EMPIR 2016: Environment}, language = {30}, DOI = {10.3390/ijerph182212150}, stag_bib_extends_levelofaccess = {NA}, author = {Beck, T.R. and Antohe, A. and Cardellini, F. and Cucoş, A. and Fialova, E. and Grossi, C. and Hening, K. and Jensen, J. and Kastratović, D. and Krivoš{\'i}k, M. and Lobner, P. and Luca, A. and Maringer, F.J. and Michielsen, N. and Otahal, P.P.S. and Quindos, L. and Rabago, D. and Sainz, C. and Sz{\"u}cs, L. and Teodorescu, T. and Tolinsson, C. and Tugulan, C.L. and Turtiainen, T. and Vargas, A. and Vosahlik, J. and Vukoslavovic, G. and Wiedner, H. and Wołoszczuk, K.} } @Manual { EloKnKALSZSFRBSHWHHHNHMMHP2019, subid = {1433}, title = {SmartCom Digital System of Units (D-SI) Guide for the use of the metadata-format used in metrology for the easy-to-use, safe, harmonised and unambiguous digital transfer of metrological data}, year = {2019}, month = {11}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Digital-SI (D-SI) metrology data digital exchange format SmartCom data communication IoT-networking IoT-communication}, web_url = {https://zenodo.org/record/3522631\#.XlTbaTFKhaQ}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, language = {30}, DOI = {10.5281/zenodo.3522631}, stag_bib_extends_levelofaccess = {NA}, author = {Elo, T. and Kuosmanen, P. and  Mustap{\"a}{\"a}, T. and Klobucar, R. and Acko, B. and Linkeov{\'a}, I. and S{\'y}kora, J. and Zelen{\'y}, V. and Smith, I. and Forbes, A. and Rhodes, S. and Brown, C. and Scheibner, A. and Hackel, S.G. and Wiedenh{\"o}fer, T. and Heeren, W. and Haertig, F. and Hutschenreuter, D. and Nikander, P. and Hovhannisyan, K. and Maennel, O. and Muller, B. and Heindorf, L. and Paciello, V.} } @Article { KlenovskyBMASS2019, subid = {1361}, title = {Optical response of (InGa)(AsSb)/GaAs quantum dots embedded in a GaP matrix}, journal = {Physical Review B}, year = {2019}, month = {11}, volume = {100}, number = {19}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {electronic structure, quantum dot}, web_url = {https://arxiv.org/abs/1906.09842}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9950, 2469-9969}, DOI = {10.1103/PhysRevB.100.195407}, stag_bib_extends_levelofaccess = {NA}, author = {Steindl, P. and Sala, E.M. and Al{\'e}n, B. and Marr{\'o}n, D.F. and Bimberg, D. and Klenovsk{\'y}, P.} } @Article { SantosCMGPAM2019, subid = {1337}, title = {Multiconfiguration Dirac–Fock calculations of Zn K‐shell radiative and nonradiative transitions}, journal = {X-Ray Spectrometry}, year = {2019}, month = {10}, day = {29}, volume = {49}, number = {1}, number2 = {17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters}, pages = {192-199}, keywords = {Dirac–Fock method, Zn K‐shell}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Wiley}, language = {30}, ISSN = {0049-8246, 1097-4539}, DOI = {10.1002/xrs.3089}, stag_bib_extends_levelofaccess = {NA}, author = {Martins, L. and Amaro, P. and Pessanha, S. and Guerra, M. and Machado, J. and Carvalho, M. L. and Santos, J. P.} } @Article { PfleidererRRLBAPWB2019, subid = {1313}, title = {Ferromagnetic Resonance with Magnetic Phase Selectivity by Means of Resonant Elastic X-Ray Scattering on a Chiral Magnet}, journal = {Physical Review Letters}, year = {2019}, month = {10}, day = {14}, volume = {123}, number = {16}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, keywords = {Skyrmions, X-ray scattering, Ferromagnetic resonance}, web_url = {https://arxiv.org/abs/1909.08293}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.123.167201}, stag_bib_extends_levelofaccess = {NA}, author = {P{\"o}llath, S. and Aqeel, A. and Bauer, A. and Luo, C. and Ryll, H. and Radu, F. and Pfleiderer, C. and Woltersdorf, G. and Back, C. H.} } @Article { AlvesBLLPB2019, subid = {1401}, title = {Maltese cross coupling to individual cold atoms in free space}, journal = {Optics Express}, year = {2019}, month = {10}, day = {11}, volume = {27}, number = {21}, number2 = {17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems}, pages = {31042}, keywords = {Sub-Pissonian statistics, photon anti bounching}, misc2 = {EMPIR 2017: Fundamental}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.27.031042}, stag_bib_extends_levelofaccess = {NA}, author = {Bruno, Natalia and Bianchet, Lorena C. and Prakash, Vindhiya and Li, Nan and Alves, Nat{\'a}lia and Mitchell, M.W.} } @Proceedings { FortuneCRSPA2019, subid = {1198}, title = {STUDY OF NONINVASIVE INSTRUMENTS FOR THE MEASUREMENT OF X-RAY HIGH VOLTAGE TUBE}, journal = {Proceedings of CIM 2019}, year = {2019}, month = {9}, day = {24}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {Pulsed X-ray tube, KVp meters, Metrology, Dose.}, web_url = {https://www.cim2019.com}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Paris, France}, event_name = {The 19st Congr{\`e}s Internationla de M{\'e}trologie}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201902002}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {10.5281/zenodo.3335340}, author = {Agazar, M. and Perrillat, D. and Saadeddine, H. and Robert, C. and Casteignau, L. and Fortune, D.} } @Proceedings { Allal2019, subid = {1230}, title = {EMPIR European project for validation of vector array SAR measurement systems}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number = {2019 19th}, number2 = {16NRM07: Vector SAR: SAR measurement using vector probes}, pages = {3/02003}, keywords = {Specific Absorption Rate, Vector Probe Array, MIMO}, web_url = {https://cfmetrologie.edpsciences.org/articles/metrology/abs/2019/01/metrology_cim2019_02003/metrology_cim2019_02003.html}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {EDP Sciences}, event_place = {LNE}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201902003}, stag_bib_extends_levelofaccess = {NA}, author = {Allal, Djamel} } @Proceedings { BagciHYTAGD2019, subid = {1325}, title = {Improvement of dynamic pressure standard for calibration of dynamic pressure transducers}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number = {2019}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, keywords = {dynamic pressure, measurement, calibration, drop mass, dynamic calibration machine}, misc2 = {EMPIR 2017: Industry}, publisher = {EDP Sciences}, address = {17 av. du Hoggar PA de Courtaboeuf BP 112 PA de Courtaboeuf BP 112 Les Ulis cedex A 91944 France}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201927009}, stag_bib_extends_levelofaccess = {NA}, author = {Durgut, Y. and Ganioglu, O. and Aydemir, B. and Turk, A. and Yilmaz, R. and Hamarat, A. and Bağcı, E.} } @Proceedings { CucciaSBLvAMCVSBPCT2019, subid = {1781}, title = {Development of standardized methods for the analysis of amines, terpenes and ammonia in biomethane}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, month = {9}, day = {23}, number2 = {16ENG05: Biomethane: Metrology for biomethane}, keywords = {biomethane, terpenes, amines, ammonia}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201906001}, stag_bib_extends_levelofaccess = {NA}, author = {Cuccia, L. and Sanz, B. and Ballestas Castro, D. and Li, J. and van der Veen, A.M.H. and Amico di Meane, E. and Moreno, S. and Culleton, L.P. and Vorin, D. and Senn{\'e}, C. and Bougueroua, F. and Pyr{\'e}e, L. and Courtois, Y. and Tastard, C.} } @Article { LeferinkSAPH2019, subid = {1381}, title = {On-site Waveform Characterization at Static Meters Loaded with Electrical Vehicle Chargers}, journal = {2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2019}, month = {9}, volume = {Not Applic}, number = {Not Applic}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, pages = {6}, keywords = {IEEE Keywords Current measurement, Meters, Time measurement, Electromagnetic interference, Time-domain analysis, Probes, Battery charge measurement INSPEC: Controlled Indexing battery storage plants, charge measurement, electric vehicle charging, electromagnetic interference, statistical distributions, time-domain analysis INSPEC: Non-Controlled Indexing electrical vehicle chargers, static meter misreadings, noisy waveforms, electric vehicle charging stations, on-site waveform characterization, EV charging stations, TEMPS software, time domain electromagnetic interference measurement and post-processing system, amplitude probability distribution, APD, EMI measurements, baseband digitizer}, tags = {SEG}, web_url = {https://research.utwente.nl/en/publications/on-site-waveform-characterization-at-static-meters-loaded-with-el}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2019.8871469}, stag_bib_extends_levelofaccess = {NA}, author = {Hartman, T. and Pous, M. and Azpurua, M.A. and Silva, F. and Leferink, F.} } @Proceedings { ChiampiBAZ2019, subid = {1271}, title = {Uncertainty propagation in phaseless electric properties tomography}, journal = {2019 International Conference on Electromagnetics in Advanced Applications (ICEAA)}, year = {2019}, month = {9}, number2 = {18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers}, keywords = {magnetic resonance imaging (MRI), phaseless contrast source inversion (CSI), electric properties tomography (EPT), uncertainty propagation, Monte Carlo method}, web_url = {https://arxiv.org/abs/1911.02809}, misc2 = {EMPIR 2018: Health}, publisher = {IEEE}, event_place = {Granada}, event_name = {2019 International Conference on Electromagnetics in Advanced Applications}, event_date = {09-09-2019 to 13-09-2019}, language = {30}, DOI = {10.1109/ICEAA.2019.8879147}, stag_bib_extends_levelofaccess = {NA}, author = {Arduino, Alessandro and Bottauscio, O. and Chiampi, M. and Zilberti, L.} } @Article { KorpelainenGKAS2019, subid = {1298}, title = {Atomic force microscope with an adjustable probe direction and piezoresistive cantilevers operated in tapping-mode / Im Tapping-Modus betriebenes Rasterkraftmikroskop mit einstellbarer Antastrichtung und piezoresistiven Cantilevern}, journal = {tm - Technisches Messen}, year = {2019}, month = {9}, volume = {86}, number = {s1}, number2 = {15SIB09: 3DNano: Traceable three-dimensional nanometrology}, pages = {12-16}, keywords = {Rasterkraftmikroskopie; piezoresistive Cantilever; Nanomessmaschine}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Walter de Gruyter GmbH}, language = {30}, ISSN = {2196-7113, 0171-8096}, DOI = {10.1515/teme-2019-0035}, stag_bib_extends_levelofaccess = {NA}, author = {Schaude, J. and Albrecht, J. and Kl{\"o}pzig, U. and Gr{\"o}schl, A.C. and Hausotte, Tino} } @Proceedings { RoviraGSFA2019, subid = {1197}, title = {Characterisation of high voltage dividers for X-ray measurements}, journal = {Proceedings of IHS2019}, year = {2019}, month = {8}, day = {26}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, keywords = {High Voltage, Pulsed X-ray tube , Divider, Metrology}, misc2 = {EMPIR 2015: Pre-Co-Normative}, event_place = {Budapest, Hungary,}, event_name = {The 21st International Symposium on High Voltage Engineering (ISH2019)}, event_date = {26-08-2019 to 30-08-2019}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3243494}, author = {Rovira, J. and Garnacho, F. and Saadeddine, H. and Fortune, D. and Agazar, M.} } @Proceedings { VentreMDBCFPPRSTBASSGHBZFDKL2019, subid = {1200}, title = {Metrology for Inductive Charging of Electric Vehicles (MICEV)}, journal = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, year = {2019}, month = {8}, day = {19}, volume = {Electrical}, number = {2019 AEIT}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {6 pages}, keywords = {Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety}, tags = {SEG}, web_url = {http://arxiv.org/abs/1908.11108}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Turin (Italy)}, event_name = {2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE)}, event_date = {02-07-2019 to 04-07-2019}, language = {30}, ISBN = {978-8-8872-3743-6}, ISSN = {0018-9219}, DOI = {10.23919/EETA.2019.8804498}, stag_bib_extends_levelofaccess = {NA}, author = {Zucca, M. and Bottauscio, O. and Harmon, S. and Guilizzoni, R. and Schilling, F. and Schmidt, M. and Ankarson, P. and Bergsten, T. and Tammi, K. and Sainio, P. and Romero, J.B. and Puyal, E.L. and Pichon, L. and Freschi, F. and Cirimele, V. and Bauer, P. and Dong, J. and Maffucci, A. and Ventre, S. and Femia, N. and Di Capua, G. and Kuster, N. and Liorni, I.} } @Article { WendischPMWIBABOKK2019, subid = {1057}, title = {Optical Pulse-Drive for the Pulse-Driven AC Josephson Voltage Standard}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2019}, month = {8}, volume = {29}, number = {5}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {1200205}, keywords = {Optical pulses, Optical fibers, Optical distortion, High-speed optical techniques, Optical attenuators, Optical crosstalk}, web_url = {https://ieeexplore.ieee.org/document/8643521}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2019.2899851}, stag_bib_extends_levelofaccess = {NA}, author = {Kieler, O. and Karlsen, B. and Ohlckers, P.A. and Bardalen, E. and Akram, M.N. and Behr, R. and Ireland, J. and Williams, J. and Malmbekk, H. and Palafox, L. and Wendisch, R.} } @Article { AslanDSWZOY2019, title = {Comparison of two methods for the rapid radiochemical analysis of air dust samples in emergency situations}, journal = {Applied Radiation and Isotopes}, year = {2019}, month = {8}, volume = {150}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {120-126}, keywords = {Emergency preparedness, airborne radioactivity, radiochemical analysis, extraction chromatography}, web_url = {https://www.sciencedirect.com/science/article/pii/S0969804317308229?dgcid=raven_sd_via_email}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, address = {230 Park Avenue Suite 800 Shantae McGee New York NY 10169-0935 United States}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2019.04.031}, stag_bib_extends_levelofaccess = {NA}, author = {Aslan, N. and Dirican, A. and Seferinoğlu, M. and Wershofen, H. and Zapata-Garc{\'i}a, D. and {\"O}z\c{c}ayan, G. and Y{\"u}cel, {\"U}.} } @Article { OrtolanoARCETCZSCC2019, subid = {1227}, title = {Mapping the conductivity of graphene with Electrical Resistance Tomography}, journal = {Scientific Reports}, year = {2019}, month = {7}, day = {23}, volume = {9}, number = {1}, number2 = {16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics}, keywords = {graphene, electrical resistance tomography, conductivity, terahertz spectroscopy}, web_url = {https://doi.org/10.1038/s41598-019-46713-8}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-46713-8}, stag_bib_extends_levelofaccess = {NA}, author = {Cultrera, A. and Serazio, D. and Zurutuza, A. and Centeno, A. and Txoperena, O. and Etayo, D. and Cordon, A. and Redo-Sanchez, A. and Arnedo, I. and Ortolano, M. and Callegaro, L.} } @Article { MurugandBvAtH2019, subid = {1816}, title = {Measurement challenges for hydrogen vehicles}, journal = {International Journal of Hydrogen Energy}, year = {2019}, month = {7}, volume = {44}, number = {35}, number2 = {16ENG01: MetroHyVe: Metrology for hydrogen vehicles}, pages = {19326-19333}, keywords = {Hydrogen; Fuel cell; Vehicles; ISO 14687; Metrology; Measurement; Flow metering; Quality control}, tags = {EnG}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2019.03.190}, stag_bib_extends_levelofaccess = {NA}, author = {Murugan, A. and de Huu, M. and Bacquart, T. and van Wijk, J. and Arrhenius, K. and te Ronde, I. and Hemfrey, D.} } @Article { SilanderHFZA2019, subid = {1542}, title = {Gas equilibration gas modulation refractometry for assessment of pressure with sub-ppm precision}, journal = {Journal of Vacuum Science \& Technology B}, year = {2019}, month = {7}, volume = {37}, number = {4}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {042901}, keywords = {Gas equilibration gas modulation refractometry for assessment of pressure with sub-ppm precision}, misc2 = {EMPIR 2014: Industry}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/1.5090860}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Hausmaninger, T. and Forss{\'e}n, C. and Zelan, M. and Axner, O.} } @Article { VasilatouAH2019_2, subid = {1220}, title = {Facility for calibration of optical and condensation particle counters based on a turbulent aerosol mixing tube and a reference optical particle counter}, journal = {Review of Scientific Instruments}, year = {2019}, month = {7}, volume = {90}, number = {7}, number2 = {16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality}, pages = {075111}, keywords = {optical particle counters, aerosol instrumentation, aerosol generation setup, turbulent flow tube, particle homogenization, isokinetic sampling ports, particle counter, Stable and reproducible aerosols, polystyrene latex particles}, web_url = {https://aip.scitation.org/doi/10.1063/1.5095853}, misc2 = {EMPIR 2016: Environment}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.5095853}, stag_bib_extends_levelofaccess = {NA}, author = {Horender, S. and Auderset, K. and Vasilatou, K.} } @Article { AdibekyanKMH2019, subid = {1287}, title = {Characterization, calibration and validation of an industrial emissometer}, journal = {Journal of Sensors and Sensor Systems}, year = {2019}, month = {6}, day = {27}, volume = {8}, number = {1}, number2 = {16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials}, pages = {233-242}, keywords = {emissivity, TIR 100-2 emissometer, characterization, calibration, reflective foils}, web_url = {https://www.j-sens-sens-syst.net/8/233/2019/}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {2194-878X}, DOI = {10.5194/jsss-8-233-2019}, stag_bib_extends_levelofaccess = {NA}, author = {Kononogova, Elena and Adibekyan, Albert and Monte, Christian and Hollandt, J{\"o}rg} } @Article { PottieLATMQFCX2019, subid = {1117}, title = {Two-Branch Fiber Link for International Clock Networks}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2019}, month = {6}, volume = {68}, number = {6}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {2195-2200}, keywords = {Optical fiber links, phase lock loop, phase measurement, two-way noise compensation, ultrastable frequencytransfer}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2886865}, stag_bib_extends_levelofaccess = {NA}, author = {Xu, D. and Cantin, E. and Frank, F. and Quintin, N. and Meynadier, F. and Tuckey, P. and Amy-Klein, A. and Lopez, O. and Pottie, P.E.} } @Article { HeinrichPSDKFA2019, subid = {1067}, title = {Influence of Microwave Probes on Calibrated On-Wafer Measurements}, journal = {IEEE Transactions on Microwave Theory and Techniques}, year = {2019}, month = {5}, volume = {67}, number = {5}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1892-1900}, keywords = {Calibration, coplanar waveguide, electromagnetic field simulation, multiline-thru-reflect-line, on-wafer probing, probes}, web_url = {https://www.fbh-berlin.de/fileadmin/downloads/Publications/2019/FINAL_VERSION_repository.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9480, 1557-9670}, DOI = {10.1109/TMTT.2019.2903400}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Kahne, B. and Fritzsch, T. and Arz, U. and Heinrich, W.} } @Manual { SchmucklePASHL2019, subid = {1084}, title = {Guidelines for the design of calibration substrates, including the suppression of parasitic modes for frequencies up to and including 325 GHz}, year = {2019}, month = {4}, day = {24}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Calibration, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), on-wafer probing, probes}, web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424A}, misc2 = {EMPIR 2014: Industry}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, language = {30}, DOI = {10.7795/530.20190424A}, stag_bib_extends_levelofaccess = {NA}, author = {Schmuckle, F.J. and Phung, G.N. and Arz, U. and Spirito, M. and Heinrich, W. and Lozar, R.} } @Manual { HaddadiDLHGLHPZWHMSRKPASC2019, subid = {1085}, title = {Best Practice Guide for Planar S-Parameter Measurements using Vector Network Analysers}, year = {2019}, month = {4}, day = {24}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), microwave probes, extreme impedance measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise, vector network analyzer (VNA)}, web_url = {https://oar.ptb.de/resources/show/10.7795/530.20190424B}, misc2 = {EMPIR 2014: Industry}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, language = {30}, DOI = {10.7795/530.20190424B}, stag_bib_extends_levelofaccess = {NA}, author = {Haddadi, K. and Dambrine, G. and Lozar, R. and Helmreich, K. and Gold, G. and Lomakin, K. and Heinrich, W. and Phung, G.N. and Zeier, M. and Wollensack, M. and Hoffmann, J. and Mubarak, F. and Shang, X. and Ridler, N. and Kuhlmann, K. and Probst, T. and Arz, U. and Spirito, M. and Clarke, R.} } @Article { XuLLALAGMWTLATSPDA2019, subid = {1116}, title = {High-precision methanol spectroscopy with a widely tunable SI-traceable frequency-comb-based mid-infrared QCL}, journal = {Optica}, year = {2019}, month = {4}, volume = {6}, number = {4}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {411}, keywords = {Diode lasers; Laser beams; Laser sources; Optical components; Saturation spectroscopy; Tunable lasers;}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.6.000411}, stag_bib_extends_levelofaccess = {NA}, author = {Santagata, R. and Tran, D.B.A. and Argence, B. and Lopez, O. and Tokunaga, S.K. and Wiotte, F. and Mouhamad, H. and Goncharov, A. and Abgrall, M. and Le Coq, Y. and Alvarez-Martinez, H. and Le Targat, R. and Lee, W.K. and Xu, D. and Pottie, P.E. and Darqui{\'e}, B. and Amy-Klein, A.} } @Article { DarquieSPXATAWTLMAGLLAL2019, subid = {1116}, title = {High-precision methanol spectroscopy with a widely tunable SI-traceable frequency-comb-based mid-infrared QCL}, journal = {Optica}, year = {2019}, month = {4}, volume = {6}, number = {4}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {411}, keywords = {optical Fiber, optical frequency transfer}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.6.000411}, stag_bib_extends_levelofaccess = {NA}, author = {Santagata, R. and Tran, D.B.A. and Argence, B. and Lopez, O. and Tokunaga, S.K. and Wiotte, F. and Mouhamad, H. and Goncharov, A. and Abgrall, M. and Le Coq, Y. and Alvarez-Martinez, H. and Le Targat, R. and Lee, W.K. and Xu, D. and Pottie, P.E. and Darqui{\'e}, B. and Amy-Klein, A.} } @Article { HanselaerAL2019, subid = {1223}, title = {Development of an image-based gloss measurement instrument}, journal = {Journal of Coatings Technology and Research}, year = {2019}, month = {4}, volume = {16}, number = {4}, number2 = {16NRM08: BiRD: Bidirectional reflectance definitions}, pages = {913-921}, keywords = {specular gloss meterimage-based gloss measurementcontrast glossorange peel}, web_url = {https://rdcu.be/bTtmT}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1547-0091, 1935-3804}, DOI = {10.1007/s11998-019-00184-8}, stag_bib_extends_levelofaccess = {NA}, author = {Leloup, F.B. and Audenaert, J. and Hanselaer, P.} } @Article { BuechelerTSALWCW2019, subid = {1241}, title = {Time-resolved photoluminescence on double graded Cu(In,Ga)Se2 – Impact of front surface recombination and its temperature dependence}, journal = {Science and Technology of Advanced Materials}, year = {2019}, month = {4}, volume = {20}, number = {1}, number2 = {16ENG03: HyMet: Hybrid metrology for thin films in energy applications}, pages = {313-323}, keywords = {time-resolved photoluminescence}, misc2 = {EMPIR 2016: Energy}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1468-6996, 1878-5514}, DOI = {10.1080/14686996.2019.1586583}, stag_bib_extends_levelofaccess = {NA}, author = {Weiss, T.P. and Carron, R. and Wolter, M.H. and L{\"o}ckinger, J. and Avancini, E. and Siebentritt, S. and Buecheler, S. and Tiwari, A.N.} } @Article { MarquesTUWdLLLGHA2019, subid = {1369}, title = {Topology Driven g-Factor Tuning in Type-II Quantum Dots}, journal = {Physical Review Applied}, year = {2019}, month = {4}, volume = {11}, number = {4}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {044011}, keywords = {quantum dots, optoelectronics, spin-orbit coupling, Aharonov-Bohm effect}, web_url = {https://arxiv.org/abs/1710.08828}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.11.044011}, stag_bib_extends_levelofaccess = {NA}, author = {Llorens, J.M. and Lopes-Oliveira, V. and L{\'o}pez-Richard, V. and de Oliveira, E.R. Cardozo and Wewi{\'o}r, L. and Ulloa, J.M. and Teodoro, M.D. and Marques, G.E. and Garc{\'i}a-Crist{\'o}bal, A. and Hai, G.-Q. and Al{\'e}n, B.} } @Article { KiselevDMFVPABBLXBHD2019, subid = {1024}, title = {Long Slender Piezo-Resistive Silicon Microprobes for Fast Measurements of Roughness and Mechanical Properties inside Micro-Holes with Diameters below 100 µm}, journal = {Sensors 2019}, year = {2019}, month = {3}, day = {22}, volume = {19(6)}, number = {1410}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {cantilever microprobe; high-speed; contact resonance; tip wear; piezo-resistive; mechanical damping; tip-testing standard}, web_url = {https://www.mdpi.com/1424-8220/19/6/1410}, misc2 = {EMPIR 2017: Industry}, publisher = {MDPI AG}, address = {Basel}, language = {30}, DOI = {10.3390/s19061410}, stag_bib_extends_levelofaccess = {NA}, author = {Brand, U. and XU, M. and Doering, L. and Langfahl-Klabes, J. and Behle, H. and B{\"u}tefisch, S. and Ahbe, T. and Peiner, E. and V{\"o}llmeke, S. and Frank, T. and Mickan, B. and Kiselev, I. and Hauptmannl, M. and Drexel, M.} } @Article { KurlyandskayaSCMBACT2019, subid = {944}, title = {Specific loss power measurements by calorimetric and thermal methods on \(\gamma\)-Fe2O3 nanoparticles for magnetic hyperthermia}, journal = {Journal of Magnetism and Magnetic Materials}, year = {2019}, month = {3}, volume = {473}, number2 = {16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles}, pages = {403-409}, keywords = {Magnetic hyperthermia, Fe-oxide, Magnetic nanoparticles}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-8853}, DOI = {10.1016/j.jmmm.2018.10.107}, stag_bib_extends_levelofaccess = {NA}, author = {Co{\"i}sson, M. and Barrera, G. and Appino, C. and Celegato, F. and Martino, L. and Safronov, A.P. and Kurlyandskaya, G.V. and Tiberto, P.} } @Article { GramegnaRPARVDG2019, subid = {1006}, title = {Optimal estimation of entanglement and discord in two-qubit states}, journal = {Scientific Reports}, year = {2019}, month = {2}, day = {28}, volume = {9}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1-9}, keywords = {quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-39334-8}, stag_bib_extends_levelofaccess = {NA}, author = {Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Ruo Berchera, I. and Degiovanni, I.P. and Genovese, M.} } @Article { GramegnaRPARVDG20190, subid = {1006}, title = {Optimal estimation of entanglement and discord in two-qubit states}, journal = {Scientific Reports}, year = {2019}, month = {2}, day = {28}, volume = {9}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1-9}, keywords = {quantum technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-39334-8}, stag_bib_extends_levelofaccess = {NA}, author = {Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Ruo Berchera, I. and Degiovanni, I.P. and Genovese, M.} } @Article { GramegnaRPARVDG20191, subid = {1006}, title = {Optimal estimation of entanglement and discord in two-qubit states}, journal = {Scientific Reports}, year = {2019}, month = {2}, day = {28}, volume = {9}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1-9}, keywords = {quantum technologies}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-019-39334-8}, stag_bib_extends_levelofaccess = {NA}, author = {Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Ruo Berchera, I. and Degiovanni, I.P. and Genovese, M.} } @Article { PiacentiniGRAVVMDG2019, subid = {1005}, title = {Theoretical description and experimental simulation of quantum entanglement near open time-like curves via pseudo-density operators}, journal = {Nature Communications}, year = {2019}, month = {1}, day = {14}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, pages = {1-7}, keywords = {quantum entanglement, pseudo-density operators,}, web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-018-08100-1}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Article { PiacentiniGRAVVMDG20190, subid = {1005}, title = {Theoretical description and experimental simulation of quantum entanglement near open time-like curves via pseudo-density operators}, journal = {Nature Communications}, year = {2019}, month = {1}, day = {14}, volume = {10}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, pages = {1-7}, keywords = {quantum entanglement, pseudo-density operators,}, web_url = {https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-018-08100-1}, stag_bib_extends_levelofaccess = {NA}, author = {Marletto, C. and Vedral, V. and Virz{\`i}, S. and Rebufello, E. and Avella, A. and Piacentini, F. and Gramegna, M. and Degiovanni, I.P. and Genovese, M.} } @Proceedings { SavinA2019, subid = {977}, title = {On-Wafer Residual Error Correction Through Adaptive Filtering of Verification Line Measurements}, journal = {2018 International Workshop on Computing, Electromagnetics, and Machine Intelligence (CEMi)}, year = {2019}, month = {1}, day = {14}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {79-80}, keywords = {uncertainty,calibration,standards,measurement uncertainty,coplanar waveguides,scattering, parameters,microwave measurement}, web_url = {https://doi.org/10.1109/CEMI.2018.8610566}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Stellenbosch, South Africa}, event_name = {2018 International Workshop on Computing, Electromagnetics, and Machine Intelligence (CEMi)}, event_date = {21-11-2018 to 24-11-2018}, language = {30}, ISBN = {978-1-5386-7845-9}, DOI = {10.7795/EMPIR.14IND02.CA.20190403F}, stag_bib_extends_levelofaccess = {NA}, author = {Savin, A. and Arz, U.} } @Article { VavassoriASCGPRCC2019, subid = {1307}, title = {Magnetic imaging using geometrically constrained nano-domain walls}, journal = {Nanoscale}, year = {2019}, volume = {11}, number = {10}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {4478-4488}, keywords = {MFM}, web_url = {https://pubs.rsc.org/en/content/articlelanding/2019/NR/C8NR07729K\#!divAbstract}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2040-3364, 2040-3372}, DOI = {10.1039/C8NR07729K}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Corte-Le{\'o}n, H. and Rodr{\'i}guez, L A. and Pancaldi, M. and Gatel, C. and Cox, D. and Snoeck, E. and Antonov, V. and Vavassori, P.} } @Proceedings { SpasovaBNOSCTHZSAV2019, subid = {1490}, title = {A new EMPIR Project “MetForTC” for Developing Traceable Measurement Capabilities for Monitoring Thermocouple Performance}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, volume = {-}, number = {2019}, number2 = {18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance}, pages = {5/18006}, keywords = {EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple}, misc2 = {EMPIR 2018: Research Potential}, publisher = {EDP Sciences}, event_place = {Paris, France}, event_name = {19th International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201918006}, stag_bib_extends_levelofaccess = {NA}, author = {Arifovic, N. and Sestan, D. and Zvizdić, D. and Hozic, N. and Turz{\'o}-Andr{\'a}s, E. and Čohodarević, S. and Strnad, R. and Opel, K. and Neagu, D. and Bordianu, C. and Spasova, S. and Vukičević, T.} } @Proceedings { SmithFAHP2019, subid = {1515}, title = {Risk calculations for conformity assessment in practice}, journal = {19th International Congress of Metrology (CIM2019)}, year = {2019}, number2 = {17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty}, keywords = {Conformity assessmentRiskCAsoftUncertainty}, tags = {MAT}, misc2 = {EMPIR 2017: Support for Impact}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {International Congress of Metrology}, event_date = {24-09-2019 to 26-09-2019}, language = {30}, DOI = {10.1051/metrology/201916001}, stag_bib_extends_levelofaccess = {NA}, author = {Allard, A. and Fischer, N. and Smith, I. and Harris, P. and Pendrill, L.} } @Article { AkramMNBKKO2019, subid = {1056}, title = {Pulsation of InGaAs photodiodes in liquid helium for driving Josephson arrays in ac voltage realization}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2019}, volume = {29}, number = {7}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {1200308}, keywords = {Photodiodes, Integrated circuits, Josephson junctions, Optical distortion, Junctions, Bit rate, Optical pulses}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1051-8223, 1558-2515, 2378-707}, DOI = {10.1109/TASC.2019.2901573}, stag_bib_extends_levelofaccess = {NA}, author = {Karlsen, B. and Kieler, O. and Behr, R. and Tuan Nguyen, T.A. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.A.} } @Proceedings { FateevPDJAWSSHSLAS2018, subid = {1022}, title = {Development of measurement and calibration techniques for dynamic pressures and temperatures (DynPT): background and objectives of the 17IND07 DynPT project in the European Metrology Programme for Innovation and Research (EMPIR)}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {12}, volume = {1065}, number = {2018}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {162015}, keywords = {dynamic pressure, dynamic temperature, traceability, measurement standard, calibration method, calibration procedure, measurement uncertainty, validation, reliability, pressure measurement, temperature measurement}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, event_place = {Belfast}, event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/16/162015}, stag_bib_extends_levelofaccess = {NA}, author = {Saxholm, S. and Saxholm, S. and H{\"o}gstr{\"o}m, R. and Sarraf, C. and Sutton, G. and Wynands, R. and Arrh{\'e}n, F. and J{\"o}nsson, G. and Durgut, Y. and Peruzzi, A. and Fateev, A. and Liverts, M. and Adolfse, C.} } @Article { SchioppoNMMLLIHCFBBBBAWSLWZZZ2018, subid = {958}, title = {New bounds on dark matter coupling from a global network of optical atomic clocks}, journal = {Science Advances}, year = {2018}, month = {12}, volume = {4}, number = {12}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {eaau4869}, keywords = {optical atomic clocks, sensor network, dark matter}, web_url = {http://advances.sciencemag.org/content/4/12/eaau4869.full}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Association for the Advancement of Science (AAAS)}, language = {30}, ISSN = {2375-2548}, DOI = {10.1126/sciadv.aau4869}, stag_bib_extends_levelofaccess = {NA}, author = {Wcisło, P. and Ablewski, P. and Beloy, K. and Bilicki, S. and Bober, M. and Brown, R. and Fasano, R. and Ciuryło, R. and Hachisu, H. and Ido, T. and Lodewyck, J. and Ludlow, A. and McGrew, W. and Morzyński, P. and Nicolodi, D. and Schioppo, M. and Sekido, M. and Le Targat, R. and Wolf, P. and Zhang, X. and Zjawin, B. and Zawada, M.} } @Proceedings { nceABADU2018, subid = {1023}, title = {Development of Dynamic Calibration Machine for Pressure Transducers}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {12}, volume = {1065}, number = {2018}, number2 = {17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures}, pages = {162013}, keywords = {dynamic pressure, dynamic calibration, pressure measurement, pressure calibration, pressure transducer, traceability, signal conditioning, drop mass}, web_url = {https://doi.org/10.1088/1742-6596/1065/16/162013}, misc2 = {EMPIR 2017: Industry}, publisher = {IOP Publishing}, event_place = {Belfast}, event_name = {XXII World Congress of the International Measurement Confederation (IMEKO 2018)}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, ISBN = {1742-6588, 1742-6596}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/16/162013}, stag_bib_extends_levelofaccess = {NA}, author = {Durgut, Y. and Aydemir, B. and Bağcı, E. and Akşahin, E. and İnce, A.T. and Uslukılı\c{c}, U.} } @Article { DorscherASBSSPOHHSL2018, subid = {1054}, title = {Towards an optical clock for space: Compact, high-performance optical lattice clock based on bosonic atoms}, journal = {Physical Review A}, year = {2018}, month = {11}, day = {29}, volume = {98}, number = {5}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {053443}, keywords = {optical clocks, optical lattice clock, isotope shift, clock comparisons}, web_url = {https://www.ptb.de/cms/fileadmin/internet/fachabteilungen/abteilung_4/4.3_quantenoptik_und_laengeneinheit/4.32/ori18.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2469-9926, 2469-9934}, DOI = {10.1103/PhysRevA.98.053443}, stag_bib_extends_levelofaccess = {NA}, author = {Origlia, S. and Pramod, M.S. and Schiller, S. and Singh, Y. and Bongs, K. and Schwarz, R. and Al-Masoudi, A. and D{\"o}rscher, S. and Herbers, S. and H{\"a}fner, S. and Sterr, U. and Lisdat, C.} } @Article { FarooqAMLPLVF2018, subid = {1028}, title = {Autoignition studies of Liquefied Natural Gas (LNG) in a shock tube and a rapid compression machine}, journal = {Fuel}, year = {2018}, month = {11}, volume = {232}, number2 = {16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel}, pages = {423-430}, keywords = {Alternative fuels, combustion, kinetics, LNG, Shock tube, RCM}, tags = {EnG}, web_url = {https://www.sciencedirect.com/science/article/pii/S0016236118308238}, misc2 = {EMPIR 2016: Energy}, publisher = {Elsevier BV}, language = {30}, ISSN = {0016-2361}, DOI = {10.1016/j.fuel.2018.04.168}, stag_bib_extends_levelofaccess = {NA}, author = {Vallabhuni, S.K. and Lele, A.D. and Patel, V. and Lucassen, A. and Moshammer, K. and AlAbbad, M. and Farooq, A. and Fernandes, R.X.} } @Article { MehdiSouzaniANA2018, subid = {863}, title = {A novel hybrid trust region minimax fitting algorithm for accurate dimensional metrology of aspherical shapes}, journal = {Measurement}, year = {2018}, month = {10}, volume = {127}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {134-140}, keywords = {Trust region methods, Aspheric shapes, Minimax, Chebyshev fitting, Minimization, Form error, Dimensional metrology, Ultra-high precision engineering}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2018.05.071}, stag_bib_extends_levelofaccess = {NA}, author = {Arezki, Y. and Nouira, H. and Anwer, N. and Mehdi-Souzani, C.} } @Article { HisamotoRHLASTYTLSK2018, subid = {595}, title = {Quantum Dipole Effects in a Silicon Transistor under High Electric Fields}, journal = {Journal of the Physical Society of Japan}, year = {2018}, month = {9}, day = {15}, volume = {87}, number = {9}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {094801}, keywords = {Si, CMOS, transistor, quantum dipole, Heisenberg model}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Physical Society of Japan}, language = {30}, ISSN = {0031-9015, 1347-4073}, DOI = {10.7566/jpsJ.87.094801}, stag_bib_extends_levelofaccess = {NA}, author = {Saito, S. and Li, Z. and Yoshimoto, H, and Tomita, I. and Tsuchiya, Y. and Sasago, Y. and Arimoto, H. and Liu, F. and Husain, M.K. and Hisamoto, D. and Rutt, H.N. and Kurihara, S.} } @Proceedings { AllalARJG2018, subid = {1032}, title = {Efficient Experimental Assessment of The Specific Absorption Rate (SAR) Induced by MIMO Wireless Communication Devices; Application of Vector Near-Field Measurement System}, journal = {2018 IEEE Conference on Antenna Measurements \& Applications (CAMA)}, year = {2018}, month = {9}, number2 = {16NRM07: Vector SAR: SAR measurement using vector probes}, pages = {1-4}, keywords = {SAR, MIMO, Planar Near-Field Measurement System, Vector Field Measurement}, web_url = {https://hal.archives-ouvertes.fr/hal-02376333}, misc2 = {EMPIR 2016: Pre-Co-Normative}, publisher = {IEEE}, event_place = {Vasteras}, event_name = {2018 IEEE Conference on Antenna Measurements \& Applications (CAMA)}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1109/CAMA.2018.8530621}, stag_bib_extends_levelofaccess = {NA}, author = {Aberbour, L. and Jawad, O. and Ramdani, M. and Giry, P. and Julien, T.} } @Proceedings { ProbstHDSPA2018_2, subid = {939}, title = {Impact of Substrate Modes on mTRL-Calibrated CPW Measurements in G Band}, journal = {2018 48th European Microwave Conference (EuMC)}, year = {2018}, month = {9}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {on-wafer probes, coplanar waveguides (CPW), substrate modes, calibration}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/impact-of-substrate-modes-on-mtrl-calibrated-cpw-measurements-in-g-band}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Madrid}, event_name = {2018 48th European Microwave Conference}, event_date = {23-09-2018 to 28-09-2018}, language = {30}, DOI = {10.23919/EuMC.2018.8541813}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Heinrich, W. and Probst, T. and Arz, U.} } @Proceedings { AzevedoGoncalvesAGLDGD2018, subid = {1701}, title = {Investigating the potential of SiGe Diode in BiCMOS 55nm for power detection and datacom applications at 300 GHz}, journal = {2018 43rd International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz)}, year = {2018}, month = {9}, volume = {-}, number = {-}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {-}, keywords = {-}, web_url = {https://zenodo.org/record/4295560\#.X8M60s1Kg2x}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Nagoya, Japan}, event_name = {43rd International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz)}, event_date = {09-09-2018 to 14-09-2018}, language = {30}, ISBN = {978-1-5386-3810-1}, ISSN = {2162-2035}, DOI = {10.1109/IRMMW-THz.2018.8510217}, stag_bib_extends_levelofaccess = {NA}, author = {Azevedo Goncalves, J.C. and Alaji, I. and Gloria, D. and L{\'e}pilliet, S. and Danneville, F. and Gaquiere, C. and Ducournau, G.} } @Proceedings { AzevedoGoncalvesAGGGLDDG2018, subid = {1702}, title = {On Wafer Millimetre Wave Power Detection Using a PN Junction Diode in BiCMOS 55 nm for In-Situ Large Signal Characterization}, journal = {2018 48th European Microwave Conference (EuMC)}, year = {2018}, month = {9}, volume = {-}, number = {-}, number2 = {16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications}, pages = {-}, keywords = {-}, web_url = {https://zenodo.org/record/4294934\#.X8XOjs1Kg2z}, misc2 = {EMPIR 2016: Energy}, publisher = {IEEE}, event_place = {Madrid Spain}, event_name = {On Wafer Millimetre Wave Power Detection Using a PN Junction Diode in BiCMOS 55 nm for In-Situ Large Signal Characterization}, event_date = {23-09-2018 to 27-09-2018}, language = {30}, ISBN = {978-2-87487-051-4}, ISSN = {-}, DOI = {10.23919/EuMC.2018.8541387}, stag_bib_extends_levelofaccess = {NA}, author = {Azevedo Goncalves, Joao Carlos and Alaji, Issa and Gloria, Daniel and Gidel, Vincent and Gianesello, Frederic and Lepilliet, Sylvie and Ducournau, Guillaume and Danneville, Francois and Gaquiere, C.} } @Article { KoppmannHGRAMO2018, title = {A large-area blackbody for in-flight calibration of an infrared interferometer deployed on board a long-duration balloon for stratospheric research}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {8}, day = {14}, volume = {11}, number = {8}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {4757-4762}, keywords = {GLORIA, Calibration}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-4757-2018}, stag_bib_extends_levelofaccess = {NA}, author = {Koppmann, R. and Hollandt, J. and Gutschwager, B. and Reiniger, M. and Adibekyan, A. and Monte, C. and Olschewski, F.} } @Article { YooSWWIAKR2018, subid = {842}, title = {Extrusion 3D Printing of Paracetamol Tablets from a Single Formulation with Tunable Release Profiles Through Control of Tablet Geometry}, journal = {AAPS PharmSciTech}, year = {2018}, month = {8}, day = {10}, volume = {19}, number = {11}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, keywords = {3D printing; paracetamol; sustained release; immediate release; personalised medicine; geometry}, web_url = {https://link.springer.com/article/10.1208/s12249-018-1107-z}, misc2 = {EMPIR 2015: Health}, publisher = {American Association of Pharmaceutical Scientists (AAPS)}, language = {30}, ISSN = {1530-9932}, DOI = {10.1208/s12249-018-1107-z}, stag_bib_extends_levelofaccess = {NA}, author = {Khaled, S.A. and Alexander, M.R. and Irvine, D.J. and Wildman, R.D. and Wallace, M.J. and Sharpe, S. and Yoo, J. and Roberts, C.J.} } @Article { KuuskABVF2018, subid = {2453}, title = {Implication of Illumination Beam Geometry on Stray Light and Bandpass Characteristics of Diode Array Spectrometer}, journal = {IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing}, year = {2018}, month = {8}, volume = {11}, number = {8}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {2925-2932}, keywords = {Optical fibre devices, Optical spectroscopy, stray light, laser measurement, Illumination beam geometry}, misc2 = {EMPIR 2016: Environment}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1939-1404, 2151-1535}, DOI = {10.1109/JSTARS.2018.2841772}, stag_bib_extends_levelofaccess = {NA}, author = {Kuusk, J. and Ansko, I. and Bialek, A. and Vendt, R. and Fox, N.} } @Article { NeuvonenAALBBPMSPFWSBL2018, subid = {1062}, title = {Establishing traceability for liquid density measurements in Europe: 17RPT02-rhoLiq a new EMPIR joint research project}, journal = {Journal of Physics: Conference Series}, year = {2018}, month = {8}, volume = {1065}, number = {8}, number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements}, pages = {082013}, keywords = {density of liquids; hydrostatic weighing; oscillation-type density meters}, web_url = {https://iopscience.iop.org/article/10.1088/1742-6596/1065/8/082013/pdf}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IOP Publishing}, address = {Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/1065/8/082013}, stag_bib_extends_levelofaccess = {NA}, author = {Furtado, A. and Pereira, J. and Schiebl, M. and Mares, G. and Popa, G. and Bartos, P. and Bebic, J. and Lenard, E. and Alic, A. and Alisic, S. and Neuvonen, P. and Wolf, H. and Sariyerli, G. and Bescupschii, A. and Laky, B.} } @Article { JelezkoDNAEBGJSMTFDGO2018, subid = {1010}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept}, journal = {Physical Review Applied}, year = {2018}, month = {7}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance}, web_url = {https://arxiv.org/abs/1706.07935}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.10.014024}, stag_bib_extends_levelofaccess = {NA}, author = {Forneris, J. and Ditalia Tchernij, S. and Traina, P. and Moreva, E. and Skukan, N. and Jakšić, M. and Grilj, V. and Bosia, F. and Enrico, E. and Amato, G. and Degiovanni, I.P. and Naydenov, B. and Jelezko, F. and Genovese, M. and Olivero, P.} } @Article { JelezkoDNAEBGJSMTFDGO20180, subid = {1010}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of NV Sensors - A Self-Diagnostic Concept}, journal = {Physical Review Applied}, year = {2018}, month = {7}, day = {25}, volume = {10}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.10.014024}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1706.07935}, author = {Forneris, J. and Ditalia Tchernij, S. and Traina, P. and Moreva, E. and Skukan, N. and Jakšić, M. and Grilj, V. and Bosia, F. and Enrico, E. and Amato, G. and Degiovanni, I.P. and Naydenov, B. and Jelezko, F. and Genovese, M. and Olivero, P.} } @Article { MonteGAUKK2018, title = {Characterization of blackbody inhomogeneity and its effect on the retrieval results of the GLORIA instrument}, journal = {Atmospheric Measurement Techniques}, year = {2018}, month = {7}, volume = {11}, number = {7}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {3871-3882}, keywords = {GLORIA,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1867-8548}, DOI = {10.5194/amt-11-3871-2018}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Gutschwager, B. and Adibekyan, A. and Ungermann, J. and Krisch, I. and Kleinert, A.} } @Proceedings { ArifovicDKM2018, subid = {855}, title = {Performance of Reference Partial Discharge Measurement System}, journal = {Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, volume = {1}, number = {1}, number2 = {15NRM02: UHV: Techniques for ultra-high voltage and very fast transients}, pages = {1-2}, keywords = {Calibration, charge measurement, partial discharge, PD measurement, uncertainty}, web_url = {https://zenodo.org/record/1343872\#.W9cMuNX7TIU\&\#10;https://ieeexplore.ieee.org/document/8500956/metrics\#metrics}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, event_place = {Paris, France}, event_name = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, event_date = {08-07-2018 to 13-07-2018}, language = {30}, ISBN = {978-1-5386-0973-6}, ISSN = {978-1-5386-0974-3}, DOI = {10.5281/zenodo.1343872}, stag_bib_extends_levelofaccess = {NA}, author = {Merev, A. and Karaman, I. and Dedeoğlu, S. and Arifovi\c{c}, M.} } @Article { WeisbachKHDBALKHW2018, subid = {515}, title = {Development and characterization of sub-monolayer coatings as novel calibration samples for X-ray spectroscopy}, journal = {Spectrochimica Acta Part B: Atomic Spectroscopy}, year = {2018}, month = {7}, volume = {145}, number2 = {14IND07: 3D Stack: Metrology for manufacturing 3D stacked integrated circuits}, pages = {36-42}, keywords = {X-ray fluorescence, calibration samples}, web_url = {https://arxiv.org/abs/1801.04246}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0584-8547}, DOI = {10.1016/j.sab.2018.04.001}, stag_bib_extends_levelofaccess = {NA}, author = {Honicke, P. and Kr{\"a}mer, M. and L{\"u}hl, L. and Andrianov, K. and Beckhoff, B. and Dietsch, R. and Holz, T. and Kanngie{\ss}er, B. and Wei{\ss}bach, D. and Wilhein, T.} } @Proceedings { GrajciarDACHP2018, subid = {887}, title = {Harmonics Effects on Microwave Low-Power Measurement}, journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-2}, keywords = {Harmonic effect, microwave measurements, microwave power, power sensor, uncertainty}, web_url = {http://rfmw.cmi.cz/documents/papers/Celep_HarmonicEffect_cpem2018.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Paris, France}, event_name = {2018 Conference on Precision Electromagnetic Measurements}, event_date = {08-07-2018 to 13-07-2018}, language = {30}, ISBN = {978-1-5386-0974-3}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2018.8500788}, stag_bib_extends_levelofaccess = {NA}, author = {CELEP, Murat and Abdo, Yaser and Dražil, Karel and Grajciar, Jan and Hudlicka, Martin and Pinter, Borut} } @Article { SigrayLCBMBBAHRGCBD2018, subid = {904}, title = {Calibration standards for hydrophones and autonomous underwater noise recorders for frequencies below 1 kHz: current activities of EMPIR “UNAC-LOW” project}, journal = {ACTA IMEKO}, year = {2018}, month = {7}, volume = {7}, number = {2}, number2 = {15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz}, pages = {32}, keywords = {low frequency hydrophone calibration; low frequency underwater noise recorders; underwater acoustics; calibration}, web_url = {http://dx.doi.org/10.21014/acta_imeko.v7i2.542}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IMEKO International Measurement Confederation}, language = {30}, ISSN = {2221-870X}, DOI = {10.21014/acta_imeko.v7i2.542}, stag_bib_extends_levelofaccess = {NA}, author = {Biber, A. and \c{C}orak\c{c}ı, A.C. and Golick, A. and Robinson, S. and Hayman, G. and Ablitt, J. and Barrera-Figueroa, S. and Buogo, S. and Mauro, S. and Borsani, F. and Curcuruto, S. and Linn{\'e}, M. and Sigray, P. and Davidsson, P.} } @Article { EllingsbergBAVLRWPS2018, subid = {1376}, title = {Evaluation of EMI Effects on Static Electricity Meters}, journal = {2018 Conference on Precision Electromagnetic Measurements (CPEM 2018)}, year = {2018}, month = {7}, number2 = {17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters}, keywords = {Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters.}, tags = {SEG}, web_url = {https://zenodo.org/record/3587786\#.XiGxp3u7KUn}, misc2 = {EMPIR 2017: Pre-Co-Normative}, publisher = {IEEE}, language = {30}, DOI = {10.1109/CPEM.2018.8500945}, stag_bib_extends_levelofaccess = {NA}, author = {Wright, P.S. and Rietveld, G. and Leferink, F. and van den Brom, H.E. and Alonso, F.R.I and Braun, J.P. and Ellingsberg, K. and Pous, M. and Svoboda, M.} } @Article { DorscherSFASL2018, subid = {567}, title = {Lattice-induced photon scattering in an optical lattice clock}, journal = {Physical Review A}, year = {2018}, month = {6}, day = {25}, volume = {97}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {063419}, keywords = {Optical lattice clocks, light-matter interaction, electronic transitions,}, web_url = {https://arxiv.org/abs/1802.02945}, misc2 = {EMPIR 2015: SI Broader Scope}, language = {30}, DOI = {10.1103/PhysRevA.97.063419}, stag_bib_extends_levelofaccess = {NA}, author = {D{\"o}rscher, S{\"o}ren and Schwarz, Roman and Al-Masoudi, Ali and Falke, Stephan and Sterr, Uwe and Lisdat, Christian} } @Article { MalhiARNDBOCL2018, subid = {959}, title = {Realistic Forest Stand Reconstruction from Terrestrial LiDAR for Radiative Transfer Modelling}, journal = {Remote Sensing}, year = {2018}, month = {6}, day = {13}, volume = {10}, number = {6}, number2 = {16ENV03: MetEOC-3: Further metrology for earth observation and climate}, pages = {933}, keywords = {tree reconstruction, radiative transfer, terrestrial LiDAR, forestry, 3D modelling, calibration and validation, end-to-end traceability}, web_url = {https://www.mdpi.com/2072-4292/10/6/933}, misc2 = {EMPIR 2016: Environment}, publisher = {MDPI AG}, language = {30}, ISSN = {2072-4292}, DOI = {10.3390/rs10060933}, stag_bib_extends_levelofaccess = {NA}, author = {Calders, K. and Origo, N. and Burt, A. and Disney, M. and Nightingale, J. and Raumonen, P. and {\AA}kerblom, M. and Malhi, Y. and Lewis, P.} } @Proceedings { ProbstHDSPA2018, subid = {752}, title = {Effects Degrading Accuracy of CPW mTRL Calibration at W Band}, journal = {2018 IEEE/MTT-S International Microwave Symposium - IMS}, year = {2018}, month = {6}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1296-1299}, keywords = {Calibration, measurement accuracy, on-wafer measurement, probe}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/effects-degrading-accuracy-of-cpw-mtrl-calibration-at-w-band}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, event_place = {Philadelphia}, event_name = {2018 IEEE/MTT-S International Microwave Symposium - IMS}, event_date = {10-06-2018 to 15-06-2018}, language = {30}, DOI = {10.1109/MWSYM.2018.8439837}, stag_bib_extends_levelofaccess = {NA}, author = {Phung, G.N. and Schmuckle, F.J. and Doerner, R. and Heinrich, W. and Probst, T. and Arz, U.} } @Proceedings { ZinalADP2018, subid = {753}, title = {On the Importance of Calibration Standards Definitions for On-Wafer Measurements up to 110 GHz}, journal = {2018 91st ARFTG Microwave Measurement Conference (ARFTG)}, year = {2018}, month = {6}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Calibration, Substrates, Standards, Probes, Aluminum oxide, Frequency measurement,}, web_url = {https://doi.org/10.1109/ARFTG.2018.8423829}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Philadelphia, PA, USA}, event_name = {2018 91st ARFTG Microwave Measurement Conference (ARFTG)}, event_date = {15-06-2018 to 15-06-2018}, language = {30}, DOI = {10.7795/EMPIR.14IND02.CA.20190403C}, stag_bib_extends_levelofaccess = {NA}, author = {Zinal, S. and Arz, U. and Doerner, R. and Probst, T.} } @Article { deClercqZGRPCAB2018, title = {Toward a High-Stability Coherent Population Trapping Cs Vapor-Cell Atomic Clock Using Autobalanced Ramsey Spectroscopy}, journal = {Physical Review Applied}, year = {2018}, month = {6}, volume = {9}, number = {6}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, keywords = {Resonance raman transition, dual-frequency laser, long-term stability, rubidium, standard; compensation, performance, shifts,}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {2331-7019}, DOI = {10.1103/PhysRevApplied.9.064002}, stag_bib_extends_levelofaccess = {NA}, author = {de Clercq, E. and Zanon-Willette, T. and Gu{\'e}randel, S. and Rocher, C. and Petersen, M. and Coget, G. and Abdel Hafiz, M. and Boudot, R.} } @Article { DebogovicISAPdM2018, title = {3D printed microwave cavity for atomic clock applications: proof of concept}, journal = {Electronics Letters}, year = {2018}, month = {5}, day = {31}, volume = {54}, number = {11}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {691-693}, keywords = {three-dimensional printing, rapid prototyping (industrial), atomic clocks, microwave resonators, polymers, coatings, 3D printed microwave cavity, additively manufactured microwave resonator cavity, AM microwave resonator cavity, double-resonance vapour-cell atomic clock application, DR vapour-cell atomic clock application, loop-gap resonator approach, conventionally-machined aluminium component, metal-coated polymer, clock short-term stability}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Institution of Engineering and Technology (IET)}, language = {30}, ISSN = {0013-5194, 1350-911X}, DOI = {10.1049/el.2017.4176}, stag_bib_extends_levelofaccess = {NA}, author = {Debogovic, T. and Ivanov, A.E. and Skrivervik, A.K. and Affolderbach, C. and Pellaton, M. and de Rijk, E. and Mileti, G.} } @Proceedings { PousASTOC2018, subid = {765}, title = {FFT-based time domain solution to power frequency issue of CS101 testing for military and aerospace equipment}, journal = {2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility (EMC/APEMC)}, year = {2018}, month = {5}, day = {14}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {177-182}, keywords = {Aerospace, CS101, EMC, Immunity, Military, Time Domain}, web_url = {http://rfmw.cmi.cz/documents/papers/Cakir_FFT_TDS_CS101.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Singapore}, event_name = {2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility}, event_date = {14-05-2018 to 18-05-2018}, language = {30}, ISBN = {978-1-5090-5997-3}, DOI = {10.1109/ISEMC.2018.8393762}, stag_bib_extends_levelofaccess = {NA}, author = {\c{C}akır, S. and Ozturk, M. and Tektas, B. and Şen, O. and Acak, S. and Pous, M.} } @Article { GenoveseDBTVLGAP2018, subid = {532}, title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement}, journal = {Scientific Reports}, year = {2018}, month = {5}, volume = {8}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-25156-7}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Gramegna, M. and Lussana, R. and Villa, F. and Tosi, A. and Brida, G. and Degiovanni, I.P. and Genovese, M.} } @Article { GenoveseDBTVLGAP20180, subid = {532}, title = {Investigating the Effects of the Interaction Intensity in a Weak Measurement}, journal = {Scientific Reports}, year = {2018}, month = {5}, volume = {8}, number = {1}, number2 = {17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits}, keywords = {Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-018-25156-7}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Gramegna, M. and Lussana, R. and Villa, F. and Tosi, A. and Brida, G. and Degiovanni, I.P. and Genovese, M.} } @Article { VandervorstvAZFMMC2018, subid = {482}, title = {Toward accurate composition analysis of GaN and AlGaN using atom probe tomography}, journal = {Journal of Vacuum Science \& Technology B, Nanotechnology and Microelectronics: Materials, Processing, Measurement, and Phenomena}, year = {2018}, month = {5}, volume = {36}, number = {3}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {03F130}, keywords = {accuracy, composition, Atom probe, GaN}, web_url = {https://avs.scitation.org/doi/10.1116/1.5019693}, misc2 = {EMPIR 2014: Industry}, publisher = {American Vacuum Society}, language = {30}, ISSN = {2166-2746, 2166-2754}, DOI = {10.1116/1.5019693}, stag_bib_extends_levelofaccess = {NA}, author = {Morris, R.J.H. and Cuduvally, R. and Melkonyan, D. and Fleischmann, C. and Zhao, M. and Arnoldi, L. and van der Heide, P. and Vandervorst, W.} } @Article { BelenguerJKLA2018, subid = {796}, title = {Empty Substrate Integrated Waveguide-Fed MMW Aperture-Coupled Patch Antenna for 5G Applications}, journal = {EuCAP}, year = {2018}, month = {5}, number2 = {14IND10: MET5G: Metrology for 5G communications}, keywords = {5G, antennas, millimetre-wave, Empty Substrate Integrated Waveguide.}, web_url = {http://www.eucap.org/}, misc2 = {EMPIR 2014: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/abs/1809.07817}, author = {Belenguer, A. and Jilani, S.F. and Khan, Z.U. and Loh, T. H. and Alomainy, A.} } @Article { AxnerZHS2018, subid = {804}, title = {Gas modulation refractometry for high-precision assessment of pressure under non-temperature-stabilized conditions}, journal = {Journal of Vacuum Science \& Technology A: Vacuum, Surfaces, and Films}, year = {2018}, month = {5}, volume = {36}, number = {3}, number2 = {14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range}, pages = {03E105}, keywords = {GAs modulation refractometry, Fabry Perot cavity refractometry}, misc2 = {EMPIR 2014: Industry}, publisher = {American Vacuum Society}, language = {30}, ISSN = {0734-2101, 1520-8559}, DOI = {10.1116/1.5022244}, stag_bib_extends_levelofaccess = {NA}, author = {Silander, I. and Hausmaninger, T. and Zelan, M. and Axner, O.} } @Article { KimBBWLAM2018, subid = {843}, title = {Improved Extraction Repeatability and Spectral Reproducibility for Liquid Extraction Surface Analysis–Mass Spectrometry Using Superhydrophobic–Superhydrophilic Patterning}, journal = {Analytical Chemistry}, year = {2018}, month = {4}, day = {27}, volume = {90}, number = {10}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {6001-6005}, keywords = {liquid extraction surface analysis (LESA); Droplet Microarray (DMA); extraction solvent; mass spectrometry}, web_url = {https://pubs.acs.org/doi/pdf/10.1021/acs.analchem.8b00973}, misc2 = {EMPIR 2015: Health}, publisher = {American Chemical Society (ACS)}, language = {30}, ISSN = {0003-2700, 1520-6882}, DOI = {10.1021/acs.analchem.8b00973}, stag_bib_extends_levelofaccess = {NA}, author = {Meurs, J. and Alexander, M.R. and Levkin, P.A. and Widmaier, S. and Bunch, J. and Barrett, D.A. and Kim, D.H.} } @Article { HeinrichSPHDKA2018, subid = {1053}, title = {Traceable Coplanar Waveguide Calibrations on Fused Silica Substrates up to 110 GHz}, journal = {IEEE TRANSACTIONS ON MICROWAVE THEORY AND TECHNIQUES}, year = {2018}, month = {4}, day = {19}, volume = {t.b.d.}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1-10}, keywords = {Calibration, on-wafer, S-parameters, traceability, uncertainty budget}, web_url = {https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=8693763}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/TMTT.2019.2908857}, stag_bib_extends_levelofaccess = {NA}, author = {Arz, U. and Kuhlmann, K. and Dziomba, T. and Hechtfischer, G. and Phung, G. and Schm{\"u}ckle, F. and Heinrich, W.} } @Article { LopezASLXP2018, subid = {1099}, title = {Studying the fundamental limit of optical fiber links to the 10−21 level}, journal = {Optics Express}, year = {2018}, month = {4}, volume = {26}, number = {8}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {9515}, keywords = {Fiber optics links and subsystems; Metrological instrumentation; Metrology; Phase measurement}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.009515}, stag_bib_extends_levelofaccess = {NA}, author = {Lopez, O. and Amy-Klein, A. and Stefani, F. and Lee, W.K. and Xu, D. and Pottie, P.E.} } @Article { LopezASLXP20180, subid = {837}, title = {Studying the fundamental limit of optical fiber links to the 10−21 level}, journal = {Optics Express}, year = {2018}, month = {4}, volume = {26}, number = {8}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {9515}, keywords = {Fiber optics links and subsystems; Metrological instrumentation; Metrology; Phase measurement}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {1094-4087}, DOI = {10.1364/OE.26.009515}, stag_bib_extends_levelofaccess = {NA}, author = {Xu, D. and Lee, W.K. and Stefani, F. and Lopez, O. and Amy-Klein, A. and Pottie, P.E.} } @Article { NouiraAMZA2018, subid = {862}, title = {Investigation of minimum zone assessment methods for aspheric shapes}, journal = {Precision Engineering}, year = {2018}, month = {4}, volume = {52}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {300-307}, keywords = {Aspheric shape, Chebyshev fitting, Exponential Penalty Function, Primal-Dual Interior Point Method, Form errors}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2018.01.008}, stag_bib_extends_levelofaccess = {NA}, author = {Arezki, Y. and Zhang, X. and Mehdi-Souzani, C. and Anwer, N. and Nouira, H.} } @Article { LewisAWNDOC2018, title = {Variability and bias in active and passive ground-based measurements of effective plant, wood and leaf area index}, journal = {Agricultural and Forest Meteorology}, year = {2018}, month = {4}, volume = {252}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {231-240}, keywords = {Sensor comparison, Leaf area index, Terrestrial LiDAR, Hemispherical photography, LAI-2200, Validation.}, web_url = {http://discovery.ucl.ac.uk/1542932/1/Origo_1-s2.0-S0168192317300369-main.pdf}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0168-1923}, DOI = {10.1016/j.agrformet.2018.01.029}, stag_bib_extends_levelofaccess = {NA}, author = {Lewis, P. and Armston, J. and Woodgate, W. and Nightingale, J. and Disney, M. and Origo, N. and Calders, K.} } @Article { AarhaugHAGCMB2018, subid = {502}, title = {Probability of occurrence of ISO 14687-2 contaminants in hydrogen: Principles and examples from steam methane reforming and electrolysis (water and chlor-alkali) production processes model}, journal = {International Journal of Hydrogen Energy}, year = {2018}, month = {4}, number2 = {15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications}, keywords = {ISO14687-2, Hydrogen quality, Fuel cell electrical vehicle, Probability of occurrence, Hydrogen production process, ISO 19880-8}, web_url = {https://www.sciencedirect.com/science/article/pii/S0360319918308450}, misc2 = {EMPIR 2015: Pre-Co-Normative}, publisher = {Elsevier BV}, language = {30}, ISSN = {0360-3199}, DOI = {10.1016/j.ijhydene.2018.03.084}, stag_bib_extends_levelofaccess = {NA}, author = {Bacquart, T and Murugan, A and Carr{\'e}, M and Gozlan, B and Aupr{\^e}tre, F and Haloua, F and Aarhaug, T.A.} } @Article { RawsonHAS2018, subid = {841}, title = {Electrochemically stimulating developments in bioelectronic medicine}, journal = {Bioelectronic Medicine}, year = {2018}, month = {3}, day = {15}, volume = {4}, number = {1}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, keywords = {Bioelectronic interfaces, Bioelectrochemistry, Nanobioelectronics, Cellular signalling}, web_url = {https://link.springer.com/content/pdf/10.1186\%2Fs42234-018-0001-z.pdf}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature}, language = {30}, ISSN = {2332-8886}, DOI = {10.1186/s42234-018-0001-z}, stag_bib_extends_levelofaccess = {NA}, author = {Sanjuan-Alberte, P. and Alexander, M.R. and Hague, R.J.M. and Rawson, F.J.} } @Article { deRijkSPDIMAM2018, title = {Study of additive manufactured microwave cavities for pulsed optically pumped atomic clock applications}, journal = {Applied Physics Letters}, year = {2018}, month = {3}, day = {12}, volume = {112}, number = {11}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {113502}, keywords = {gap resonator, frequency stability, frequency standard}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0003-6951, 1077-3118}, DOI = {10.1063/1.5019444}, stag_bib_extends_levelofaccess = {NA}, author = {de Rijk, E. and Skrivervik, A.K. and Pellaton, M. and Debogovic, T. and Ivanov, A.E. and Moreno, W. and Affolderbach, C. and Mileti, G.} } @Article { BarlowKGAWIOS2018, subid = {830}, title = {Development of large-area high-temperature fixed-point blackbodies for photometry and radiometry}, journal = {Metrologia}, year = {2018}, month = {2}, volume = {55}, number = {2}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, pages = {S43-S51}, keywords = {large-area high-temperature fixed point, blackbody, rhenium–carbon,tungsten carbide–carbon, photometry}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://link.springer.com/article/10.1007\%2Fs10765-017-2273-z}, author = {Barlow, C. and Khlevnoy, B. and Grigoryeva, I. and Anhalt, K. and Waehmer, M. and Ivashin, E. and Otryaskin, D. and Solodilov, M.} } @Article { OhlckersAMKB2018, subid = {455}, title = {Reliability study of fiber-coupled photodiode module for operation at 4 K}, journal = {Microelectronics Reliability}, year = {2018}, month = {2}, volume = {81}, number = {February 2}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {362-367}, keywords = {Optoelectronic packaging, Cryogenics, Voltage standards}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0026-2714}, DOI = {10.1016/j.microrel.2017.10.034}, stag_bib_extends_levelofaccess = {NA}, author = {Bardalen, E. and Karlsen, B. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.} } @Article { HudlickaPOPAS2018, subid = {597}, title = {Waveform Approach for Assessing Conformity of CISPR 16-1-1 Measuring Receivers}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2018}, month = {2}, volume = {67}, number = {5}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1187-1198}, keywords = {Receivers, Electromagnetic interference, Calibration, Current measurement, Standards, Real-time systems, Frequency measurement}, misc2 = {EMPIR 2015: Research Potential}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2018.2794941}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://upcommons.upc.edu/handle/2117/116447}, author = {Azpurua, M.A. and Pous, M. and Oliva, J.A. and Pinter, B. and Hudlicka, M. and Silva, F.} } @Article { ArzLDOP2018, subid = {525}, title = {110 GHz on-wafer measurement comparison on alumina substrate}, journal = {ARFTG Microwave Measurement Symposium (ARFTG), 2017 Nov 28th - Dec 1st}, year = {2018}, month = {1}, day = {15}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Calibration, Ceramics, Probes, Metals, Substrates, Frequency measurement, Geometry, alumina, measurement standards, microwave measurement, network analysers, S-parameters devices under tests, measurement configurations, alumina calibration substrate, calibrations, probe geometry, measurement system, highly accurate multiline TRL calibration, vector network analyzer measurement, frequency 110.0 GHz, Al2O3, on-wafer, substrate}, web_url = {https://doi.org/10.1109/ARFTG.2017.8255867}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.7795/EMPIR.14IND02.CA.20190403A}, stag_bib_extends_levelofaccess = {NA}, author = {Arz, U. and Lazar, R. and Doerner, R. and Ohlrogge, M. and Probst, T.} } @Article { AnwerMAN2018, subid = {860}, title = {Reference data simulation for L\(\infty\) fitting of aspheres}, journal = {Procedia CIRP}, year = {2018}, volume = {75}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {331-336}, keywords = {computational metrology fitting reference data}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {2212-8271}, DOI = {10.1016/j.procir.2018.04.051}, stag_bib_extends_levelofaccess = {NA}, author = {Arezki, Y. and Mehdi-Souzani, C. and Anwer, N. and Nouira, H.} } @Article { AlexanderWWNRPHH2018, subid = {844}, title = {Effect of surfactant on Pseudomonas aeruginosa colonization of polymer microparticles and flat films}, journal = {RSC Advances}, year = {2018}, volume = {8}, number = {28}, number2 = {15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance}, pages = {15352-15357}, keywords = {nanoparticles, polymer microparticles, polymerizable monomer}, web_url = {https://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra01491d}, misc2 = {EMPIR 2015: Health}, publisher = {Royal Society of Chemistry (RSC)}, language = {30}, ISSN = {2046-2069}, DOI = {10.1039/C8RA01491D}, stag_bib_extends_levelofaccess = {NA}, author = {H{\"u}sler, A. and Haas, S. and Parry, L. and Romero, M. and Nisisako, T. and Williams, P. and Wildman, R.D. and Alexander, M.R.} } @Article { OhlckersAMKB2018_2, subid = {1183}, title = {Evaluation of InGaAs/InP photodiode for high-speed operation at 4 K}, journal = {International Journal of Metrology and Quality Engineering}, year = {2018}, volume = {9}, number2 = {15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages}, pages = {13}, keywords = {optoelectronics / cryogenics / voltage standards}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {EDP Sciences}, language = {30}, ISSN = {2107-6847}, DOI = {10.1051/ijmqe/2018015}, stag_bib_extends_levelofaccess = {NA}, author = {Bardalen, E. and Karlsen, B. and Malmbekk, H. and Akram, M.N. and Ohlckers, P.} } @Article { RockstuhlRLZGAAP2018, subid = {869}, title = {Rigorous wave-optical treatment of photon recycling in thermodynamics of photovoltaics: Perovskite thin-film solar cells}, journal = {Phys. Rev. B}, year = {2018}, volume = {98}, number = {7}, number2 = {14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications}, pages = {075141}, keywords = {Geometrical \& wave optics, Interference \& diffraction of light, Light propagation, transmission \& absorption, Light-matter interaction, Luminescence, Nanophotonics, ,Optoelectronics, Spontaneous emission}, web_url = {https://arxiv.org/abs/1804.02230}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society}, language = {30}, DOI = {10.1103/PhysRevB.98.075141}, stag_bib_extends_levelofaccess = {NA}, author = {Abebe, M.G. and Abass, A. and Gomard, G. and Zschiedrich, L. and Lemmer, U. and Richards, B.S. and Rockstuhl, C. and Paetzold, U.W. } } @Proceedings { KummeSAFW2018, subid = {882}, title = {Investigations towards extrapolation approaches for torque transducer characteristics}, journal = {Conference Proceedings 22. IMEKO World Congress}, year = {2018}, number = {2018}, number2 = {14IND14: MNm Torque: Torque measurement in the MN•m range}, keywords = {torque transducers, traceable measurement, extrapolation, partial full range measurement, 20kN}, misc2 = {EMPIR 2014: Industry}, event_place = {Belfast, Northern Ireland}, event_name = {22. IMEKO World Congress}, event_date = {03-09-2018 to 06-09-2018}, language = {30}, DOI = {10.1088/1742-6596/1065/4/042057}, stag_bib_extends_levelofaccess = {NA}, author = {Weidinger, P. and Foyer, G. and Ala-Hiiro, J. and Schlegel, C. and Kumme, R.} } @Article { BurnsRMNBFLADYHR2017, subid = {499}, title = {Antimicrobial peptide capsids of de novo design}, journal = {Nature Communications}, year = {2017}, month = {12}, day = {22}, volume = {8}, number = {1}, number2 = {15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance}, pages = {2263}, keywords = {Antimicrobials, Protein design, Self-assembly, Biometrology}, misc2 = {EMPIR 2015: Health}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/s41467-017-02475-3}, stag_bib_extends_levelofaccess = {NA}, author = {De Santis, E. and Alkassem, H. and Lamarre, B. and Faruqui, N. and Bella, A. and Noble, J.E. and Micale, N. and Ray, S. and Burns, J.R. and Yon, A.R. and Hoogenboom, B.W. and Ryadnov, M.G.} } @Article { NielsenAKKIIHGFCCBHOOSS2017, title = {New Primary Standards for Establishing SI Traceability for Moisture Measurements in Solid Materials}, journal = {International Journal of Thermophysics}, year = {2017}, month = {12}, volume = {39}, number = {1}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, keywords = {Karl Fischer, Loss-on-drying, Moisture, Oven drying, Traceability}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2340-5}, stag_bib_extends_levelofaccess = {NA}, author = {Nielsen, J. and Aro, R. and Krasheninina, M. and Keawprasert, T. and Ismail, N. and Ionescu, G.V. and Hudoklin, D. and Georgin, E. and Fernicola, V. and Cortellessa, G. and Choi, B.I. and Bell, S. and Heinonen, M. and Oguz Aytekin, S. and {\"O}sterberg, P. and Skabar, J. and Strnad, R.} } @Proceedings { SchmuckleHPAZH2017, subid = {521}, title = {Establishing traceability for on-wafer S-parameter measurements of membrane technology devices up to 110 GHz}, journal = {2017 90th ARFTG Microwave Measurement Symposium (ARFTG)}, year = {2017}, month = {11}, day = {30}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {on-wafer, calibration, S-parameters, traceability,uncertainty budget}, web_url = {https://doi.org/10.1109/ARFTG.2017.8255874}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Boulder, Colorado}, event_name = {ARFTG Microwave Measurement Symposium}, event_date = {28-11-2017 to 01-12-2017}, language = {30}, ISBN = {978-1-5386-4356-3}, DOI = {10.7795/EMPIR.14IND02.CA.20190403}, stag_bib_extends_levelofaccess = {NA}, author = {Schmuckle, Franz-Josef and Heinrich, Wolfgang and Probst, Thorsten and Arz, Uwe and Zinal, Sherko and Hechtfischer, Gerd} } @Article { BaeHCGHAK2017, subid = {414}, title = {Upper frequency limit depending on potential shape in a QD-based single electron pump}, journal = {Journal of Applied Physics}, year = {2017}, month = {11}, day = {21}, volume = {122}, number = {19}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {194502}, keywords = {single electron pump, quantum dot, single electron tunneling}, web_url = {http://aip.scitation.org/doi/abs/10.1063/1.5000319}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979, 1089-7550}, DOI = {10.1063/1.5000319}, stag_bib_extends_levelofaccess = {NA}, author = {Ahn, Y.H. and Hong, Y.P. and Hong, C. and Ghee, Y.S. and Chung, Y. and Bae, M.H. and Kim, N.} } @Article { LestremauLKvBMBCBRYAB2017, title = {Suitability of vessels and adsorbents for the short-term storage of biogas/biomethane for the determination of impurities – Siloxanes, sulfur compounds, halogenated hydrocarbons, BTEX}, journal = {Biomass and Bioenergy}, year = {2017}, month = {10}, volume = {105}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {127-135}, keywords = {BiogasCompositionImpuritiesVesselsSampling}, tags = {EnG}, web_url = {http://www.sciencedirect.com/science/article/pii/S0961953417302118}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, DOI = {10.1016/j.biombioe.2017.06.025}, stag_bib_extends_levelofaccess = {NA}, author = {Lestremau, F. and Li, J. and Krom, I. and van der Veen, A.M.H. and Brewer, B. and Murugan, A. and Bartlett, S. and Culleton, L. and B{\"u}ker, O. and Rosell, L. and Yaghooby, H. and Arrhenius, K. and Beranek, J.} } @Proceedings { HoogenboomAHR2017, subid = {391}, title = {Meeting ecodesign efficiency requirements: ensuring accuracy in power transformer loss tests via TLM system calibrations}, journal = {CIRED - Open Access Proceedings Journal}, year = {2017}, month = {10}, volume = {2017}, number = {1}, number2 = {14IND08: ElPow: Metrology for the electrical power industry}, pages = {329-332}, keywords = {power transformer testing power factor; error sources; Ecodesign Directive; sustainable energy policies; high-quality TLM systems; efficiency requirements; power transformer loss test; TLM system calibration; transformer loss measurement systems; EU; calibration accuracies; advanced digital signal processing technique; ecodesign efficiency requirement}, tags = {SEG}, web_url = {http://digital-library.theiet.org/content/journals/10.1049/oap-cired.2017.0475}, misc2 = {EMPIR 2014: Industry}, publisher = {Institution of Engineering and Technology (IET)}, event_place = {Scottish Event Campus (SEC), Glasgow, Scotland}, event_name = {CIRED 2017}, event_date = {12-06-2017 to 15-06-2017}, language = {30}, ISSN = {2515-0855}, DOI = {10.1049/oap-cired.2017.0475}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, G. and Houtzager, E. and Acanski, M. and Hoogenboom, D.} } @Article { WehmannLSTVASFNLZSHW2017, title = {Study of 3D-growth conditions for selective area MOVPE of high aspect ratio GaN fins with non-polar vertical sidewalls}, journal = {Journal of Crystal Growth}, year = {2017}, month = {10}, volume = {476}, number2 = {ENG62: MESaIL: Metrology for efficient and safe innovative lighting}, pages = {90-98}, keywords = {Crystal morphology, Metalorganic vapor phase epitaxy, Gallium compounds, Nitrides, Light emitting diodes}, web_url = {http://www.sciencedirect.com/science/article/pii/S0022024817305146}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0022-0248}, DOI = {10.1016/j.jcrysgro.2017.08.021}, stag_bib_extends_levelofaccess = {NA}, author = {Wehmann, H-H and Lugauer, H-J and Stra{\ss}burg, M. and Trampert, A. and Varghese, T. and Avramescu, A. and Schimpke, T. and F{\"u}ndling, S. and Nicolai, L. and Ledig, J. and Zhou, H. and Steib, F. and Hartmann, J. and Waag, A} } @Proceedings { GrandidierEBXFMDAHD2017, subid = {421}, title = {Nano-probing station incorporating MEMS probes for 1D device RF on-wafer characterization}, journal = {2017 47th European Microwave Conference (EuMC)}, year = {2017}, month = {10}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {MEMS GSG Probe, nano-prober, Nanowire, on-wafer, microwave}, web_url = {https://hal.archives-ouvertes.fr/hal-01726555}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Nuremberg}, event_name = {EuMC}, event_date = {08-10-2017 to 12-10-2017}, language = {30}, DOI = {10.23919/EuMC.2017.8230973}, stag_bib_extends_levelofaccess = {NA}, author = {Daff{\'e}, K. and Marzouk, J. and Fellahi, A. El and Xu, T. and Boyaval, C. and Eliet, S. and Grandidier, B. and Arscott, S. and Dambrine, G. and Haddadi, K.} } @Article { FailleauHHPSRBZARGVSSKSPLG2017, title = {Metrology for decommissioning nuclear facilities: Partial outcomes of joint research project within the European Metrology Research Program}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Decommissioning, Sample preparation, Metrology}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.08.032}, stag_bib_extends_levelofaccess = {NA}, author = {Failleau, G. and Hay, B. and Holm, P. and Per{\"a}j{\"a}rvi, K. and Sand, J. and Rogiers, B. and Boden, S. and Zapata-Garc{\'i}a, D. and Arnold, D. and Russell, B. and Garcia Miranda, M. and Van Ammel, R. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Plumeri, S. and Laurent Beck, Y. and Grisa, T.} } @Article { BogucarskaPdJASSSKSTv2017, title = {New high-throughput measurement systems for radioactive wastes segregation and free release}, journal = {Applied Radiation and Isotopes}, year = {2017}, month = {9}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {nuclear decommissioning, radioactive waste, free release, clearance level}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2017.09.043}, stag_bib_extends_levelofaccess = {NA}, author = {Bogucarska, T. and Pedersen, B. and De Felice, P. and Jerome, S. and Arnold, D. and Skala, L. and Solc, J. and Smoldasova, J. and Kov{\'a}ř, P. and Šur{\'a}ň, J. and Tzika, F. and Van Ammel, R.} } @Article { AgustoniFHCMMA2017, title = {Calibration of Commercial Test Sets for Non-Conventional Instrument Transformers}, journal = {2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS)}, year = {2017}, month = {9}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {19-24}, keywords = {Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measurement standards}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, DOI = {10.1109/AMPS.2017.8078324}, stag_bib_extends_levelofaccess = {NA}, author = {Agustoni, M. and Fricke, S. and Houtzager, E. and \c{C}aycı, H. and Mortara, A. and Mohns, E. and Ayhan, B.} } @Proceedings { PousOAS2017, subid = {434}, title = {Robust extreme value estimation for full time-domain EMI measurements}, journal = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2017}, month = {9}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-6}, keywords = {Statistical signal processing, Extreme value estimation, Electromagnetic interference, Electromagneticmeasurements, Time-domain analysis}, web_url = {https://upcommons.upc.edu/handle/2117/116880}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, address = {445 Hoes Lane Piscataway NJ 08855-1331 United States}, event_place = {Angers, France}, event_name = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {04-09-2017 to 07-09-2017}, language = {30}, ISBN = {978-1-5386-0689-6}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2017.8094729}, stag_bib_extends_levelofaccess = {NA}, author = {Azp{\'u}rua, Marco A. and Oliva, Jose A. and Pous, Marc and Silva, Ferran} } @Article { AntonanzasTorresGPLRTHKGU2017, title = {Extensive validation of CM SAF surface radiation products over Europe}, journal = {Remote Sensing of Environment}, year = {2017}, month = {9}, volume = {199}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {171-186}, keywords = {Satellite-based models, Global horizontal irradiance, CM SAF, Solar radiation data, Pyranometer}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0034-4257}, DOI = {10.1016/j.rse.2017.07.013}, stag_bib_extends_levelofaccess = {NA}, author = {Antonanzas-Torres, F. and Gottschalg, R. and Palmer, D. and Lindfors, A. and Riihel{\"a}, A. and Trentmann, J. and Huld, T. and Koubli, E. and Gracia-Amillo, A.M. and Urraca, R.} } @Proceedings { PousAS2017, subid = {433}, title = {APD oudoors time-domain measurements for impulsive noise characterization}, journal = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, year = {2017}, month = {9}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-6}, keywords = {Amplitude Probability Distribution, Impulsive noise, In-situ measurements, Electromagnetic interference, Electromagnetic measurements, Time-domain analysis}, web_url = {https://upcommons.upc.edu/handle/2117/116885}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Angers, France}, event_name = {2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE}, event_date = {04-09-2017 to 07-09-2017}, language = {30}, ISBN = {978-1-5386-0689-6}, ISSN = {2325-0364}, DOI = {10.1109/EMCEurope.2017.8094786}, stag_bib_extends_levelofaccess = {NA}, author = {Pous, M. and Azpurua, M.A. and Silva, F.} } @Article { NiederhauserLAGP2017, title = {Two generators to produce SI-traceable reference gas mixtures for reactive compounds at atmospheric levels}, journal = {Measurement Science and Technology}, year = {2017}, month = {8}, day = {18}, number2 = {ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change}, keywords = {reference gas mixture, permeation, dynamic dilution, matrix gas, metrological traceability, uncertainty}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa870c}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa870c}, stag_bib_extends_levelofaccess = {NA}, author = {Niederhauser, B.C. and Leuenberger, D. and Ackermann, A. and Guillevic, M. and Pascale, C.} } @Article { GrigoryevaGUTTKHAWKS2017, subid = {1175}, title = {Thermodynamic Temperature of High-Temperature Fixed Points Traceable to Blackbody Radiation and Synchrotron Radiation}, journal = {International Journal of Thermophysics}, year = {2017}, month = {8}, day = {16}, volume = {38}, number = {10}, number2 = {15SIB02: InK 2: Implementing the new kelvin 2}, keywords = {Absolute radiometry, Blackbody radiation, Cryogenic substitution radiometer, Filter radiometer, High-temperature fixed points, Irradiance mode, Primary radiation standards, Ratio radiometry, Synchrotron radiation, Thermodynamic temperature}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {0195-928X, 1572-9567}, DOI = {10.1007/s10765-017-2273-z}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}hmer, M. and Anhalt, K. and Hollandt, J. and Klein, R. and Taubert, R. D. and Thornagel, R. and Ulm, G. and Gavrilov, V. and Grigoryeva, I. and Khlevnoy, B. and Sapritsky, V.} } @Article { DegiovanniAPRLVTGBCVG2017, subid = {334}, title = {Determining the quantum expectation value by measuring a single photon}, journal = {Nature Physics}, year = {2017}, month = {8}, day = {14}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {4}, keywords = {Protective Measurements, Weak Measurements}, web_url = {https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf;}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/nphys4223}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Rebufello, E. and Lussana, R. and Villa, F. and Tosi, A. and Gramegna, M. and Brida, G. and Cohen, E. and Vaidman, L. and Degiovanni, I.P. and Genovese, M.} } @Article { SuterSSPOMKHGFBAKLWS2017, title = {The CLARA/NORSAT-1 solar absolute radiometer: instrument design, characterization and calibration}, journal = {Metrologia}, year = {2017}, month = {8}, day = {10}, volume = {54}, number = {5}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {674-682}, keywords = {solar irradiance, satellite measurements, electrical substitution radiometer, cavity detector, sun}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa7a63}, stag_bib_extends_levelofaccess = {NA}, author = {Suter, M. and Spescha, M. and Soder, R. and Pfiffner, D, and Oliva, A.R. and Mingard, N. and Koller, S. and Heuerman, K. and Gyo, M. and Finsterle, W. and Beck, I. and Andersen, B. and Kopp, G. and Levesque, P.L. and Walter, B. and Schmutz, W.} } @Article { VandervorstMAFDKBV2017, subid = {565}, title = {Atom probe tomography analysis of SiGe fins embedded in SiO 2 : Facts and artefacts}, journal = {Ultramicroscopy}, year = {2017}, month = {8}, volume = {179}, number2 = {14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies}, pages = {100-107}, keywords = {Atom probe tomography, Tip shape, FinFET, Local magnification, Trajectory overlaps}, web_url = {https://lirias2repo.kuleuven.be/rest/bitstreams/515063/retrieve}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0304-3991}, DOI = {10.1016/j.ultramic.2017.04.006}, stag_bib_extends_levelofaccess = {NA}, author = {Melkonyan, D. and Fleischmann, C. and Arnoldi, L. and Demeulemeester, J. and Kumar, A. and Bogdanowicz, J. and Vurpillot, F. and Vandervorst, W.} } @Article { BoudotdYTCBA2017, title = {High-contrast sub-Doppler absorption spikes in a hot atomic vapor cell exposed to a dual-frequency laser field}, journal = {New Journal of Physics}, year = {2017}, month = {7}, day = {25}, volume = {19}, number = {7}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {073028}, keywords = {Counterpropagating light waves, saturation spectroscopy, dark resonances, diode-lasers; d-1 line, d1 line, d2 line}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/aa7258}, stag_bib_extends_levelofaccess = {NA}, author = {Boudot, R. and de Clercq, E. and Yudin, V. and Taichenachev, A. and Coget, G. and Brazhnikov, D. and Abdel Hafiz, M.} } @Article { AntonovSMKCK2017, subid = {583}, title = {Hybrid normal metal/ferromagnetic nanojunctions for domain wall tracking}, journal = {Scientific Reports}, year = {2017}, month = {7}, day = {24}, volume = {7}, number = {1}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {6295}, keywords = {domain wall, magnetoresistance, permalloy}, web_url = {https://www.nature.com/articles/s41598-017-06292-y.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/s41598-017-06292-y}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Krzysteczko, P. and Manzin, A. and Schumacher, H.W. and Antonov, V. and Kazakova, O.} } @Article { IkonenAPPK2017, subid = {416}, title = {Fisheye camera method for spatial non-uniformity corrections in luminous flux measurements with integrating spheres}, journal = {Metrologia}, year = {2017}, month = {7}, day = {24}, volume = {54}, number = {4}, number2 = {15SIB07: PhotoLED: Future photometry based on solid-state lighting products}, pages = {577-583}, keywords = {fisheye camera, integrating sphere, luminous flux, spatial correction, angular intensity distribution, photometry, measurement uncertainty}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa7cb7}, stag_bib_extends_levelofaccess = {NA}, author = {Kokka, A. and Pulli, T. and Poikonen, T. and Askola, J. and Ikonen, E.} } @Proceedings { AcakCS2017, subid = {201}, title = {More insight into conducted immunity tests and investigation of support influences}, journal = {2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)}, year = {2017}, month = {7}, day = {13}, volume = {2017}, number = {2017}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {124-126}, keywords = {CDN, Conducted Immunity, EMC, Loop Impedance, Support}, web_url = {http://rfmw.cmi.cz/documents/papers/Sen_APEMC2017_OA.pdf}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Seoul}, event_name = {2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC)}, event_date = {20-06-2017 to 23-06-2017}, language = {30}, DOI = {10.1109/APEMC.2017.7975442}, stag_bib_extends_levelofaccess = {NA}, author = {Şen, O. and \c{C}akır, S. and Acak, S.} } @Proceedings { CamisardPLACWQCS2017, subid = {445}, title = {Progress on the REFIMEVE+ project for optical frequency standard dissemination}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, web_url2 = {https://www.eftf.org/previous-meetings/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/FCS.2017.8088897}, stag_bib_extends_levelofaccess = {NA}, author = {Cantin, E. and Quintin, N. and Wiotte, F. and Chardonnet, C. and Amy-Klein, A. and Lopez, O. and Pottie, P.E. and Santarelli, G. and Camisard, E.} } @Article { LopezLSPXA2017, subid = {440}, title = {Hybrid optical link for ultra-stable frequency comparison}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/FCS.2017.8088833}, stag_bib_extends_levelofaccess = {NA}, author = {Xu, D. and Lee, W.K. and Stefani, F. and Pottie, P.E. and Amy-Klein, A. and Lopez, O.} } @Proceedings { LeCoqANDTAALTSLXLP2017, subid = {446}, title = {Frequency comb-assisted QCL stabilization for high resolution molecular spectroscopy}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fiber, optical frequency transfer}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, event_place = {Besan\c{c}on, France}, event_name = {2017 European Frequency and Time Forum \& International Frequency Control Symposium}, event_date = {10-07-2017 to 13-07-2017}, language = {30}, DOI = {10.1109/FCS.2017.8088928}, stag_bib_extends_levelofaccess = {NA}, author = {Santagata, R. and Tran, D.B.A. and Lopez, O. and Argence, B. and Tokunaga, S.K. and Darqui{\'e}, B. and Amy-Klein, A. and Nicolodi, D. and Abgrall, M. and Le Coq, Y. and Le Targat, R. and Xu, D. and Lee, W.K. and Pottie, P.E.} } @Article { SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017, subid = {477}, title = {CLONETS – Clock network services strategy and innovation for clock services over optical-fibre networks}, journal = {2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC)}, year = {2017}, month = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {optical fibre, network, clock, time, dissemination, service}, web_url = {https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IEEE}, language = {30}, DOI = {10.1109/FCS.2017.8089004}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Śliwczyński, L. and Dostal, J. and Radil, J. and Smotlacha, V. and Velc, R. and Vojtech, J. and Campanella, M. and Calonico, D. and Clivati, C. and Levi, F. and Č{\'i}p, O. and Rerucha, S. and Holzwarth, R. and Lessing, M. and Camargo, F. and Desruelle, B. and Lautier-Gaud, J. and English, E.L. and Kronj{\"a}ger, J. and Whibberley, P. and Pottie, P.E. and Tavares, R. and Tuckey, P. and John, F. and Snajder, M. and Stefl, J. and Nogaś, P. and Urbaniak, R. and Binczewski, A. and Bogacki, W. and Turza, K. and Grosche, G. and Schnatz, H. and Camisard, E. and Quintin, N. and Diaz, J. and Garcia, T. and Ros, E. and Galardini, A. and Seeds, A. and Yang, Z. and Amy-Klein, A.} } @Article { MasowskiLCCBAPMNNlLKBKMZCPBT2017, subid = {402}, title = {Fibre-optic delivery of time and frequency to VLBI station}, journal = {Astronomy \& Astrophysics}, year = {2017}, month = {7}, volume = {603}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {A48}, keywords = {high angular resolution instrumentation, interferometers}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {EDP Sciences}, language = {30}, ISSN = {0004-6361, 1432-0746}, DOI = {10.1051/0004-6361/201730615}, stag_bib_extends_levelofaccess = {NA}, author = {Krehlik, P. and Buczek, L. and Kołodziej, J. and Lipiński, M. and Śliwczyński, Ł. and Nawrocki, J. and Nogaś, P. and Marecki, A. and Pazderski, E. and Ablewski, P. and Bober, M. and Ciuryło, R. and Cygan, A. and Lisak, D. and Masłowski, P. and Morzyński, P. and Zawada, M. and Campbell, R. M. and Pieczerak, J. and Binczewski, A. and Turza, K.} } @Proceedings { PousOAS2017_2, subid = {599}, title = {Fast and automated verification of multi-channel full time-domain EMI measurement systems}, journal = {2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, year = {2017}, month = {7}, number2 = {15RPT01: RFMicrowave: Development of RF and microwave metrology capability}, pages = {1-7}, keywords = {electromagnetic compatibility, electromagnetic interference, just-before-test, quality management, standards}, web_url = {https://upcommons.upc.edu/handle/2117/116687}, misc2 = {EMPIR 2015: Research Potential}, publisher = {IEEE}, event_place = {Turin, Italy}, event_name = {2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC)}, event_date = {22-05-2017 to 25-05-2017}, language = {30}, ISBN = {978-1-5090-3596-0}, DOI = {10.1109/I2MTC.2017.7969789}, stag_bib_extends_levelofaccess = {NA}, author = {Azpurua, M.A. and Oliva, J.A. and Pous, M. and Silva, F.} } @Article { MasowskiCZDBCAMWBL2017, subid = {387}, title = {Absolute frequency determination of molecular transition in the Doppler regime at kHz level of accuracy}, journal = {Journal of Quantitative Spectroscopy and Radiative Transfer}, year = {2017}, month = {6}, day = {11}, volume = {201}, number2 = {15SIB03: OC18: Optical clocks with 1E-18 uncertainty}, pages = {156-160}, keywords = {Transition frequency, Absolute frequency measurement, Optical atomic clock, Oxygen B band, Cavity ring-down spectroscopy}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0022-4073}, DOI = {10.1016/j.jqsrt.2017.07.010}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://arxiv.org/pdf/1705.06639.pdf}, author = {Bielska, K. and W{\'o}jtewicz, S. and Morzyński, P. and Ablewski, P. and Cygan, A. and Bober, M. and Domysławska, J. and Zawada, M. and Ciuryło, R. and Masłowski, P. and Lisak, D.} } @Article { HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017, subid = {141}, title = {Test of Special Relativity Using a Fiber Network of Optical Clocks}, journal = {Physical Review Letters}, year = {2017}, month = {6}, volume = {118}, number = {22}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, web_url = {https://arxiv.org/abs/1703.04426}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.118.221102}, stag_bib_extends_levelofaccess = {NA}, author = {Delva, P. and Lodewyck, J. and Bilicki, S. and Bookjans, E. and Vallet, G. and Le Targat, R. and Pottie, P.-E. and Guerlin, C. and Meynadier, F. and Le Poncin-Lafitte, C. and Lopez, O. and Amy-Klein, A. and Lee, W.-K. and Quintin, N. and Lisdat, C. and Al-Masoudi, A. and D{\"o}rscher, S. and Grebing, C. and Grosche, G. and Kuhl, A. and Raupach, S. and Sterr, U. and Hill, I. R. and Hobson, R. and Bowden, W. and Kronj{\"a}ger, J. and Marra, G. and Rolland, A. and Baynes, F. N. and Margolis, H. S. and Gill, P.} } @Article { MonteALBGRRKMAG2017, title = {Defect characterisation of tensile loaded CFRP and GFRP laminates used in energy applications by means of infrared thermography}, journal = {Quantitative InfraRed Thermography Journal}, year = {2017}, month = {6}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-20}, keywords = {Defect characterisation CFRP and GFRP laminates energy applications infrared thermography}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Informa UK Limited}, language = {30}, ISSN = {1768-6733, 2116-7176}, DOI = {10.1080/17686733.2017.1334312}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Aktas, A. and Lodeiro, M. and Baker, G. and Gower, M. and Rehmer, B. and R{\"o}llig, M. and Krankenhagen, R. and Maierhofer, C. and Adibekyan, A. and Gutschwager, B.} } @Article { MortaraA2017, title = {A Calibration Setup for IEC 61850-9-2 Devices}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2017}, month = {6}, volume = {66}, number = {6}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {1124-1130}, keywords = {IEC 61850-9-2, IEEE 1588, merging unit, sample values, test set}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2017.2665938}, stag_bib_extends_levelofaccess = {NA}, author = {Mortara, A. and Agustoni, M.} } @Article { HeinrichSPAPD2017, subid = {516}, title = {Mutual interference in calibration line configurations}, journal = {2017 89th ARFTG Microwave Measurement Conference (ARFTG)}, year = {2017}, month = {6}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Coupling, em simulation, measurements, parasitic modes, probes}, web_url = {https://www.fbh-berlin.com/publications-patents/publications/title/mutual-interference-in-calibration-line-configurations}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, language = {30}, DOI = {10.1109/ARFTG.2017.8000823}, stag_bib_extends_levelofaccess = {NA}, author = {Schmuckle, F.J. and Probst, T. and Arz, U. and Phung, G.N. and Doerner, R. and Heinrich, W.} } @Article { LopezAPBSL2017, subid = {139}, title = {Hybrid fiber links for accurate optical frequency comparison}, journal = {Applied Physics B}, year = {2017}, month = {5}, volume = {123}, number = {5}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, keywords = {Hybrid fiber links, accurate optical frequency comparison,}, web_url = {https://link.springer.com/article/10.1007/s00340-017-6736-5}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-017-6736-5}, stag_bib_extends_levelofaccess = {NA}, author = {Lee, W.K. and Stefani, F. and Bercy, A. and Lopez, O. and Amy-Klein, A. and Pottie, P.E.} } @Article { SantarelliLLCCMWKKCSNRQDLBRGGAWGALLPG2017, subid = {138}, title = {First international comparison of fountain primary frequency standards via a long distance optical fiber link}, journal = {Metrologia}, year = {2017}, month = {5}, volume = {54}, number = {3}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {348-354}, keywords = {optical fiber frequency transfer, atomic fountain clocks, international fountain, clock comparison}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/aa65fe}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa65fe}, stag_bib_extends_levelofaccess = {NA}, author = {Guena, J and Weyers, S and Abgrall, M and Grebing, C and Gerginov, V and Rosenbusch, P and Bize, S and Lipphardt, B and Denker, H and Quintin, N and Raupach, S M F and Nicolodi, D and Stefani, F and Chiodo, N and Koke, S and Kuhl, A and Wiotte, F and Meynadier, F and Camisard, E and Chardonnet, C and Le Coq, Y and Lours, M and Santarelli, G and Amy-Klein, A and Le Targat, R and Lopez, O and Pottie, P E and Grosche, G} } @Article { CaldersBADNMOB2017, title = {Evaluation of the Range Accuracy and the Radiometric Calibration of Multiple Terrestrial Laser Scanning Instruments for Data Interoperability}, journal = {IEEE Transactions on Geoscience and Remote Sensing}, year = {2017}, month = {5}, volume = {55}, number = {5}, number2 = {ENV53: MetEOC2: Metrology for earth observation and climate}, pages = {2716-2724}, keywords = {Data interoperability, radiometric calibration, RIEGL VZ-400, terrestrial light detection and ranging (LiDAR).}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, USA}, language = {30}, ISSN = {0196-2892, 1558-0644}, DOI = {10.1109/TGRS.2017.2652721}, stag_bib_extends_levelofaccess = {NA}, author = {Calders, Kim and Burt, Andrew and Armston, John and Disney, Mathias I. and Nightingale, Joanne and Muir, Jasmine and Origo, Niall and Brede, Benjamin} } @Article { KataokaAKBG2017, subid = {313}, title = {Robust operation of a GaAs tunable barrier electron pump}, journal = {Metrologia}, year = {2017}, month = {4}, volume = {54}, number = {3}, number2 = {15SIB08: e-SI-Amp: Quantum realisation of the SI ampere}, pages = {299-306}, keywords = {single-electron pumps, primary electrical metrology, current standards}, web_url = {http://iopscience.iop.org/article/10.1088/1681-7575/54/1/S1/meta;jsessionid=4918445C3978B8F392DE6A658FA21463.ip-10-40-1-105}, web_url2 = {http://www.e-si-amp.eu/outputs/}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/1681-7575/aa634c}, stag_bib_extends_levelofaccess = {NA}, author = {Giblin, S P and Bae, M-H and Kim, N and Ahn, Ye-Hwan and Kataoka, M} } @Article { deClercqGYCAB2017, title = {A high-performance Raman-Ramsey Cs vapor cell atomic clock}, journal = {Journal of Applied Physics}, year = {2017}, month = {3}, day = {14}, volume = {121}, number = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {104903}, keywords = {Frequency standard, laser, resonances, stability, shift}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0021-8979, 1089-7550}, DOI = {10.1063/1.4977955}, stag_bib_extends_levelofaccess = {NA}, author = {de Clercq, E. and Gu{\'e}randel, S. and Yun, P. and Coget, G. and Abdel Hafiz, M. and Boudot, R.} } @Article { SchumacherACMMCKMSCK2017, subid = {252}, title = {Magnetic scanning gate microscopy of CoFeB lateral spin valve}, journal = {AIP Advances}, year = {2017}, month = {3}, volume = {7}, number = {5}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {056808}, keywords = {AbstractDevices comprised of CoFeB nanostructures with perpendicular magnetic anisotropy and non-magnetic Ta channel were operated in thermal lateral spin valve (LSV) mode and studied by magnetotransport measurements and magnetic scanning gate microscopy (SGM). Due to the short spin diffusion length of Ta, the spin diffusion signal was suppressed, allowing the study of the contribution from the anomalous Nernst (ANE) and anomalous Hall effects (AHE). The magnetotransport measurements identified the switching fields of the CoFeB nanostructures and demonstrated a combination of AHE and ANE when the devices were operated in thermally-driven spin-injection mode. Modified scanning probe microscopy probes were fabricated by placing a NdFeB magnetic bead (MB) on the apex of a commercial Si probe. The dipole magnetic field distribution around the MB was characterized by using differential phase contrast technique and direct measurement of the switching field induced by the bead in the CoFeB nanodevices. Using SGM we demonstrate the influence of localized magnetic field on the CoFeB nanostructures near the non-magnetic channel. This approach provides a promising route towards the study of thermal and spin diffusion effects using local magnetic fields.}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {AIP Publishing}, language = {30}, ISSN = {2158-3226}, DOI = {10.1063/1.4977891}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Scarioni, A.F. and Mansell, R. and Krzysteczko, P. and Cox, D. and McGrouther, D. and McVitie, S. and Cowburn, R. and Schumacher, H.W. and Antonov, V. and Kazakova, O.} } @Article { MartinezVerduLAKOGKJFSPSC2017, title = {Multilateral spectral radiance factor scale comparison}, journal = {Applied Optics}, year = {2017}, month = {3}, volume = {56}, number = {7}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {1996}, keywords = {BSDF, BRDF, BTDF, Densitometers, reflectometers, Reflection.}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Optical Society}, address = {2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States}, language = {30}, ISSN = {0003-6935, 1539-4522}, DOI = {10.1364/AO.56.001996}, stag_bib_extends_levelofaccess = {NA}, author = {Mart{\'i}nez-Verd{\'u}, F. M. and Leloup, F. B. and Audenaert, J. and K{\"a}llberg, S. and Obein, G. and Ged, G. and Koo, A. and Jaanson, P. and Ferrero, A. and Strothk{\"a}mper, C. and Perales, E. and Schirmacher, A. and Campos, J.} } @Article { , title = {The new INRIM rotating encoder angle comparator (REAC)}, journal = {Measurement Science and Technology}, year = {2017}, month = {2}, day = {16}, volume = {28}, number = {4}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-10}, keywords = {angle metrology, angle encoder, absolute encoder, nanoradians, autocollimators}, web_url = {http://iopscience.iop.org/article/10.1088/1361-6501/aa5af6}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd.}, address = {Bristol BS1 6HG, United Kingdom}, language = {30}, ISSN = {Online ISSN: 1361-6501, Print ISSN: 0957-0233}, DOI = {10.1088/1361-6501/aa5af6}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Pisani, M and Astrua, M} } @Article { StagniRPNNMMLFBBAACZC2017, subid = {134}, title = {A VLBI experiment using a remote atomic clock via a coherent fibre link}, journal = {Scientific Reports}, year = {2017}, month = {2}, volume = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {40992}, keywords = {VLBI experiment, remote atomic clock}, web_url = {https://www.nature.com/articles/srep40992}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep40992}, stag_bib_extends_levelofaccess = {NA}, author = {Clivati, C. and Ambrosini, R. and Artz, T. and Bertarini, A. and Bortolotti, C. and Frittelli, M. and Levi, F. and Mura, A. and Maccaferri, G. and Nanni, M. and Negusini, M. and Perini, F. and Roma, M. and Stagni, M. and Zucco, M. and Calonico, D.} } @Article { PavsiDBFVJSeHRKMAAM2017, subid = {2144}, title = {Inter-laboratory assessment of different digital PCR platforms for quantification of human cytomegalovirus DNA}, journal = {Analytical and Bioanalytical Chemistry}, year = {2017}, month = {1}, day = {26}, volume = {409}, number = {10}, number2 = {HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms}, pages = {2601-2614}, keywords = {Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer Science and Business Media LLC}, language = {30}, ISSN = {1618-2642, 1618-2650}, DOI = {10.1007/s00216-017-0206-0}, stag_bib_extends_levelofaccess = {NA}, author = {Pavšič, J. and Devonshire, A. and Blejec, A. and Foy, C.A. and Van Heuverswyn, F. and Jones, G.M. and Schimmel, H. and Zel, J. and Huggett, J.F. and Redshaw, N. and Karczmarczyk, M. and Mozioglu, E. and Aky{\"u}rek, S. and Akg{\"o}z, M. and Milavec, M.} } @Article { DucourtieuxCBAFF2017, title = {Modelling of the X,Y,Z positioning errors and uncertainty evaluation for the LNE's mAFM using the Monte Carlo method}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {23}, volume = {28}, number = {3}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {034007}, keywords = {atomic force microscope, metrology, virtual instrument, measurement uncertainty, Monte Carlo method, Morris design, Sobol indices}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IOP Publishing}, address = {Temple Circus, Temple, Bristol, BS1 6BE, United Kingdom}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/28/3/034007}, stag_bib_extends_levelofaccess = {NA}, author = {Ducourtieux, Sebastien and Ceria, Paul and Boukellal, Younes and Allard, Alexandre and Fischer, Nicolas and Feltin, Nicolas} } @Article { JennettAH2017, subid = {381}, title = {Establishing isothermal contact at a known temperature under thermal equilibrium in elevated temperature instrumented indentation testing}, journal = {Measurement Science and Technology}, year = {2017}, month = {1}, day = {13}, volume = {28}, number = {2}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {025016}, keywords = {nano-indentation, elevated temperature, thermal equilibrium, isothermal contact}, web_url = {https://pure.coventry.ac.uk/ws/portalfiles/portal/8188288/Establishing_isothermal_contact_accepted_MST_104245_corrected_postprint.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/1361-6501/aa533d}, stag_bib_extends_levelofaccess = {NA}, author = {Hou, X.D. and Alvarez, C.L.M. and Jennett, N.M.} } @Article { VavassoriAMCNCPK2017, subid = {255}, title = {V-shaped domain wall probes for calibrated magnetic force microscopy}, journal = {IEEE Transactions on Magnetics}, year = {2017}, number2 = {15SIB06: NanoMag: Nano-scale traceable magnetic field measurements}, pages = {1-1}, keywords = {Probes, Magnetic domains, Magnetic resonance imaging, Magnetic field measurement, Perpendicular magnetic anisotropy, Saturation magnetization}, web_url = {https://pure.royalholloway.ac.uk/portal/en/publications/vshaped-domain-wall-probes-for-calibrated-magnetic-force-microscopy(9c2d50b1-9b1a-4aae-9b39-ca8c1864daf3).html}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {0018-9464, 1941-0069}, DOI = {10.1109/TMAG.2017.2694324}, stag_bib_extends_levelofaccess = {NA}, author = {Puttock, R. and Corte-Le{\'o}n, H. and Neu, V. and Cox, D. and Manzin, A. and Antonov, V. and Vavassori, P. and Kazakova, O.} } @Article { , title = {Alternative Conducted Immunity Tests}, journal = {IEEE Electromagnetic Compatibility Magazine}, year = {2016}, month = {12}, day = {15}, volume = {5}, number = {3}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {45-51}, keywords = {Alternative, Current Probe, CDN, Conducted Immunity, EMC, High Current, Industry, Mains Impedance}, web_url = {http://ieeexplore.ieee.org/document/7764249/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, language = {30}, ISSN = {2162-2272}, DOI = {10.1109/MEMC.0.7764249}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {\c{C}akır, Soydan and Şen, Osman and ACAK, Savaş and AZPURUA, Marco and SILVA, Ferran and \c{C}etintaş, Mustafa} } @Techreport { HultMSMLAVP2016, title = {Metrodecom: JRC-Geel Radionuclide Metrology Sector contribution to WP5 Task 2: Reference materials and standard sources for radiochemical analysis}, journal = {JRC Technical report}, year = {2016}, month = {12}, number2 = {ENV54: MetroDecom: Metrology for decommissioning nuclear facilities}, keywords = {Reference materials, Radiochemical analysis, standard sources}, web_url = {http://publications.jrc.ec.europa.eu/repository/handle/JRC103355}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {European commission Publication office}, address = {Luxemburg}, language = {30}, ISBN = {978-92-79-63506-9}, ISSN = {1831-9424}, DOI = {10.2789/949534}, stag_bib_extends_levelofaccess = {NA}, author = {Hult, M. and Marissens, G. and Stroh, H. and Marouli, M. and Lutter, G. and Altzitzoglou, T. and Van Ammel, R. and Pomm{\'e}, S.} } @Article { , title = {Creation and characterization of He-related color centers in diamond}, journal = {Journal of Luminescence}, year = {2016}, month = {11}, day = {1}, volume = {179}, number = {November 2016}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {59-63}, keywords = {Diamond; Color center; Defect; Ion implantation; Photoluminescence}, web_url = {http://www.journals.elsevier.com/journal-of-luminescence}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {0022-2313}, DOI = {10.1016/j.jlumin.2016.06.039}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-1}, author = {J. Forneris, J. and A. Tengattini, A. and S. Ditalia Tchernij, S. and F. Picollo, F. and A. Battiato, A. and P. Traina, P. and I.P. Degiovanni, I.P. and E. Moreva, E. and G. Brida, G. and V. Grilj, V. and N. Skukan, N. and M. Jakšić, M. and M. Genovese, M. and P. Olivero, P.} } @Article { PlagFHPFFMAEAFH2016, title = {Results of the Fifth International Spectroradiometer Comparison for Improved Solar Spectral Irradiance Measurements and Related Impact on Reference Solar Cell Calibration}, journal = {IEEE Journal of Photovoltaics}, year = {2016}, month = {11}, volume = {6}, number = {4}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {1004-1011}, keywords = {Intercomparison, irradiance, calibration, solar simulator}, web_url = {http://ieeexplore.ieee.org/document/7576644/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2606698}, stag_bib_extends_levelofaccess = {NA}, author = {Plag, F. and Friederichs, M. and Halwachs, M. and Pravettoni, M. and Fucci, R. and Ferretti, N. and Minuto, A. and Alonso-Alvarez, D. and Ekins-Daukes, N. and Alonso-Alvarez, D. and Friedrich, D. and Haverkamp, E.} } @Article { GorenBTZSMPRFAF2016, title = {Towards tributyltin quantification in natural water at the Environmental Quality Standard level required by the Water Framework Directive}, journal = {Talanta}, year = {2016}, month = {11}, volume = {160}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {499-511}, keywords = {ICP-MS, Isotope Dilution, Limit of quantification, Metrological traceability, Tributyltin, Water Framework Directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0039-9140}, DOI = {10.1016/j.talanta.2016.07.056}, stag_bib_extends_levelofaccess = {NA}, author = {Goren, A.C. and B{\'i}lsel, M. and Tun\c{c}, M. and Zuliani, T. and Sčančar, J. and Milačič, R. and Philipp, R. and Richter, J. and Fettig, I. and Alasonati, E. and Fisicaro, P.} } @Article { YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016, subid = {321}, title = {Versailles Project on Advanced Materials and Standards Interlaboratory Study on Measuring the Thickness and Chemistry of Nanoparticle Coatings Using XPS and LEIS}, journal = {The Journal of Physical Chemistry C}, year = {2016}, month = {10}, day = {27}, volume = {120}, number = {42}, number2 = {14IND12: Innanopart: Metrology for innovative nanoparticles}, pages = {24070-24079}, keywords = {VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory}, web_url = {https://spiral.imperial.ac.uk/handle/10044/1/40824}, misc2 = {EMPIR 2014: Industry}, publisher = {American Chemical Society (ACS)}, address = {CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States}, language = {30}, ISSN = {1932-7447, 1932-7455}, DOI = {10.1021/acs.jpcc.6b06713}, stag_bib_extends_levelofaccess = {NA}, author = {Belsey, N.A. and Cant, D. and Cant, D.J.H. and Minelli, C. and Araujo, J.R. and Bock, B. and Br{\"u}ner, P. and Castner, D.G. and Ceccone, G. and Counsell, J.D.P. and Dietrich, P.M. and Engelhard, M.H. and Fearn, S. and Galhardo, C.E. and Kalbe, H. and Kim, J.W. and Lartundo-Rojas, L. and Luftman, H.S. and Nunney, T.S. and Pseiner, J. and Smith, E.F. and Spampinato, V. and Sturm, J.M. and Thomas, A.G. and Treacy, J.P.W. and Veith, L. and Wagstaffe, M. and Wang, H. and Wang, M. and Wang, Y.C. and Werner, W. and Yang, L.} } @Article { VilllaLCDBGLAPTZG2016, subid = {231}, title = {Measuring Incompatible Observables by Exploiting Sequential Weak Values}, journal = {Physical Review Letters}, year = {2016}, month = {10}, day = {20}, volume = {117}, number = {17}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {170402}, keywords = {Weak Measurements, Optical tests of quantum theory, Weak Values}, web_url = {https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.170402}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.117.170402}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Levi, M. P. and Gramegna, M. and Brida, G. and Degiovanni, I. P. and Cohen, E. and Lussana, R. and Villa, F. and Tosi, A. and Zappa, F. and Genovese, M.} } @Article { RantosonNAM2016, subid = {1551}, title = {Improved curvature-based registration methods for high-precision dimensional metrology}, journal = {Precision Engineering}, year = {2016}, month = {10}, volume = {46}, number2 = {15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses}, pages = {232-242}, keywords = {Improved curvature-based registration methods for high-precision dimensional metrology}, web_url = {https://hal.archives-ouvertes.fr/hal-01363750/document}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Elsevier BV}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2016.05.002}, stag_bib_extends_levelofaccess = {NA}, author = {Rantoson, R. and Nouira, H. and Anwer, N. and Mehdi-Souzani, C.} } @Article { RietveldvJJNCAC2016, title = {Measurement of the harmonic impedance of the aggregated distribution network}, journal = {2016 17th International Conference on Harmonics and Quality of Power (ICHQP)}, year = {2016}, month = {10}, number2 = {ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics}, keywords = {Phasor measurement units, Power Quality, Power system harmonics, Impedance measurement, Harmonic impedance, Load modeling}, tags = {SEG}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, DOI = {10.1109/ICHQP.2016.7783374}, stag_bib_extends_levelofaccess = {NA}, author = {Rietveld, G. and van den Brom, H.E. and Jongepier, A. and Jin, W. and Ni, F. and Cuk, V. and Acanski, M. and Cobben, J.F.G.} } @Article { ReganCBABS2016, title = {A comparison of emerging gamma detector technologies for airborne radiation monitoring}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {10}, volume = {763}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {012010}, keywords = {gamma detector, airborne radiation monitoring, radiation monitoring}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {IOP Publishing}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/763/1/012010}, stag_bib_extends_levelofaccess = {NA}, author = {Regan, P H and Collins, S M and Beeke, S and Aitken-Smith, P and Bell, S J and Shearman, R} } @Thesis { AlMasoudi2016, title = {A strontium lattice clock with reduced blakbody radiation shift}, year = {2016}, month = {9}, day = {30}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, keywords = {optical lattice clock, black body radiation shift, frequency accuracy}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Leibnitz university}, school = {Leibnitz university}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://www.tib.eu/en/search/id/TIBKAT\%3A870652028/A-strontium-lattice-clock-with-reduced-blackbody/?tx_tibsearch_search\%5Bsearchspace\%5D=tn}, author = {Al-Masoudi, A.} } @Article { , title = {Improvement of an Atomic Clock using Squeezed Vacuum}, journal = {Physical Review Letters}, year = {2016}, month = {9}, day = {28}, volume = {117}, number = {14}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {143004}, keywords = {clock, spin squeezing, squeezed vacuum}, web_url = {http://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.143004}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {Washington, DC, USA}, language = {30}, ISSN = {0031-9007}, DOI = {10.1103/PhysRevLett.117.143004}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kruse, I and Lange, K and Peise, J and L{\"u}cke, B and Pezz{\`e}, L and Arlt, J and Ertmer, W and Lisdat, C and Santos, L and Smerzi, A and Klempt, C} } @Article { XanthosLCA2016, title = {Radon migration in soil and its relation to terrestrial gamma radiation in different locations of the Greek early warning system network}, journal = {Radiation Protection Dosimetry}, year = {2016}, month = {9}, day = {24}, volume = {175}, number = {1}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, keywords = {radon in soil, radon migration in soil, long term measurements}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncw277}, stag_bib_extends_levelofaccess = {NA}, author = {Xanthos, S. and Leontaris, F. and Clouvas, A. and Alifragis, D.} } @Article { RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016, title = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, journal = {Atmospheric Chemistry and Physics}, year = {2016}, month = {9}, day = {23}, volume = {16}, number = {18}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {11915-11935}, keywords = {Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7324}, DOI = {10.5194/acp-16-11915-2016}, stag_bib_extends_levelofaccess = {NA}, author = {Ramachandran, R. and Fu, X. and Zhang, H. and Feng, X.B. and Wip, D. and Obolkin, V. and Mashyanov, N. and Sena, F. and Gawlik, B.M. and Neves, L.M. and Read, K.A. and Kotnik, J. and Horvat, M. and Skov, H. and Magand, O. and Angot, H. and Dommergue, A. and Garcia, P.E. and Di{\'e}guez, M.D.C and Barbante, C. and Cairns, W. and Brito, J. and Barbosa, H.D.M.J and Morais, F. and Artaxo, P. and W{\"a}ngberg, I. and Munthe, J. and Martin, L. and Labuschagne, C. and Brunke, E.G. and Weigelt, A. and Ebinghaus, R. and Landis, M. and Mannarino, V. and Cinnirella, S. and Carbone, F. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Cossa, D. and Knoery, J. and Marusczak, Nicolas and Nerentorp, M. and Fisicaro, P.} } @Proceedings { , title = {Convolution and deconvolution of bidirectional scatter distribution function data to enable inter-instrument comparison}, journal = {Proceedings of the 4th CIE Expert Symposium on Colour and Visual Appearance}, year = {2016}, month = {9}, volume = {CIE x043:2016}, number = {-}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {427-431}, keywords = {Bidirectional Scatter Distribution Function, Convolution, Deconvolution}, web_url = {http://div2.cie.co.at/?i_ca_id=985}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {CIE}, address = {Vienna}, event_place = {Prague}, event_name = {4th CIE Expert Symposium on Colour and Visual Appearance}, event_date = {06-09-2016 to 07-11-2016}, language = {30}, ISBN = {978-3-902842-59-6}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Audenaert, J. and Hanselaer, P. and Leloup, F. B.} } @Article { , title = {Experimental Evaluation of Ball Bar Standard Thermal Properties by Simulating Real Shop Floor Conditions}, journal = {International Journal of Simulation Modelling}, year = {2016}, month = {9}, volume = {15}, number = {3}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {511-521}, keywords = {Traceability, Co-Ordinate Measurement, Measurement Standard, Thermal Expansion}, web_url = {http://www.ijsimm.com/Full_Papers/Fulltext2016/text15-3_511-521.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {DAAAM Internbational}, address = {Vienna}, language = {30}, ISSN = {1726-4529}, DOI = {10.2507/IJSIMM15(3)10.356}, extern = {1}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.ijsimm.com/}, author = {Klobucar, R. and Acko, B.} } @Article { , title = {Comparing methods for evaluating measurement uncertainty given in the JCGM ‘Evaluation of Measurement Data’ documents}, journal = {Measurement}, year = {2016}, month = {8}, day = {31}, volume = {94}, number = {December 2016}, number2 = {14IND10: MET5G: Metrology for 5G communications}, pages = {847–851}, keywords = {measurement uncertainty, GUM, GUM supplements, microwave scattering parameters, standard uncertainty}, web_url = {http://www.sciencedirect.com/science/article/pii/S0263224116304766}, misc2 = {EMPIR 2014: Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, language = {30}, DOI = {10.1016/j.measurement.2016.08.015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-8-31}, author = {Stant, L.T. and Aaen, P.H. and Ridler, N. M.} } @Article { , title = {Reasons justifying a revision of the existing sound power measurement standards}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {29}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {sound power level, transfer standard source, sound power measurement standards , Traceability I-INCE Classifacation of Subjects Number(s): 72.4}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arendt, I. and Kurtz, P.} } @Article { , title = {Numerical modeling of the primary source in a hemi-anechoic room}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, Free Field, Directivity}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {German Acoustical Society (Deutsche Gesellschaft f{\"u}r Akustik, DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arina, R. and V{\"o}lkel, K.} } @Article { , title = {Main achievements of the EMRP sound power project and future prospects}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound Power, Primary Standard I-INCE Classification of Subjects Number(s): 72.4}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Guglielmone, C. and Wittstock, V. and Kirbas, C. and Andersson, H.} } @Article { , title = {Automatic sound field sampling mechanisms to disseminate the unit watt in airborne sound}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, traceability; Calibration; Free-field over a reflecting plane (hemi-anechoic rooms)I-INCE Classification of Subjects Number(s): 72.4, 71.9 and 73.2}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Cellard, P. and Andersson, H. and Brezas, S. and Wittstock, V.} } @Article { , title = {Primary sound power sources for the realisation of the unit watt in airborne sound}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound Power, Primary Sound Power Source, Rayleigh’s Integral}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kirbas, C. and Andersson, H. and Guglielmone, C. and Bilgi\c{c}, E.} } @Article { , title = {Traceable sound power measurements in essentially diffuse or free fields}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, traceability I-INCE Classification of Subjects Number(s): 72.4}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Andersson, H. and Wittstock, V.} } @Article { , title = {Dissemination of the unit watt in airborne sound: aerodynamic reference sound sources as transfer standards}, journal = {InterNoise 2016}, year = {2016}, month = {8}, day = {26}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {Sound power, dissemination, directivity, correction, substitution I-INCE Classification of Subjects Number(s): 72.4}, web_url = {http://www.internoise2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Brezas, S. and Cellard, P. and Andersson, H. and Guglielmone, C. and Kirbas, C.} } @Article { TsaidPA2016, title = {Tuneable on-demand single-photon source in the microwave range}, journal = {Nature Communications}, year = {2016}, month = {8}, day = {22}, volume = {7}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {12588}, keywords = {Microwave photonics, Quantum information, Single photons and quantum effects}, web_url = {http://www.nature.com/articles/ncomms12588}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Nature}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms12588}, stag_bib_extends_levelofaccess = {NA}, author = {Tsai, J. S. and de Graaf, S. E. and Peng, Z. H. and Astafiev, O. V.} } @Article { QuinonesANSBM2016, title = {The Influence of Radon (Gas and Progeny) and Weather Conditions on Ambient Dose Equivalent Rate}, journal = {Radiation Protection Dosimetry}, year = {2016}, month = {8}, day = {13}, volume = {174}, number = {3}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {1-8}, keywords = {radon, radon progeny, ambient dose equivalent rate, dosimetry}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncw219}, stag_bib_extends_levelofaccess = {NA}, author = {Qui{\~n}ones, J. and Alvarez, A. and Navarro, N. and Saez, J. C. and Benito, G. and M{\'a}rquez, J. L.} } @Proceedings { , title = {Accurate Phase Calibration of PMUs and PMU Calibrators}, journal = {Proceedings of the Conference on Precision Electromagnetic Measurements 2016}, year = {2016}, month = {8}, day = {11}, volume = {2016}, number = {1}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1-2}, keywords = {aperture delay, calibration, phasor measurement unit, phase measurement, PMU, synchrophasor.}, web_url = {http://ieeexplore.ieee.org/document/7540461/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa, Canada}, event_name = {Conference on Precision Electromagnetic Measurements (CPEM)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540461}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Acanski, M and Rietveld, G and Hoogenboom, D} } @Proceedings { , title = {Magnetocapacitance and Dissipation Factor of Epitaxial Graphene Hall Bars}, journal = {Digest on Conference on Precision Electromagnetic Measurements (CPEM2016)}, year = {2016}, month = {8}, day = {11}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {graphene, quantum Hall effect, coaxial bridge circuit, magnetocapacitance, dissipation factor}, web_url = {http://ieeexplore.ieee.org/document/7540651/?denied}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540651}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schurr, J. and Kalmbach, C.C. and Kruskopf, M. and M{\"u}ller, A. and Pierz, K. and Ahlers, F.} } @Proceedings { , title = {Measurement comparison up to 65 GHz in coaxial 1.85 mm line}, journal = {Proceedings of the Conference on Precision Electromagnetic Measurements}, year = {2016}, month = {8}, day = {11}, volume = {n/a}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-2}, keywords = {high frequency circuits, metrology,}, web_url = {http://ieeexplore.ieee.org/document/7540504/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Melville}, event_place = {Ottawa, Canada}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540504}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ei⊘, C and Allal, D and Huerlimann, P and Ruefenacht, J and Zinal, S} } @Proceedings { , title = {Comparison between time- and frequency-domain high-frequency device characterizations}, journal = {CPEM 2016, Conference on Precision Electromagnetic Measurements: conference digest: (2016)}, year = {2016}, month = {8}, day = {11}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {high-frequency devices, vector network analyzer, electro-optic sampling}, web_url = {http://dx.doi.org/10.1109/CPEM.2016.7540727}, web_url2 = {https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Ottawa, Canada}, event_name = {CPEM 2016, Conference on Precision Electromagnetic Measurements}, event_date = {10-15 July 2016}, language = {30}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540727}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, stag_bib_extends_persistent_identifier = {https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E}, author = {Bieler, M. and Arz, U.} } @Proceedings { , title = {Stable arbitrary waveform generator as a transfer standard for ADC calibration}, journal = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016), Conference Digest}, year = {2016}, month = {8}, day = {11}, volume = {CPEM 2016 Conference Digest}, number = {1}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {1-2}, keywords = {ac voltage measurement, signal synthesis, digital-to-analog converter, analog-to-digital converter, comparison, sampling, ac-dc transfer.}, web_url = {http://ieeexplore.ieee.org/document/7540454/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {New York, USA}, event_place = {Ottawa, Canada}, event_name = {2016 Conference on Precision Electromagnetic Measurements (CPEM 2016)}, event_date = {July 10-15, 2016}, language = {30}, ISBN = {978-1-4673-9134-4}, ISSN = {2160-0171}, DOI = {10.1109/CPEM.2016.7540454}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Nissila, J. and Lee, J. and Sira, M. and {\"O}zt{\"u}rk, T. and Arifovic, M. and Diaz de Aguilar, J. and Lapuh, R. and Behr, R.} } @Article { , title = {Calibration systems for analogue non-conventional voltage and current transducers}, journal = {Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on}, year = {2016}, month = {8}, day = {11}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, keywords = {Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measure-ment standards, High-Voltage techniques}, tags = {SEG}, web_url = {http://ieeexplore.ieee.org/document/7540488/}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, language = {30}, ISSN = {978-1-4673-9134-4}, DOI = {10.1109/CPEM.2016.7540488}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Houtzager, E and Mohns, E and Fricke, S and Ayhan, B and Cayci, H} } @Article { , title = {SI traceable determination of the spring constant of a soft cantilever using a nanonewton force facility based on electrostatic methods}, journal = {Metrologia}, year = {2016}, month = {8}, day = {1}, volume = {53 (2016)}, number = {4}, number2 = {NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects}, pages = {1031-1044}, keywords = {Nanonewton force facility Spring constant Soft cantilever Contact potential SI-traceable determination}, web_url = {http://www.ingentaconnect.com/content/iop/met/2016/00000053/00000004/art01031}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP Publishing Ltd.}, address = {Bristol}, language = {30}, ISSN = {0026-1394 (print) ; 1681-7575 (online)}, DOI = {10.1088/0026-1394/53/4/1031}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Nesterov, V. and Belai, O. and Nies, D. and Buetefisch, S. and Muelelr, M. and Ahbe, T. and Neparty, D. and Popadic, R. and Wolff, H.} } @Article { SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016, subid = {135}, title = {A clock network for geodesy and fundamental science}, journal = {Nature Communications}, year = {2016}, month = {8}, volume = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, pages = {12443}, keywords = {Clock network; geodesy;}, web_url = {https://www.nature.com/articles/ncomms12443}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms12443}, stag_bib_extends_levelofaccess = {NA}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and Doerscher, S. and Haefner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G. and Amy-Klein, A. and Le Targat, R. and Lodewyck, J. and Lopez, O and Pottie, P.-E.} } @Article { SvecSSRPNMLKJGFFDMAHBTTVW2016_2, title = {60Co in cast steel matrix: A European interlaboratory comparison for the characterisation of new activity standards for calibration of gamma-ray spectrometers in metallurgy}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {8}, volume = {114}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {167-172}, keywords = {Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2016.05.014}, stag_bib_extends_levelofaccess = {NA}, author = {Svec, A. and Solc, J. and Silva, L. and Reis, M. and Peyres, V. and Nečemer, M. and Moser, H. and Luca, A. and Klemola, S. and Javornik, A. and Garc{\'i}a-Tora{\~n}o, E. and Ferreux, L.. and Fazio, A. and Dry{\'a}k, P. and Marroyo, B.C. and Arnold, D. and Hult, M. and Burda, O. and Tzika, F. and Tyminski, Z. and Vodenik, B. and W{\"a}tjen, U.} } @Proceedings { , title = {First ac measurements of the quantum Hall effect in epitaxial graphene}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2016}, month = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {38--39}, keywords = {AC analysis technique,AC loss elimination,AC measurement,C,Electrical resistance measurement,Gallium arsenide,Graphene,Hall effect,Impedance,Noise,Resistance,electric current measurement,epitaxial graphene-based impedance standard,graphene,impedance,quantized Hall resistance,quantum Hall effect,spectral noise density}, web_url = {http://ieeexplore.ieee.org/articleDetails.jsp?arnumber=6898247}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898247}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kalmbach, C. and Schurr, J. and Ahlers, F.J. and M{\"u}ller, A. and Novikov, S. and Lebedeva, N. and Satrapinsky, A.} } @Article { , title = {Long-term Stability of Al2O3 Passivated Black Silicon}, journal = {Energy Procedia}, year = {2016}, month = {8}, volume = {92}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {341-346}, keywords = {Black silicon, Nano-texturing, Surface passivation, Lifetime, Atomic layer deposition, Al2O3, Solar cells}, web_url = {http://www.sciencedirect.com/science/article/pii/S1876610216305203}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier}, language = {30}, DOI = {10.1016/j.egypro.2016.07.093}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Calle, E. and Ortega, P. and von Gastrow, G. . and Martin, I and Savin, H. and Alcubilla, R.} } @Article { FisicaroPJPFRA2016, title = {Determination of tributyltin in whole water matrices under the European Water Framework Directive}, journal = {Journal of Chromatography A}, year = {2016}, month = {8}, volume = {1459}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {112-119}, keywords = {Environmental quality standard (EQS), Humic acid, Isotope dilution, Surface water, Suspended particulate matter, Tributyltin (TBT)}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-9673}, DOI = {10.1016/j.chroma.2016.06.068}, stag_bib_extends_levelofaccess = {NA}, author = {Fisicaro, P. and Panne, U. and Jakubowski, N. and Philipp, R. and Fettig, I. and Richter, J. and Alasonati, E.} } @Article { , title = {Giant quantum Hall plateaus generated by charge transfer in epitaxial graphene}, journal = {Nature: Scientific Reports}, year = {2016}, month = {7}, day = {26}, volume = {6}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {30296}, keywords = {graphene, measurement, QHE,}, web_url = {http://www.nature.com/articles/srep30296?WT.feed_name=subjects_physical-sciences}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Scientific reports}, language = {30}, DOI = {10.1038/srep30296}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Alexander-Webber, J.A. and Huang, J. and Maude, D.K. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.} } @Article { WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016, title = {Five-year records of Total Mercury Deposition flux at GMOS sites in the Northern and Southern Hemispheres}, journal = {Atmospheric Chemistry and Physics Discussions}, year = {2016}, month = {7}, day = {20}, number2 = {ENV51: MeTra: Traceability for mercury measurements}, pages = {1-33}, keywords = {mercury, wet deposition flux,}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Copernicus GmbH}, language = {30}, ISSN = {1680-7375}, DOI = {10.5194/acp-2016-517}, stag_bib_extends_levelofaccess = {NA}, author = {W{\"a}ngberg, I. and Walters, C. and Vard{\`e}, M. and Spandow, P. and Somerset, V. and Sena, F. and Islas, M.R. and Obolkin, V. and Munthe, J. and Mkololo, T. and Mashyanov, N. and Martin, L. and Magand, O. and Labuschagne, C. and Kotnik, J. and Horvat, M. and Hansson, K. and Hagestr{\"o}m, U. and Gawlik, B. and Garcia, P.E. and Fu, X. and Feng, X.B. and Ebinghaus, R. and Dommergue, A. and Di{\'e}guez, M.D.C. and Comero, S. and Cairns, W. and Arcega-Cabrera, F. and Brunke, E.G. and Barbante, C. and Angot, H. and D'Amore, F. and Bencardino, M. and Pirrone, N. and Sprovieri, F. and Weigelt, A. and Yang, X. and Fisicaro, P.} } @Article { , title = {High resolution kilometric range optical telemetry in air by radio frequency phase measurement}, journal = {Review of Scientific Instruments}, year = {2016}, month = {7}, day = {12}, volume = {87}, number = {2016}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {075101}, keywords = {telemeter, ADM, laser tracker}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/87/7/10.1063/1.4954180}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, DOI = {10.1063/1.4954180}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Guillory, J. and Šm{\'i}d, R. and Garcia-M{\'a}rquez, J. and Truong, D. and Alexandre, C. and Wallerand, J.-P.} } @Proceedings { , title = {Comparison of Calibration Methods for Multiport VNAs up to 67 GHz}, journal = {Conference on Precision Electromagnetic Measurements, Ottawa, Canada, 10 – 15 July 2016 (CPEM 2016)}, year = {2016}, month = {7}, day = {10}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {N/A}, keywords = {VNA characterization, multiport measurements, calibration methods, error correction models}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7540728}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, USA}, event_place = {Ottawa, Canada}, event_name = {Conference on Precision Electromagnetic Measurements 2016 (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, DOI = {10.1109/CPEM.2016.7540728}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Zinal, S. and Allal, D. and Salter, M.} } @Proceedings { , title = {Uncertainty Evaluation of Balanced S-Parameter Measurements}, journal = {Conference on Precision Electromagnetic Measurements, Ottawa, Canada, 10 – 15 July 2016}, year = {2016}, month = {7}, day = {10}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {N/A}, keywords = {Balanced devices, electromagnetic simulation, Monte Carlo method, scattering parameters, uncertainty analysis, signal integrity, vector network analyzer.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7540616}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, USA}, event_place = {Ottawa, Canada}, event_name = {Conference on Precision Electromagnetic Measurements 2016 (CPEM 2016)}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, ISBN = {N/A}, ISSN = {N/A}, DOI = {10.1109/CPEM.2016.7540616}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ziade, F. and Hudlicka, M. and Salter, M. and Pavlicek, T. and Allal, D.} } @Article { , title = {Optical to microwave clock frequency ratios with a nearly continuous strontium optical lattice clock}, journal = {Metrologia}, year = {2016}, month = {7}, day = {8}, volume = {53}, number = {4}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {1123}, keywords = {atomic clocks, high precision spectrocopy, frequency ratios, optical lattice clocks}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1123/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/4/1123}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Lodewyck, J and Bilicki, S and Bookjans, E and Robyr, J-L and Shi, C and Vallet, G and Le Targat, R and Nicolodi, D and Le Coq, Y and Gu{\'e}na, J and Abgrall, M and Rosenbusch, P and Bize, S} } @Proceedings { , title = {On-board compact system for full time-domain electromagnetic interference measurements}, journal = {Aerospace EMC (Aerospace EMC), 2016 ESA Workshop on}, year = {2016}, month = {7}, day = {7}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {-}, keywords = {Electromagnetic interference, Antenna measurements, Voltage measurement, Current measurement, Frequency measurement, Time-domain analysis, Lightning}, web_url = {http://ieeexplore.ieee.org/document/7504579/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {-}, event_place = {Valencia (Spain)}, event_name = {Aerospace EMC (Aerospace EMC), 2016 ESA Workshop on}, event_date = {23-05-2016 to 25-05-2016}, language = {30}, ISBN = {978-9-2922-1303-9}, DOI = {10.1109/AeroEMC.2016.7504579}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {16138551}, author = {Azp{\'u}rua, Marco and Pous, Marc and Silva, Ferran} } @Proceedings { , title = {A Calibration Setup for IEC 61850-9-2 Test Sets}, journal = {Not applicable}, year = {2016}, month = {7}, day = {1}, volume = {Not applicable}, number = {Not applicable}, number2 = {ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids}, pages = {Not applicable}, keywords = {IEC 61850-9-2, IEEE 1588, Sample Values, Test, Set, Merging Unit}, tags = {SEG}, web_url = {http://cpem2016.com}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, address = {Piscataway}, event_place = {Ottawa}, event_name = {2016 Conference on Precision Electromagnetic Measurements}, event_date = {10-07-2016 to 15-07-2016}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-7-30}, author = {Agustoni, M. and Mortara, A.} } @Proceedings { , title = {Characterisation of Artificial and Natural Defects in Fibre Reinforced Plastics Designed for Energy Applications Using Active Thermography}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Composite Materials}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-9}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we2i4.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Maierhofer, CM and Krankenhagen, RK and R{\"o}llig, MR and Riemer, SR and Gower, MG and Baker, GB and Lodeiro, ML and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Adibekyan, AA and Gutschwager, BG} } @Proceedings { , title = {Design and manufacture of reference and natural defect artefacts for the evaluation of NDE techniques for fibre reinforced plastic (FRP) composites in energy applications}, journal = {19th World Conference on Non-Destructive Testing 2016}, year = {2016}, month = {7}, volume = {2016}, number = {Composite Materials}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, pages = {1-10}, keywords = {Infrared Testing (IRT), Ultrasonic Testing (UT), Visual and Optical Testing (VT/OT), Other Methods, delamination, validation, carbon fiber reinforced plastic (CFRP), Glass Fiber Reinforced Plastic (GFRP), tensile load, flat bottom hole}, web_url = {http://www.ndt.net/article/wcndt2016/papers/we1e4.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {NDT.net}, address = {Bad Breisig, Germany}, event_place = {Internationales Congress Center M{\"u}nchen Messegel{\"a}nde, Munich, Germany}, event_name = {19th World Conference on Non-Destructive Testing 2016}, event_date = {13-06-2016 to 17-06-2016}, language = {30}, ISBN = {978-3-940283-78-8}, ISSN = {1435-4934}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gower, MG and Lodeiro, ML and Aktas, AA and Shaw, RS and Maierhofer, CM and Krankenhagen, RK and Augustin, SA and R{\"o}llig, MR and Knazovick{\'a}, LK and Blahut, AB and Monte, CM and Judaschke, RJ and Segur, DS} } @Article { EkinsDaukesA2016, title = {Photoluminescence-Based Current–Voltage Characterization of Individual Subcells in Multijunction Devices}, journal = {IEEE Journal of Photovoltaics}, year = {2016}, month = {7}, volume = {6}, number = {4}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {1004-1011}, keywords = {III-V multijunction solar cell measurement, Photoluminescence, Characterization of PV}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=7452344}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {2156-3381, 2156-3403}, DOI = {10.1109/JPHOTOV.2016.2547583}, stag_bib_extends_levelofaccess = {NA}, author = {Ekins-Daukes, N. and Alonso-Alvarez, D.} } @Article { PottieALB2016, subid = {133}, title = {Ultrastable optical frequency dissemination on a multi-access fibre network}, journal = {Applied Physics B}, year = {2016}, month = {6}, day = {25}, volume = {122}, number = {7}, number2 = {15SIB05: OFTEN: Optical frequency transfer - a European network}, web_url = {https://link.springer.com/article/10.1007/s00340-016-6463-3}, misc2 = {EMPIR 2015: SI Broader Scope}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {0946-2171, 1432-0649}, DOI = {10.1007/s00340-016-6463-3}, stag_bib_extends_levelofaccess = {NA}, author = {Bercy, A. and Lopez, O. and Pottie, P.E. and Amy-Klein, A.} } @Article { , title = {High-performance near- and mid-infrared crystalline coatings}, journal = {Optica}, year = {2016}, month = {6}, day = {13}, volume = {3}, number = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {647}, keywords = {(300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings; (310.1860) Deposition and fabrication; (140.4780) Optical resonators.}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington, D.C. 20036-1012 USA}, language = {30}, ISSN = {2334-2536}, DOI = {10.1364/OPTICA.3.000647}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {COLE, G D and ZHANG, W and BJORK, B J and FOLLMAN, D and HEU, P and DEUTSCH, C and SONDERHOUSE, L and ROBINSON, J and FRANZ, C and ALEXANDROVSKI, A and NOTCUTT, M and HECKL, O H and YE, J and ASPELMEYER, M} } @Proceedings { , title = {REAC: The new INRIM rotating encoder angle comparator}, journal = {Proceedings of the 16th International Conference of the European Society for Precision Engineering and Nanotechnology}, year = {2016}, month = {6}, day = {3}, volume = {1}, number = {1}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-2}, keywords = {Angle metrology, angle encoder, nanoradians}, web_url = {http://www.euspen.eu/events/16th-international-conference-exhibition/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {euspen}, address = {Cranfield, Bedfordshire, MK43 0AL, United Kingdom}, event_place = {Nottingham, UK}, event_name = {Cranfield, Bedfordshire, MK43 0AL, United Kingdom}, event_date = {30 May – 3 June 2016}, language = {30}, ISBN = {9780956679086}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.euspen.eu/events/16th-international-conference-exhibition/}, author = {Pisani, M and Astrua, M} } @Article { , title = {Atomic fountains and optical clocks at SYRTE: Status and perspectives}, journal = {Comptes Rendus Physique}, year = {2016}, month = {6}, day = {1}, volume = {16}, number = {5}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {461 - 470}, keywords = {Atomic fountain clocks, Optical lattice clocks, Optical frequency combs, Stability of natural constants, Timekeeping}, web_url = {http://www.sciencedirect.com/science/article/pii/S1631070515000614}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {n/a}, DOI = {10.1016/j.crhy.2015.03.010}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-6-1}, author = {Abgrall, M and Chupin, B and De Sarlo, L and Guena, J and Laurent, P and Le Coq, Y and Le Targat, R and Lodewyck, J and Lours, M and Rosenbuch, P and Rovera, G. D. and Bize, S} } @Article { , title = {XPS depth profiling of an ultrathin bioorganic film with an argon gas cluster ion beam}, journal = {Biointerphases}, year = {2016}, month = {6}, day = {1}, volume = {11}, number = {2}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, pages = {029603}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {American Vacuum Society}, address = {New Yokk}, language = {30}, ISSN = {1934-8630}, DOI = {10.1116/1.4948341}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-6-1}, author = {Dietrich, P.M and Nietzold, C and Weise,, M and Unger,, W.E.S and Alnabulsi,, S and Moulder, J} } @Article { SterrAKGHVL2016, title = {A transportable optical lattice clock}, journal = {Journal of Physics: Conference Series}, year = {2016}, month = {6}, volume = {723}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {012020}, keywords = {time and frequency metrology, transportable optical lattice clock, chronometric geodesy}, web_url = {http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012020/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {1742-6588, 1742-6596}, DOI = {10.1088/1742-6596/723/1/012020}, stag_bib_extends_levelofaccess = {NA}, author = {Sterr, U. and Al-Masoudi, A. and Koller, S. and Grotti, J. and H{\"a}fner, S. and Vogt, S. and Lisdat, C.} } @Proceedings { , title = {Impact of Microwave Measurement Uncertainty on the Nonlinear Embedding Procedure}, journal = {N/A}, year = {2016}, month = {5}, day = {27}, volume = {N/A}, number = {N/A}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Microwave measurements uncertainty, microwave transistors, nonlinear embedding, power amplifiers, vector-calibrated nonlinear measurements.}, web_url = {http://www.arftg.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {San Francisco, CA, USA}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {N/A}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30}, stag_bib_extends_persistent_identifier = {IEEE Catalog Number: CFP16ARF-ART}, author = {Bosi, G. and Raffo, A. and Avolio, G. and Schreurs, D. and Humphreys, D. A.} } @Proceedings { , title = {Investigating correlations in frequency-domain S-parameter measurements}, journal = {Proceedings 87th ARFTG Microwave Measurement Conference}, year = {2016}, month = {5}, day = {27}, volume = {n.a.}, number = {n.a.}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {S-parameters, uncertainty of measurement, uncertainty matrices, measurement covariance matrix, correlation}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Danvers}, event_place = {San Francisco}, event_name = {87th ARFTG Microwave Measurement Conference}, event_date = {27-05-2016}, language = {30}, ISBN = {978-1-5090-1308-1}, ISSN = {n.a.}, DOI = {10.1109/ARFTG.2016.7501951}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-1-1}, author = {Arz, U.} } @Article { , title = {Realization of a timescale with an accurate optical lattice clock}, journal = {Optica}, year = {2016}, month = {5}, day = {25}, volume = {3}, number = {6}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {563-569}, keywords = {optical clocks, SI units, caesium fountain clocks, metrology, atom optics, spectroscopy, high resolution}, web_url = {http://arxiv.org/abs/1511.03888}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Optical Society of America}, address = {Washington DC}, language = {30}, ISSN = {n/a}, DOI = {10.1364/OPTICA.3.000563}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-5-25}, author = {Grebing, C and Al-Masoudi, A and D{\"o}rscher, S and H{\"a}fner, S and Gerginov, V and Weyers, S and Lipphardt, B and Sterr, U and Lisdat, C} } @Article { , title = {Aperture alignment in autocollimator-based deflectometric profilometers}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2016}, month = {5}, day = {24}, volume = {87}, number = {051906 (2016)}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-9}, keywords = {Apertures, Calibration Charge coupled devices, Ray tracing, Optical aberrations}, web_url = {http://aip.scitation.org/doi/10.1063/1.4950734}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Institute of Physics}, address = {Melville, NY 11747-4300 USA}, language = {30}, ISSN = {Print: 0034-6748, Online: 1089-7623}, DOI = {10.1063/1.4950734}, extern = {1}, stag_bib_extends_fe_group = {55,59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Geckeler, R. D. and Artemiev, N. A. and Barber, S. K. and Just, A and Lacey, I. and Kranz, O and Smith, B. V. and Yaschckuk, V. V.} } @Article { , title = {Linear chirped slope profile for spatial calibration in slope measuring deflectometry}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2016}, month = {5}, day = {24}, volume = {87}, number = {051907 (2016)}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-9}, keywords = {Spatial resolution, Modulation transfer functions, Topography, Calibration, Spatial dimensions}, web_url = {http://aip.scitation.org/doi/10.1063/1.4950737}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Institute of Physics}, address = {Melville, NY 11747-4300 USA}, language = {30}, ISSN = {ISSN: Print: 0034-6748, Online: 1089-7623}, DOI = {10.1063/1.4950737}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Siewert, F and Zeschke, T and Arnold, T and Paetzelt, H and Yashchuk, VV} } @Article { , title = {High precision tilt stage as a key element to a universal test mirror for characterization and calibration of slope measuring instruments}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2016}, month = {5}, day = {20}, volume = {87}, number = {051904 (2016)}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-12}, keywords = {Calibration, Mirrors, X-ray optics, Apertures, Comparators}, web_url = {http://aip.scitation.org/doi/10.1063/1.4950729}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Institute of Physics}, address = {Melville, NY 11747-4300 USA}, language = {30}, ISSN = {Print: 0034-6748, Online: 1089-7623}, DOI = {10.1063/1.4950729}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yashchuk, VV and Artemiev, NA and Centers, G and Chaubard, A and Geckeler, RD and Lacey, I and Marth, H and McKinney, WR and Noll, T and Siewert, F and Winter, M and Zeschke, T} } @Article { , title = {Application of advanced shearing techniques to the calibration of autocollimators with small angle generators and investigation of error source}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS}, year = {2016}, month = {5}, day = {20}, volume = {87}, number = {051903 (2016)}, number2 = {SIB58: Angles: Angle metrology}, pages = {1-14}, keywords = {Calibration, Error analysis, Data sets, Data analysis, Time measurement}, web_url = {http://aip.scitation.org/doi/10.1063/1.4950720}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Institute of Physics}, address = {Melville, NY 11747-4300 USA}, language = {30}, ISSN = {Print: 0034-6748, Online: 1089-7623}, DOI = {10.1063/1.4950720}, extern = {1}, stag_bib_extends_fe_group = {59,80}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Yandayan, T and Geckeler, RD and Aksulu, M and Akgoz, SA and Ozgur, B} } @Proceedings { , title = {Characterization of high-frequency interconnects: Comparison between time- and frequency-domain methods}, journal = {2016 IEEE 20th Workshop on Signal and Power Integrity (SPI) Conference Proceedings}, year = {2016}, month = {5}, day = {12}, volume = {N/A}, number = {N/A}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, pages = {1-4}, keywords = {coplanar waveguides, frequency-domain analysis, microwave measurement, time-domain analysis}, web_url = {http://dx.doi.org/10.1109/SaPIW.2016.7496271}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, event_place = {Torino, Italy}, event_name = {2016 IEEE 20th Workshop on Signal and Power Integrity}, event_date = {08-05-2016 to 11-05-2016}, language = {30}, ISBN = {978-1-5090-0349-5}, DOI = {10.7795/EMPIR.14IND02.CA.20190403D}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bieler, M. and Arz, U.} } @Proceedings { , title = {Impact of measurement uncertainty on modelling}, journal = {Proc. of 21st International Conference on Microwave, Radar and Wireless Communications (MIKON)}, year = {2016}, month = {5}, day = {9}, volume = {n/a}, number = {n/a}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {1-4}, keywords = {Calibration, Measurement uncertainty, Microwave measurement, nonlinear modelling}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7492056\&isnumber=7491934}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, address = {Piscataway}, event_place = {Krakow, Poland}, event_name = {21st International Conference on Microwave, Radar and Wireless Communications (MIKON)}, event_date = {9-11 May 2016}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, DOI = {10.1109/MIKON.2016.7492056}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schreurs, D. and Liu, S. and Avolio, G. and Ocket, I.} } @Article { ZappaTVLLAPGBDG2016, subid = {232}, title = {Experiment Investigating the Connection between Weak Values and Contextuality}, journal = {Physical Review Letters}, year = {2016}, month = {5}, volume = {116}, number = {18}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {180401}, keywords = {Quantum Foundations, Quantum Nonlocality, Weak Values, Weak Measurements}, misc2 = {EMPIR 2014: Industry}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {0031-9007, 1079-7114}, DOI = {10.1103/PhysRevLett.116.180401}, stag_bib_extends_levelofaccess = {NA}, author = {Piacentini, F. and Avella, A. and Levi, M. P. and Lussana, R. and Villa, F. and Tosi, A. and Zappa, F. and Gramegna, M. and Brida, G. and Degiovanni, I. P. and Genovese, M.} } @Article { , title = {Towards joint reconstruction of noise and losses in quantum channels}, journal = {Quantum Measurements and Quantum Metrology}, year = {2016}, month = {4}, day = {21}, volume = {3}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {27–31}, keywords = {Quantum Communication, Quantum Metrology, Calibration}, web_url = {https://www.degruyter.com/view/j/qmetro}, misc2 = {EMPIR 2014: Industry}, publisher = {DE GRUYTER OPEN}, address = {Warsaw (Poland)}, language = {30}, ISSN = {2299-114X}, DOI = {10.1515/qmetro-2016-0005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.degruyter.com/downloadpdf/j/qmetro.2016.3.issue-1/qmetro-2016-0005/qmetro-2016-0005.pdf}, author = {Piacentini, F. and Avella, A. and Traina, P. and Lolli, L. and Taralli, E. and Monticone, E. and Rajteri, M. and Fukuda, D. and Degiovanni, I. P. and Brida, G.} } @Article { , title = {A Planar Near Field Setup for Millimeter-Wave System-Embedded Antenna Testing}, journal = {IEEE Antennas and Wireless Propagation Letters}, year = {2016}, month = {4}, day = {21}, volume = {PP (pre pubblicaiton)}, number = {99}, number2 = {IND51: MORSE: Metrology for optical and RF communication systems}, pages = {1-4}, keywords = {Embedded antenna, on-module antenna, near field measurement.}, web_url = {http://ieeexplore.ieee.org/document/7457638/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway}, language = {30}, ISSN = {Print ISSN: 1536-1225 Online ISSN: 1548-5757}, DOI = {10.1109/LAWP.2016.2557239}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, stag_bib_extends_persistent_identifier = {http://ieeexplore.ieee.org/document/7457638/}, author = {Alonso del Pino, M. and Di Rosa, M. and Simeoni, M. and Spella, M. and de Martino, C. and Spirito, M.} } @Article { , title = {Absolute calibration of an EMCCD camera by quantum correlation, linking photon counting to the analog regime}, journal = {Optics Letters}, year = {2016}, month = {4}, day = {14}, volume = {41}, number = {8}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {1841-1844}, keywords = {CCD, charge-coupled device; Quantum detectors; Calibration.}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-8-1841}, misc2 = {EMPIR 2014: Industry}, publisher = {OSA Publishing}, address = {Washington, D.C. 20036-1012 USA}, language = {30}, ISSN = {0146-9592/16/081841-04}, DOI = {10.1364/OL.41.001841}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-14}, author = {Avella, A. and Ruo-Berchera, I. and Degiovanni, I. P. and Brida, G. and Genovese, M.} } @Proceedings { , title = {JRP SIB60 “Metrology for Long Distance Surveying”-a concise survey on major project results}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {March 30-April 1, 2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Pollinger, F. and Bauch, A. and Leute, J. and Meiners-Hagen, K. and Mildner, J. and Guillory, J. and Wallerand, J.-P. and Jokela, J. and Kallio, U. and Koivula, H. and Lahtinen, S. and Poutanen, M. and Astrua, M. and Francese, C. and Zucco, M. and Eusebio, L. and Marques, F. and Pires, C. and Saraiva, F. and Pelligrino, O. and Tomberg, T. and Hieta, T. and Fordell, T. and Merimaa, M. and Kupko, V. and Neyezhmakov, P. and Bergstrand, S. and van den Berg, S.A. and Kersten, T. and Krawinkel, T.} } @Proceedings { , title = {Towards Kilometric Distance Measurements with Air Refractive Index Compensation}, journal = {Proceedings of the third Joint International Symposium on Deformation Monitoring}, year = {2016}, month = {4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {Submission 27}, keywords = {Kilometric distance, optical telemetry, two-wavelength telemetry, absolute distance meter.}, web_url = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {FIG}, event_place = {Vienna, Austria}, event_name = {Joint International Symposium on Deformation Monitoring}, event_date = {30-03-2016 to 01-04-2016}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf}, author = {Guillory, J. and Wallerand, J.-P. and Truong, D. and Šm{\'i}d, R. and Alexandre, C.} } @Article { , title = {Thermodynamic temperature assignment to the point of inflection of the melting curve of high-temperature fixed points}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150044}, keywords = {high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150044}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0044}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Wooliams, E.R and Anhalt, K and Ballico, M and Bloembergen, P and Bourson, F and Briaudeau, S and Campos, J and Cox, M.G and del Campo, D and Dong, W and Dury, M.R and Gavrilov, V and Grigoryeva, I and Hernanz, M.L and Jahan, F and Khlevnoy, B and Khromchenko, V and Lowe, D.H and Lu, X and Machin, G and Mantilla, J.M and Martin, M.J and McEvoy, H.C and Rougie, B and Saldi, M and Salim, S.G.R and Sasajima, N and Taubert, D.R and Todd, A.D.W and Van den Bossche, R} } @Article { , title = {Thermodynamic temperature by primary radiometry}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {3}, day = {28}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150041}, keywords = {primary thermometry, radiation thermometry, radiometry}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150041}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0041}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Anhalt, K and Machin, G} } @Article { , title = {Coherent cancellation of photothermal noise in GaAs/Al0.92Ga0.08As Bragg mirrors}, journal = {Metrologia}, year = {2016}, month = {3}, day = {9}, volume = {53}, number = {2}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {860}, keywords = {photothermal noise, AlGaAs, laser frequency stabilization, Fabry-P{\'e}rot cavities, gravitational waves}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/2/860/meta}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/53/2/860}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Chalermsongsak, T and Hall, E D and Cole, G D and Follman, D and Seifert, F and Arai, K and Gustafson, E K and Smith, J R and Aspelmeyer, M and Adhikari, R X} } @Article { , title = {Standardisation of 90Y and determination of calibration factors for 90Y Microspheres (resin) for the NPL secondary ionisation chamber and a Capintec CRC-25R}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, day = {1}, volume = {109}, number = {Special Issue: ICRM 2015}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {226-230}, keywords = {90Y resin microspheres; Ionisation chambers; calibration factors; Capintec CRC-25R}, web_url = {http://ac.els-cdn.com/S0969804315303134/1-s2.0-S0969804315303134-main.pdf?_tid=5a48db6c-1dc9-11e6-b9a5-00000aab0f6b\&acdnat=1463666312_e589a503e7b566030018889dc6beaabd}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier}, address = {London}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.11.074}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ferreira, KM and Fenwick, AJ and Arinc, A and Johansson, LC} } @Article { AltzitzoglouSM2016, title = {Evaluation of the 2014 EC measurement comparison on 137Cs in air filters}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number2 = {ENV57: MetroERM: Metrology for radiological early warning networks in Europe}, pages = {36-40}, keywords = {Interlaboratory comparison Environmental radioactivity Spiked air filter 137Cs in air}, misc2 = {EMRP A169: Call 2013 Environment II}, publisher = {Elsevier BV}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.12.008}, stag_bib_extends_levelofaccess = {NA}, author = {Altzitzoglou, T. and Sobiech-Matura, K. and M{\'a}t{\'e}, B.} } @Article { , title = {Activity standardization, photon emission probabilities and half-life measurements of 177Lu}, journal = {Applied Radiation and Isotopes}, year = {2016}, month = {3}, volume = {109}, number = {March 2016}, number2 = {HLT11: MetroMRT: Metrology for molecular radiotherapy}, pages = {160-163}, keywords = {Radionuclide 177Lu, Activity Standardization, Photon Emission probability, Half-life}, web_url = {http://www.sciencedirect.com/science/article/pii/S0969804315302906}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier}, address = {Oxford}, language = {30}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2015.11.059}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Dryak, P. and Sochorova, J. and Solc, J. and Auerbach, P.} } @Article { , title = {Dissemination of thermodynamic temperature above the freezing point of silver}, journal = {Philosophical Transactions of the Royal Society A}, year = {2016}, month = {2}, day = {22}, volume = {374}, number = {2064}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {20150043}, keywords = {high-temperature fixed points, thermodynamic temperature, filter radiometer, radiation thermometer}, web_url = {http://rsta.royalsocietypublishing.org/content/374/2064/20150043}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Royal Society}, address = {London}, language = {30}, DOI = {10.1098/rsta.2015.0043}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sadli, M and Machin, G and Anhalt, K and Bourson, F and Biraudeau, S and del Campo, D and Diril, A and Kozlova, O and Lowe, D.H and Mantilla Amor, J.M and Martin, M.J and McEvoy, H.C and Ojanen-Saloranta, M and Pehlivan, {\"O} and Rougi{\'e}, B and Salim, S.G.R} } @Article { PoletaeffBPOKZA2016, title = {Improvement of LISN Measurement Accuracy Based on Calculable Adapters}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2016}, month = {2}, volume = {65}, number = {2}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {365-377}, keywords = {Improvement of LISN Measurement Accuracy Based on Calculable Adapters}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, address = {445 Hoes Lane, Piscataway, NJ 08855-1331, USA}, language = {30}, ISSN = {0018-9456, 1557-9662}, DOI = {10.1109/TIM.2015.2479107}, stag_bib_extends_levelofaccess = {NA}, author = {Poletaeff, Andr{\'e} and B{\'e}li{\`e}res, Denis and Pinter, Borut and Ouameur, Mohamed and Kokalj, Miha and Ziade, Francois and Allal, Djamel} } @Article { AstefanoaeiDQPPLG2016, title = {A graphite calorimeter for absolute measurements of absorbed dose to water: application in medium-energy x-ray filtered beams}, journal = {Physics in Medicine and Biology}, year = {2016}, month = {2}, volume = {61}, number = {4}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {1738-1764}, keywords = {graphite calorimetry, calorimetry, medium-energy x-rays, reference dosimetry, primary standard, x-ray dosimetry}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/61/4/1738}, stag_bib_extends_levelofaccess = {NA}, author = {Astefanoaei, I and D’Arienzo, M and Quini, M and Pimpinella, M and Pinto, M and Loreti, S and Guerra, A S} } @Article { , title = {A folded‑sandwich polarization‑entangled two‑color photon pair source with large tuning capability for applications in hybrid quantum systems}, journal = {Applied Physics B}, year = {2016}, month = {1}, day = {30}, volume = {122}, number = {February 2016}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {33}, keywords = {Entangled Photons Source, Quantum Hybrid Systems}, web_url = {https://link.springer.com/article/10.1007/s00340-015-6275-x}, web_url2 = {http://link.springer.com/journal/340}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer-Verlag}, address = {Berlin Heidelberg}, language = {30}, ISSN = {1432-0649}, DOI = {10.1007/s00340-015-6275-x}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Dietz, O. and M{\"u}ller, C. and Krei{\ss}l, T. and Herzog, U. and Kroh, T. and Ahlrichs, A. and Benson, O.} } @Article { SawalNPGZRBTGSGACFEERBP2016, title = {An interlaboratory comparison on whole water samples}, journal = {Accreditation and Quality Assurance}, year = {2016}, month = {1}, day = {29}, volume = {21}, number = {2}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {121-129}, keywords = {Water Framework Directive, Interlaboratory comparison, Whole water sample, Suspended particulate matter, Polycyclic aromatic hydrocarbons, Polybrominated diphenyl ethers, Tributlyltin}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Springer Nature}, language = {30}, ISSN = {0949-1775, 1432-0517}, DOI = {10.1007/s00769-015-1190-8}, stag_bib_extends_levelofaccess = {NA}, author = {Sawal, G. and Nousiainen, M. and Pr{\"o}frock, D. and Gago, A.G. and Zuliani, T. and Rodr{\'i}guez-Cea, A. and Binici, B. and Tun\c{c}, M. and Gokcen, T. and Swart, C. and Gantois, F. and Alasonati, E. and Cabillic, J. and Fettig, I. and Emteborg, H. and Elordui-Zapatarietxe, S. and Richter, J. and Buzoianu, M. and Philipp, R.} } @Article { OzgurAHYaCCY2016, title = {Application of the differential Fabry–Perot interferometer in angle metrology}, journal = {Measurement Science and Technology}, year = {2016}, month = {1}, day = {20}, volume = {27}, number = {3}, number2 = {SIB58: Angles: Angle metrology}, pages = {035201}, keywords = {Angle metrology, Differential Fabry–Perot interferometry, small angle generators, autocollimators, Synchrotron and X-FEL optics}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/27/3/035201}, stag_bib_extends_levelofaccess = {NA}, author = {{\"O}zg{\"u}r, B. and Akg{\"o}z, A. and Hamid, R. and Yandayan, T. and Şahin, E. and \c{C}elik, M. and \c{C}etintaş, M. and Yandyan, T.} } @Proceedings { MonteBKALBGRRKMAG2016, title = {Characterisation of artificial defects in CFRP and GFRP sheets designed for energy applications using active thermography}, journal = {Proceedings of the 2016 International Conference on Quantitative InfraRed Thermography}, year = {2016}, month = {1}, day = {16}, number2 = {ENG57: VITCEA: Validated inspection techniques for composites in energy applications}, keywords = {Characterisation artificial defects CFRP and GFRP active thermography}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {QIRT Council}, address = {1065 ave. de la Medecine Quebec City Quebec G1V 0A6 Canada}, event_place = {Gdansk}, event_name = {QIRT 16}, event_date = {04-07-2016 to 08-07-2016}, language = {30}, DOI = {10.21611/qirt.2016.076}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Blahut, A. and Knazovicka, L. and Aktas, A. and Lodeiro, M. and Baker, G. and Gower, M. and Rehmer, B. and R{\"o}llig, M. and Krankenhagen, R. and Maierhofer, C. and Adibekyan, A. and Gutschwager, B.} } @Article { vanderVeenBA2016, title = {Suitability of different containers for the sampling and storage of biogas and biomethane for the determination of the trace-level impurities – A review}, journal = {Analytica Chimica Acta}, year = {2016}, month = {1}, volume = {902}, number2 = {ENG54: Biogas: Metrology for biogas}, pages = {22-32}, keywords = {Sampling; Containers; Suitability; Biogas; Biomethane; Impurities; VOCs; Siloxanes}, tags = {EnG}, web_url = {https://www.ncbi.nlm.nih.gov/pubmed/26703250}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Elsevier BV}, address = {New York}, language = {30}, ISSN = {0003-2670}, DOI = {10.1016/j.aca.2015.10.039}, stag_bib_extends_levelofaccess = {NA}, author = {van der Veen, A.M.H. and Brown, A.S. and Arrhenius, K.} } @Techreport { TerauchiKSBWWADGAAHUWSJKKFSBSS2016, subid = {415}, title = {Final report of CCQM-K129 'Measurement of Mole Fractions of Cu, In, Ga and Se in Cu(In,Ga)Se2 Films}, journal = {Metrologia}, year = {2016}, month = {1}, volume = {53}, number = {1A}, number2 = {14SIP05: TF-STANDARD: Developing a Standard for Valid Methodology for the Characterisation of Functional Alloy Thin Films}, pages = {08011-08011}, keywords = {CIGS, Cu(In,Ga)Se2, mole fractions, key comparison CCQM-K129}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/53/1A/08011\&\#10;https://www.bipm.org/utils/common/pdf/final_reports/QM/K129/CCQM-K129.pdf}, misc2 = {EMPIR 2014: Support for Impact}, publisher = {IOP Publishing}, language = {30}, ISSN = {0026-1394, 1681-7575}, DOI = {10.1088/0026-1394/53/1A/08011}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, A.S. and Kim, K.J. and Jang, J.S. and Suh, J.K. and Wirth, T. and Unger, W. and Hodoroaba, V.D. and Araujo, J.R. and Archanjo, B.S. and Galhardo, C.E. and Damasceno, J. and Achete, C.A. and Wang, H. and Wang, M. and Bennett, J. and Simon, D. and Kurokawa, A. and Terauchi, S. and Fujimoto, T. and Streeck, C. and Beckhoff, B. and Spencer, S. and Shard, A.} } @Article { , title = {Quantum and Classical Characterization of Single/Few Photon Detectors}, journal = {Quantum Matter}, year = {2016}, volume = {4}, number = {3}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {1-13}, keywords = {Quantum Tomography, Quantum Information, Single Photon Detectors, POVM}, web_url = {http://www.aspbs.com/qm.html}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {2164-7615}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Mingolla, M. G. and Piacentini, F. and Avella, A. and Gramegna, M. and Lolli, L. and Meda, A. and Ruo Berchera, I. and Taralli, E. and Traina, P. and Rajteri, M. and Brida, G. and Degiovanni, I. P. and Genovese, M.} } @Article { , title = {A comparison of irradiance responsivity and thermodynamic temperature measurement between PTB and NIM}, journal = {AIP Conference Proceedings}, year = {2016}, volume = {1552}, number = {728}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {728-733}, keywords = {Comparison; Filter radiometer; Irradiance responsivity; Thermodynamic temperature measurement}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821404}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Scitation}, address = {Melville}, language = {30}, ISSN = {0094-243X}, DOI = {10.1063/1.4821404}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lu, X and Anhalt, K and Taubert, R D and Yuan, Z} } @Article { , title = {Modelling of interband transitions in GaAs tunnel diode}, journal = {Semiconductor Science and Technology}, year = {2016}, volume = {31}, number = {06LT01}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {1-5}, keywords = {tunnel junction, multi-junction solar cells, band-to-band tunneling, Flietner’s relation}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IOP Publishing}, address = {UK}, language = {30}, DOI = {10.1088/0268-1242/31/6/06LT01}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Louarn, KL and Fontain, CF and Arnoult, AA and Olivi{\'e}, FO and Lacoste, GL and Piquemal, FP and Bounouh, AB and Almuneau, GA} } @Article { , title = {Decomposition of Electromagnetic Interferences in the Time-Domain}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2016}, volume = {58}, number = {2}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {385-392}, keywords = {Digital signal processing, electromagnetic compatibility, electromagnetic interference, electromagnetic measurements, time-domain analysis.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7390236\&isnumber=7429977}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9375}, DOI = {10.1109/TEMC.2016.2518302}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {15837187}, author = {Azp{\'u}rua, Marco A. and Pous, Marc and Silva, Ferran} } @Article { , title = {Annihilation of structural defects in chalcogenide absorber films for high-efficiency solar cells}, journal = {Energy \& Environmental Science}, year = {2016}, volume = {9}, number = {5}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1818-1827}, keywords = {Thin films, solar cells, Cu(In,Ga)Se2, XRD, XRF, in-situ, planar defects, TEM}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {The Royal Society of Chemistry}, address = {London}, language = {30}, ISSN = {1754-5692}, DOI = {10.1039/c6ee00402d}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-18}, author = {Mainz, R. and Simsek Sanli, E. and Stange, H. and Azulay, D. and Brunken, S. and Greiner, D. and Hajaj, S. and Heinemann, M. D. and Kaufmann, C. A. and Klaus, M. and Ramasse, Q. M. and Rodriguez-Alvarez, H. and Weber, A. and Balberg, I. and Millo, O. and van Aken, P. A. and Abou-Ras, D.} } @Article { , title = {Time-domain Measurement Technique to Analyze Cyclic Short-Time Interference in Power Supply Networks}, journal = {Proceedings of the 2016 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Shenzhen, China}, year = {2016}, volume = {N.A.}, number = {N.A.}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {279-282}, keywords = {electromagnetic compatibility; time-domain measurement; spectrogram; power mains noise and interference}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Piscataway, NJ}, language = {30}, ISSN = {Unknown}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Setiawan, I. and Keyer, C.H. and Azpurua, M. and Silva, F. and Leferink, F.B.J.} } @Article { , title = {Repeatability and reproducibility of specular gloss meters in theory and practice}, journal = {Journal of Coatings Technology and Research}, year = {2016}, volume = {13}, number = {6}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {941-951}, keywords = {Specular gloss, Gloss meter, Interinstrument agreement}, web_url = {http://link.springer.com/article/10.1007/s11998-016-9813-5}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {American Coatings Association}, address = {Washington, DC20001}, language = {30}, ISBN = {1935-3804}, ISSN = {1547-0091}, DOI = {10.1007/s11998-016-9813-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-12-1}, author = {Leloup, F. B. and Audenaert, J. and Obein, G. and Ged, G. and Hanselaer, P.} } @Proceedings { , title = {New Approach for Measuring Moisture in Solids Using Radio Frequency and Microwave}, journal = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances}, year = {2016}, volume = {11th}, number = {2016}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {297}, keywords = {dielectric permittivity, capacitive cell, coaxial cell, moisture measurement}, web_url = {http://www.isema2016.org/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Edifir-Edizioni}, address = {Firenze}, event_place = {Firenze (Italy)}, event_name = {11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances}, event_date = {23-05-2016 to 27-05-2016}, language = {30}, ISBN = {978-88-7970-800-5}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ben Ayoub, MW and Georgin, E and Rochas, J F and Hubert, S and Achard, P and Neves, L and Sabouroux, P} } @Article { AlacaOLHWT2016, subid = {922}, title = {Determination of the Elastic Behavior of Silicon Nanowires within a Scanning Electron Microscope}, journal = {Journal of Nanomaterials}, year = {2016}, volume = {2016}, number2 = {14IND03: Strength-ABLE: Metrology for length-scale engineering of materials}, pages = {1-6}, keywords = {Elastic Behavior of Silicon Nanowires}, web_url = {https://www.hindawi.com/journals/jnm/2016/4905838/}, misc2 = {EMPIR 2014: Industry}, publisher = {Hindawi Limited}, language = {30}, ISSN = {1687-4110, 1687-4129}, DOI = {10.1155/2016/4905838}, stag_bib_extends_levelofaccess = {NA}, author = {Wollschl{\"a}ger, N. and Tasdemir, Z. and H{\"a}usler, I. and Leblebici, Y. and {\"O}sterle, W. and Alaca, B.E.} } @Proceedings { LiDHRVAR2016, subid = {80}, title = {Development of a Reference Wafer for On-wafer Testing of Extreme Impedance Devices}, journal = {IEEE XPlore}, year = {2016}, number2 = {14IND02: PlanarCal: Microwave measurements for planar circuits and components}, keywords = {Standards, Calibration, Impedance, Nanoscale devices, Impedance measurement, Probes, Transmission line measurements, extreme impedance measurement, Calibration, on-wafer measurement, nano-scale, co-planar waveguide, RF nanotechnology}, web_url = {http://epubs.surrey.ac.uk/813783/1/Votsi_88th_ARFTG_Paper_Summary\%20\%28002\%29.pdf}, misc2 = {EMPIR 2014: Industry}, publisher = {IEEE}, address = {USA \& Canada}, event_place = {Austin, TX, USA}, event_name = {Microwave Measurement Conference (ARFTG)}, event_date = {08-12-2016 to 09-12-2016}, language = {30}, DOI = {10.1109/ARFTG.2016.7839719}, stag_bib_extends_levelofaccess = {NA}, author = {Votsi, H. and Roch-Jeune, I. and Haddadi, K. and Li, C. and Dambrine, G. and Aaen, P.H. and Ridler, N.} } @Article { EkinsDaukesA2016_2, title = {SPICE Modelling of Photoluminescence and Electroluminescence Based Current-Voltage Curves of Solar Cells for Concentration Applications}, journal = {IEEE Journal of Photovoltaics}, year = {2016}, volume = {6}, number = {4}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, pages = {1004-1011}, keywords = {Semiconductors, multi-junction solar cells, photoluminescence, SPICE}, web_url = {http://www.riverpublishers.com/journal_read_html_article.php?j=JGE/5/4/3}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Institute of Electrical and Electronics Engineers (IEEE)}, language = {30}, ISSN = {1904-4720}, DOI = {10.13052/jge1904-4720.5343}, stag_bib_extends_levelofaccess = {NA}, author = {Ekins-Daukes, N. and Alonso-Alvarez, D.} } @Article { , title = {A multi-thermogram-based Bayesian model for the determination of the thermal diffusivity of a material}, journal = {Metrologia}, year = {2015}, month = {12}, day = {16}, volume = {53}, number = {1}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {1-9}, keywords = {inverse problem, Bayesian framework, Metropolis–Hastings, measurement uncertainty, prior distributions, thermal diffusivity}, tags = {MAT}, web_url = {-}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {BIPM}, address = {S{\`e}vres}, language = {30}, ISSN = {-}, DOI = {10.1088/0026-1394/53/1/S1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Allard, A. and Fischer, N. and Ebrard, G. and Hay, B. and Harris, P. and Wright, L. and Rochals, D. and Mattout, J.} } @Article { , title = {Self-supporting graphene films and their applications}, journal = {IET Circuits, Devices \& Systems}, year = {2015}, month = {12}, day = {3}, volume = {9}, number = {6}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {420 - 427}, keywords = {thermal properties, atomic force microscopy, chemical vapour deposition, copper, foils, graphene, mechanical properties, micromechanical resonators, monolayers, scanning electron microscopy}, web_url = {http://ieeexplore.ieee.org/document/7339736/}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {New York CIty}, language = {30}, ISSN = {1751-858X}, DOI = {10.1049/iet-cds.2015.0149}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-3}, author = {Goniszewski, S and Gallop, J and Adabi, M and Gajewski, K and Shaforost, E and Klein, N and Sierakowski, A and Chen, J and Gotszalk, T and Chen, Y and Hao, L} } @Article { SterrHDAL2015, title = {Noise and instability of an optical lattice clock}, journal = {Physical Review A}, year = {2015}, month = {12}, volume = {92}, number = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {063814}, keywords = {time and frequency metrology, optical lattice clock, ultra-stable laser, stability}, web_url = {https://journals.aps.org/pra/abstract/10.1103/PhysRevA.92.063814}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society (APS)}, language = {30}, ISSN = {1050-2947, 1094-1622}, DOI = {10.1103/PhysRevA.92.063814}, stag_bib_extends_levelofaccess = {NA}, author = {Sterr, U. and H{\"a}fner, S. and D{\"o}rscher, S. and Al-Masoudi, A. and Lisdat, C.} } @Article { , title = {On the Statistical Properties of the Peak Detection for Time-Domain EMI Measurements}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2015}, month = {12}, volume = {57}, number = {6}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1374-1381}, keywords = {Electromagnetic compatibility, electromagnetic interference (EMI), electromagnetic measurements, statistical signal processing, time-domain analysis.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7169567\&isnumber=7353235}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9375}, DOI = {10.1109/TEMC.2015.2456983}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {15677166}, author = {Azp{\'u}rua, Marco A. and Pous, Marc and Silva, Ferran} } @Article { , title = {Measurement and Evaluation Techniques to Estimate the Degradation Produced by the Radiated Transients Interference to the GSM System}, journal = {IEEE Transactions on Electromagnetic Compatibility}, year = {2015}, month = {12}, volume = {57}, number = {6}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1382-1390}, keywords = {Amplitude probability distribution (APD), electromagnetic transients interferences, GSM, impulsive noise, timedomain measurements.}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7247681\&isnumber=7353235}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {New York}, language = {30}, ISSN = {0018-9375}, DOI = {10.1109/TEMC.2015.2472983}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {15677194}, author = {Pous, Marc and Azp{\'u}rua, Marco A. and Silva, Ferran} } @Article { KralikBAVSS2015, title = {Measurement of secondary neutrons generated during proton therapy}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {12}, volume = {172}, number = {4}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {341-345}, keywords = {Secondary neutrons, proton therapy, Bonner Sphere Spectrometer}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv504}, stag_bib_extends_levelofaccess = {NA}, author = {Kr{\'a}l{\'i}k, M. and B{\'a}rtov{\'a}, H. and Andrl{\'i}k, M. and Vykydal, Z. and Solc, J. and Solc, J.} } @Article { BallesterNebotAFRRG2015, title = {Determination of ultratrace levels of tributyltin in waters by isotope dilution and gas chromatography coupled to tandem mass spectrometry}, journal = {Journal of Chromatography A}, year = {2015}, month = {12}, volume = {1425}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {265-272}, keywords = {EU Water Framework Directive, GC–MS/MS, Isotope Dilution Mass Spectrometry, Tributyltin}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0021-9673}, DOI = {10.1016/j.chroma.2015.11.031}, stag_bib_extends_levelofaccess = {NA}, author = {Ballester Nebot, S. and Aranda Mares, J.L. and Font Cardona, N. and Rodr{\'i}guez-Gonz{\'a}lez, P. and Rodr{\'i}guez-Cea, A. and Garc{\'i}a Alonso, J.I.} } @Article { SmerziSHAEPLKLPK2015, title = {Satisfying the Einstein–Podolsky–Rosen criterion with massive particles}, journal = {Nature Communications}, year = {2015}, month = {11}, day = {27}, volume = {6}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {8984}, keywords = {quantum mechanics, entanglement, heisenberg limit}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Springer Nature}, address = {New York}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms9984}, stag_bib_extends_levelofaccess = {NA}, author = {Smerzi, A. and Santos, L. and Hammerer, K. and Arlt, J. and Ertmer, W. and Pezz{\`e}, L. and L{\"u}cke, B. and Kruse, I. and Lange, K. and Peise, J. and Klempt, C.} } @Article { , title = {A clock network for geodesy and fundamental science}, journal = {Nature Communication}, year = {2015}, month = {11}, day = {24}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, web_url = {arxiv.org/abs/1511.07735}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lisdat, C. and Grosche, G. and Quintin, N. and Shi, C. and Raupach, S.M.F. and Grebing, C. and Nicolodi, D. and Stefani, F. and Al-Masoudi, A. and D{\"o}rscher, S. and H{\"a}fner, S. and Robyr, J.-L. and Chiodo, N. and Bilicki, S. and Bookjans, E. and Koczwara, A. and Koke, S. and Kuhl, A. and Wiotte, F. and Meynadier, F. and Camisard, E. and Abgrall, M. and Lours, M. and Legero, T. and Schnatz, H. and Sterr, U. and Denker, H. and Chardonnet, C. and Le Coq, Y. and Santarelli, G.} } @Article { , title = {Thermoelectric properties of currently available Au/Pt thermocouples related to the valid reference function}, journal = {Int. J. Metrol. Qual. Eng.}, year = {2015}, month = {11}, day = {23}, volume = {6}, number = {3}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {303}, keywords = {Au/Pt thermocouple, reference function, temperature scale}, web_url = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Dr. A. CHARKI}, address = {EDP Sciences - France 17, Avenue du Hoggar Parc d'Activit{\'e} de Courtabœuf BP 112 91944 Les Ulis Cedex A France}, language = {30}, DOI = {10.1051/ijmqe/2015016}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html}, author = {Edler, F. and Arifovic, N. and Atance, G. and Dinu, C. and Elliott, C. J. and Izquierdo, C. G. and Hodzic, N. and Kalisz, S. and Pearce, J.V. and Simic, S. and Strnad, R. and Taubert, D.} } @Article { , title = {Local weighting of nanometric track structure properties in macroscopic voxel geometries for particle beam treatment planning}, journal = {Physics in Medicine and Biology}, year = {2015}, month = {11}, day = {12}, volume = {60}, number = {23}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {9145 –9156}, keywords = {Geant4-DNA, nanodosimetry, proton therapy}, web_url = {http://iopscience.iop.org/article/10.1088/0031-9155/60/23/9145}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol, UK}, language = {30}, ISSN = {0031-9155}, DOI = {10.1088/0031-9155/60/23/9145}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Alexander, F and Villagrasa, C and Rabus, H and Wilkens, J J} } @Proceedings { , title = {Uncertainty calculation in gravimetric microflow measurements}, year = {2015}, month = {11}, day = {4}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, keywords = {Microflow, uncertainty, drug delivery devices, calibration}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {St. Petersburg}, event_name = {AMCTM2014}, event_date = {September 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Batista, Elsa and Filipe, Eduarda and Almeida, Nelson and Godinho, Isabel} } @Techreport { , title = {Global Geodetic Observing System (GGOS) Requirements for Core Sites}, journal = {CDDIS: NASA's Archive of Space Geodesy Data}, year = {2015}, month = {11}, day = {1}, volume = {Revision 2}, number = {Draft 3.4}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {GNSS, SLR, DORIS, VLBI, global network}, web_url = {http://cddis.gsfc.nasa.gov/docs/2015/SiteRecDoc_Rev2_D3.4.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {NASA Goddard Space Flight Center}, address = {Greenbelt}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Appleby, G. and Behrend, D. and Bergstrand, S. and Donovan, H. and Emerson, C. and Esper, J. and Hase, H. and Long, J. and Ma, C. and McCormick, D. and Noll, C. and Pavlis, E. and Ferrage, P. and Pearlman, M. and Saunier, J. and Stowers, D. and Wetzel, S.} } @Article { , title = {Correlated Emission Lasing in Harmonic Oscillators Coupled via a Single Three-Level Artificial Atom}, journal = {PHYSICAL REVIEW LETTERS}, year = {2015}, month = {11}, volume = {115}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {223603}, keywords = {Lasing Artificial atom Decoherence Three-level atom Harmonic oscillator}, web_url = {http://journals.aps.org/prl/pdf/10.1103/PhysRevLett.115.223603}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {PHYSICAL REVIEW LETTERS}, language = {30}, DOI = {10.1103/PhysRevLett.115.223603}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Peng, Z. H. and Liu, Yu-xi and Peltonen, J. T. and Yamamoto, T. and Tsai, J.S. and Astafiev, O.V.} } @Article { OliveroGSGMEDBBAMTF2015, subid = {563}, title = {Electrical stimulation of non-classical photon emission from diamond color centers by means of sub-superficial graphitic electrodes}, journal = {Scientific Reports}, year = {2015}, month = {10}, day = {29}, volume = {5}, number = {1}, number2 = {14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication}, pages = {15901}, keywords = {Single Photon Sources, NV centers}, web_url = {https://www.nature.com/articles/srep15901}, misc2 = {EMPIR 2014: Industry}, publisher = {Springer Nature}, language = {30}, ISSN = {2045-2322}, DOI = {10.1038/srep15901}, stag_bib_extends_levelofaccess = {NA}, author = {Forneris, J. and Traina, P. and Monticone, D.G. and Amato, G. and Boarino, L. and Brida, G. and Degiovanni, I.P. and Enrico, E. and Moreva, E. and Grilj, V. and Skukan, N. and Jakšić, M. and Genovese, M. and Olivero, P.} } @Article { , title = {Stability limitations from optical detection in Ramsey-type vapour-cell atomic clocks}, journal = {Electronics Letters}, year = {2015}, month = {10}, day = {22}, volume = {51}, number = {22}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {1767 - 1769}, keywords = {atomic clocks, Ramsey scheme, pulsed interrogation, optical detection}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7308180\&filter\%3DAND\%28p_IS_Number\%3A7308095\%29\%26rowsPerPage\%3D75}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Institution of Engineering and Technology (IET)}, address = {Stevenage \& London, UK}, language = {30}, ISSN = {0013-5194}, DOI = {10.1049/el.2015.1902}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://ietdl.org/t/Uofr0b}, author = {Kang, S. and Gharavipour, M. and Affolderbach, C. and Mileti, G.} } @Article { , title = {Effect of Na presence during CuInSe2 growth on stacking fault annihilation and electronic properties}, journal = {Applied Physics Letters}, year = {2015}, month = {10}, day = {14}, volume = {107}, number = {15}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {152103}, keywords = {Stacking faults, Cu(In,Ga)Se2, thin films, solar cells, XRD, GIXRD, GDOES, grain growth, optical pump terahertz probe spectroscopy}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {AIP Publishing LLC}, address = {College Park}, language = {30}, ISSN = {0003-6951}, DOI = {10.1063/1.4933305}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Stange, H. and Brunken, S. and Hempel, H. and Rodriguez-Alvarez, H. and Sch{\"a}fer, N. and Greiner, D. and Scheu, A. and Lauche, J. and Kaufmann, C. A. and Unold, T. and Abou-Ras, D. and Mainz, R.} } @Article { , title = {The European project on high temperature measurement solutions in industry (HiTeMS) – A summary of achievements}, journal = {Measurement}, year = {2015}, month = {10}, day = {9}, volume = {78}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {168-179}, keywords = {High temperature measurement High temperature fixed points (HTFPs) Industrial process control Radiation thermometry Thermocouples Reference functions}, web_url = {http://www.sciencedirect.com/science/article/pii/S026322411500500X}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0263-2241}, DOI = {10.1016/j.measurement.2015.09.033}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Machiin, G and Anhalt, K and Battuello, M and Bourson, F and Dekker, P and Diril, A and Edler, F and Elliott, C.J. and Girard, F and Greenen, A and Knazovick{\'a}, L and Lowe, D and Pavlasek, P and Pearce, J.V. and Sadli, M and Strnad, R and Seifert, M and Vuelban, E.M.} } @Article { , title = {Thickness and Microdomain Orientation of Asymmetric PS‑b‑PMMA Block Copolymer Films Inside Periodic Gratings}, journal = {Applied Materials and Interfaces}, year = {2015}, month = {10}, day = {6}, volume = {7}, number = {42}, number2 = {SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology}, pages = {23615-23622}, keywords = {PS-b-PMMA, self-assembly, trench, thin film, rapid thermal annealing, graphoepitaxy}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {ACS Publications}, address = {Washington}, language = {30}, DOI = {10.1021/acsami.5b07127}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lupi, F. and Aprile, G. and Giammaria, T. and Seguini, G. and Zuccheri, G. and De Leo, N. and Boarino, L. and Perego, M.} } @Article { , title = {Ion induced fragmentation cross-sections of DNA constituents}, journal = {The European Physical Journal D}, year = {2015}, month = {10}, volume = {69}, number = {237}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {1-9}, keywords = {DNA, impact ionization, fragmentation, cross-sections}, web_url = {http://link.springer.com/article/10.1140\%2Fepjd\%2Fe2015-60204-7}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Berlin}, language = {30}, ISSN = {1434-6079 (print) ; 1434-6079 (online)}, DOI = {10.1140/epjd/e2015-60204-7}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Rudek, B. and Arndt, A. and Bennett, D. and Wang, M. and Rabus, H.} } @Proceedings { , title = {Experimental assessment of methods of dissemination of the thermodynamic temperature at the highest temperatures}, journal = {International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17}, number = {15001}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1-5}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15001/metrology_metr2015_15001.html}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {EDP Sciences}, address = {London/Parc d'Activit{\'e} de Courtabœuf}, event_place = {Paris}, event_name = {17th International Congress of Metrology}, event_date = {September 2015}, language = {30}, DOI = {10.1051/metrology/201515001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Sadli, M and Anhalt, K and Bourson, F and Briaudeau, S and del Campo, D and Diril, A and Lowe, D and Machin, G and Manuel Mantilla Amor, J and Martin, M.J and McEvoy, H and Ojanen, M and Pehlivan, O and Rougie, B and Salim, S.G.R} } @Article { , title = {METefnet: developments in metrology for moisture in materials}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15003}, keywords = {Development - Moisture in materials}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Bell, S and Aro, A and Arpino, F and Aytekin, S and Cortellessa, G and Dell’Isola, M and Ferenč{\'i}kov{\'a}, Z and Fernicola, V and Gavioso, R and Georgin, E and Heinonen, M and Hudoklin, D and Jalukse, L and Karab{\"o}ce, N and Leito, I and M{\"a}kynen, A and Miao, P and Nielsen, J and Nicolescu, I and Rudolfov{\'a}, M and Ojanen-Saloranta, M and {\"O}sterberg, P and {\O}stergaard, P and Rujan, M and Sega, M and Strnad, R and Vachova, T} } @Article { , title = {First steps in development of a new transfer standard, for moisture measurement, based on radio-frequency wave and micro-wave.}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, day = {21}, volume = {17th}, number = {2015}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {15008}, keywords = {Moisture, high frequencies, micro-waves, metrology, transfer standard.}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15008/metrology_metr2015_15008.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, language = {30}, ISSN = {NA}, DOI = {10.1051/metrology/20150015008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Georgin, E and Rochas, JF and Achard, P and Hubert, S and Ben Ayoub, MW and Sabouroux, P} } @Article { , title = {The determination of wear volumes by chromatic confocal measurements during twin-disc tests with cast iron and steel}, journal = {Wear}, year = {2015}, month = {9}, day = {15}, volume = {338–339}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {95–104}, keywords = {Profile measurements, Chromatic confocal probe, Twin-disc tests, Wear, Friction}, web_url = {http://www.sciencedirect.com/science/article/pii/S004316481500318X}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier }, language = {30}, ISSN = {0043-1648}, DOI = {10.1016/j.wear.2015.05.011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hemming, BH and Andersson, PA} } @Article { , title = {Comprehensive Comparison of Various Techniques for the Analysis of Elemental Distributions in Thin Films: Additional Techniques}, journal = {Microscopy and Microanalysis}, year = {2015}, month = {9}, day = {14}, volume = {21}, number = {6}, number2 = {ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications}, pages = {1644-1648}, keywords = {elemental distributions, thin films, laser-induced breakdown spectroscopy, grazing-incidence X-ray fluorescence analysis, comparison}, web_url = {http://journals.cambridge.org/action/displayAbstract?fromPage=online\&aid=10063275\&fulltextType=RA\&fileId=S1431927615015093}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {Cambridge University Press (CUP)}, language = {30}, ISSN = {1431-9276}, DOI = {10.1017/S1431927615015093}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Abou-Ras, DAR and Caballero, RC and Streeck, CS and Beckhoff, BB and In, JHI and Jeong, SJ} } @Proceedings { , title = {DESIGN OF A MEASUREMENT STANDARD FOR MONITORING METROLOGICAL PERFORMANCE OF MACHINE TOOLS}, journal = {Proceedings of International Conference on Innovative Technologies IN-TECH2015}, year = {2015}, month = {9}, day = {12}, volume = {1}, number = {1}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {104-107}, keywords = {Design, traceability, measurement standard, machine tool}, web_url = {http://www.in-tech.info}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Faculty of Engineering, University of Rijeka}, address = {Rijeka, Croatia}, event_place = {Dubrovnik, Croatia}, event_name = {International Conference on Innovative Technologies IN-TECH2015}, event_date = {08-09-2015 to 12-09-2015}, language = {30}, ISBN = {977-000-001-849-7}, ISSN = {1849-0662}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://www.in-tech.info}, author = {Acko, M. and Klobucar, R. and Milfelner, M.} } @Article { , title = {Investigating the ultimate accuracy of Doppler Broadening Thermometry by means of a global fitting procedure}, journal = {Physical Review A}, year = {2015}, month = {9}, day = {8}, volume = {92}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {032506}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {APS}, address = {New York}, language = {30}, DOI = {10.1103/PhysRevA.92.032506}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Amodio, Pasquale and De Vizia, Maria Domenica and Moretti, Luigi and Gianfrani, Livio} } @Proceedings { , title = {Propagation automatique des incertitudes: application aux techniques auto-talonnage des analyseurs de seau vectoriel}, journal = {17th International Congress of Metrology}, year = {2015}, month = {9}, volume = {2015}, number = {2015}, number2 = {SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits}, pages = {12006}, keywords = {-}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/contents/contents.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, address = {London}, event_place = {Paris}, event_name = {International Congress of Metrology}, event_date = {21-09-2015 to 24-09-2015}, language = {37}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/20150012006}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Allal, D and Hall, B and Vincent, P and Litwin, A and Ziad{\'e}, F and Allal, Djamel} } @Article { ViefhausNSRHAHPYY2015, title = {A new compact soft x-ray spectrometer for resonant inelastic x-ray scattering studies at PETRA III}, journal = {Review of Scientific Instruments}, year = {2015}, month = {9}, volume = {86}, number = {9}, number2 = {SIB58: Angles: Angle metrology}, pages = {093109}, keywords = {synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {AIP Publishing}, language = {30}, ISSN = {0034-6748, 1089-7623}, DOI = {10.1063/1.4930968}, stag_bib_extends_levelofaccess = {NA}, author = {Viefhaus, J. and Nordgren, J. and Siewert, F. and Reininger, R. and Hage, A. and Ag{\aa}ker, M. and Hahn, U. and Peters, H. B. and Yin, Z. and Yandayan, Tanfer} } @Proceedings { , title = {Numerical Modeling of Hysteresis Applied on Force Transducer}, journal = {Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque (2015)}, year = {2015}, month = {8}, day = {30}, volume = {22}, number = {1}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {4}, keywords = {Hysteresis, Reversibility, Transducer, Maxwell-Slip, Calibration}, web_url = {http://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC3-073.pdf}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IMEKO}, address = {Budapest}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Rabault, T. and Averlant, P. and Boineau, F.} } @Article { KimNHLAHLHMLHJBCPYKSPPHK2015, title = {A Facile Route for Patterned Growth of Metal–Insulator Carbon Lateral Junction through One-Pot Synthesis}, journal = {ACS Nano}, year = {2015}, month = {8}, day = {25}, volume = {9}, number = {8}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {8352-8360}, keywords = {amorphous carbon, bottom-up growth, graphene, graphene growth from polymer, graphene-based heterostructure}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {American Chemical Society (ACS)}, address = {Washington, USA}, language = {30}, ISSN = {1936-0851, 1936-086X}, DOI = {10.1021/acsnano.5b03037}, stag_bib_extends_levelofaccess = {NA}, author = {Kim, Kwang S. and Novoselov, Konstantin S. and Hwang, Chanyong and Lee, Zonghoon and Ahn, Jong-Hyun and Han, Sang Woo and Lee, Tae Geol and Hyun, Seung and Mishchenko, Artem and Lee, Seoung-Ki and Huh, Sung and Jeon, Gumhye and Byun, Jinseok and Chae, Dong-Hun and Park, Hyo Ju and Yu, Seong Uk and Kim, Yong-Jin and Son, Jin Gyeong and Park, Jaesung and Park, Beomjin and Hong, Byung Hee and Kim, Jin Kon} } @Proceedings { , title = {Measurement and Simulation of Heat Transfer into a Human Skin Phantom}, year = {2015}, month = {8}, day = {24}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, keywords = {THz, mm-wave, Skin Phantom, Thermal Imaging}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Hong Kong}, event_name = {40th International Conference on Infrared, Millimeter and Terahertz Waves (IRMMW-THz 2015)}, event_date = {2015-08-23 until 2015-08-28}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kazemipour, A. and Charles, M. and Allal, D. and Borsero, M. and Zilberti, L. and Bottauscio, O. and Chiampi, M.} } @Proceedings { , title = {Adapter and method for improving the LISN input impedance measurement accuracy}, journal = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, year = {2015}, month = {8}, day = {22}, volume = {2015}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1254-1259}, keywords = {3D electromagnetic simulations, LISN calibration, input impedance, conductive immunity}, web_url = {http://ieeexplore.ieee.org/document/7256350/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Dresden}, event_name = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, event_date = {16-08-2015 to 22-08-2015}, language = {30}, ISBN = {978-1-4799-6616-5}, ISSN = {2158-1118}, DOI = {10.1109/ISEMC.2015.7256350}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ziade, Francois and Ouameur, Mohamed and B{\'e}li{\`e}res, Denis and Poletaeff, Andr{\'e} and Allal, Djamel and Kokalj, Miha and Pinter, Borut} } @Proceedings { , title = {Alternative conducted immunity testing with multiple CDNs and wire winding}, journal = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, year = {2015}, month = {8}, day = {22}, volume = {2015}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1260 - 1265}, keywords = {Alternative, Current Probe, CDN, Conducted Immunity, EMC, High Current, Industry, Mains Impedance}, web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=7256351\&tag=1}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {USA}, event_place = {Dresden}, event_name = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, event_date = {16-08-2015 to 22-08-2015}, language = {30}, ISBN = {-}, ISSN = {2158-110X}, DOI = {10.1109/ISEMC.2015.7256351}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {\c{C}akır, Soydan and Şen, Osman and ACAK, Savaş and \c{C}etintaş, Mustafa} } @Proceedings { CetintasACS2015, title = {Alternative conducted emission measurements with LISN simulation \& CISPR 16 Voltage Probe}, journal = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, year = {2015}, month = {8}, day = {22}, volume = {2015}, number = {2015}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1243-1247}, keywords = {Alternative; Voltage; Probe; Conducted Emission; EMC; Industry; In-Situ; LISN; Mains Impedance; On-Site}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, event_place = {Dresden}, event_name = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015)}, event_date = {16-08-2015 to 22-08-2015}, language = {30}, DOI = {10.1109/ISEMC.2015.7256348}, stag_bib_extends_levelofaccess = {NA}, author = {\c{C}etintaş, M. and Acak, S. and \c{C}akır, S. and Şen, O.} } @Article { , title = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system}, journal = {Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system}, year = {2015}, month = {8}, day = {19}, volume = {2}, number = {3}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {035015}, keywords = {graphene, Quantum Hall, cryogen-free, measurement}, web_url = {http://iopscience.iop.org/2053-1583/2/3/035015/video/abstract}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {2053-1583}, DOI = {10.1088/2053-1583/2/3/035015}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Rozhko, S. and Antonov, I. and Tzalenchuk, A. and Williams, J. M. and Melhem, Z. and He, H. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R.} } @Article { , title = {Improving Time-Domain EMI Measurements Through Digital Signal Processing}, journal = {IEEE Electromagnetic Compatibility Magazine}, year = {2015}, month = {8}, day = {17}, volume = {4}, number = {Quarter 2}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {82-91}, keywords = {Digital Signal Processing, Electromagnetic compatibility, Electromagnetic interference, Electromagnetic measurements, Time-domain analysis.}, web_url = {http://ieeexplore.ieee.org/document/7204056/}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {-}, language = {30}, ISSN = {2162-2272}, DOI = {10.1109/MEMC.2015.7204056}, extern = {1}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {2162-2264}, author = {Azp{\'u}rua, Marco and Pous, Marc and \c{C}akir, Soydan and \c{C}ETİNTAŞ, Mustafa and Silva, Ferran} } @Article { , title = {Detecting metrologically useful entanglement in the vicinity of Dicke states}, journal = {New Journal of Physics}, year = {2015}, month = {8}, day = {13}, volume = {17}, number = {1}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {083027}, keywords = {quantum Fisher information, quantum metrology, quantum entanglement, Dicke states}, web_url = {http://arxiv.org/abs/1412.3426}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IOP Publishing}, address = {Bristol BS1 6HG UK}, language = {30}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/17/8/083027}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://iopscience.iop.org/1367-2630/17/8/083027}, author = {Apellaniz, I and L{\"u}cke, B and Peise, J and Klempt, C and T{\'o}th, G} } @Proceedings { , title = {Investigations for determining the sound power level by applying different measurement setups according to ISO 3744}, journal = {InterNoise 2015}, year = {2015}, month = {8}, day = {9}, volume = {44}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, pages = {11}, keywords = {sound power level determination, measurement errors,tracebility}, web_url = {http://ince.publisher.ingentaconnect.com/content/ince/incecp/2015/00000250/00000004}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {INTERNOISE}, address = {Washington, D.C.}, event_place = {San Francisco}, event_name = {InterNoise 2015}, event_date = {09.08.2015-12.08.2015}, language = {30}, ISSN = {0736-2935}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arendt, I. and Kurtz, P.} } @Proceedings { , title = {Airborne sound power level measurements revisited}, journal = {InterNoise 2015}, year = {2015}, month = {8}, day = {9}, volume = {44.}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, pages = {4684-4692}, keywords = {sound power level determination, systematic differences, tracebility}, web_url = {http://ince.publisher.ingentaconnect.com/content/ince/incecp/2015/00000250/00000002}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {INTERNOISE}, address = {Washington, D.C.}, event_place = {San Francisco}, event_name = {InterNoise 2015}, event_date = {9.-12. August 2015}, language = {30}, ISSN = {0736-2935}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arendt, I. and Kurtz, P.} } @Proceedings { , subid = {135}, title = {Metrology for long distance surveying - a joint attempt to improve traceability of long distance measurements}, journal = {IAG 150 Years - Proceedings of the 2013 IAG Scientific Assembly}, year = {2015}, month = {8}, day = {1}, volume = {143}, number = {2015}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {calibration · EDM · GNSS · local ties · reference baseline · long distance}, web_url = {http://link.springer.com/chapter/10.1007\%2F1345_2015_154}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Springer International Publishing}, address = {Berlin Heidelberg}, event_place = {Potsdam, Germany}, event_name = {International Association of Geodesy (IAG) Scientific Assembly 2013}, event_date = {September 1-6, 2013}, language = {30}, ISSN = {0939-9585}, DOI = {10.1007/1345_2015_154}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Pollinger, F. and Astru, M. and Bauch, A. and Bergstrand, S. and G{\"o}rres, B. and Jokela, J. and Kallio, U. and Koivula, H. and Kuhlmann, H. and Kupko, V. and Meiners-Hagen, K. and Merimaa, M. and Niemeier, W. and Neyezhmakov, P. and Poutanen, M. and Saraiva, F. and Sch{\"o}n, S. and van den Berg, S.A. and Wallerand, J.-P. and Zucco, M.} } @Techreport { , title = {A Guide to Bayesian Inference for Regression Problems}, journal = {-}, year = {2015}, month = {7}, day = {30}, volume = {-}, number = {-}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {-}, keywords = {-}, tags = {MAT}, web_url = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {PTB}, address = {Brunswick \& Berlin}, institution = {-}, language = {30}, ISBN = {-}, ISSN = {-}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf}, author = {Elster, C. and Klauenberg, K. and Walzel, M. and Wuebbeler, G. and Harris, P. and Cox, M. and Matthews, C. and Smith, I. and Wright, L. and Allard, A. and Fischer, N. and Cowen, S. and Ellison, S. and Wilson, P. and Pennecchi, F. and Kok, G. and Van der Veen, A. and Pendrill, L.R.} } @Article { , title = {Measuring Compositions in Organic Depth Profiling: Results from a VAMAS Interlaboratory Study}, journal = {Journal of Physical Chemistry (B)}, year = {2015}, month = {7}, day = {23}, volume = {119}, number = {33}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {10784–10797}, web_url = {http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b05625}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {ACS}, address = {Washington DC}, language = {30}, DOI = {10.1021/acs.jpcb.5b05625}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-6}, author = {Shard, A. and Havelund, R. and Spencer, S. and Gilmore, I. and Alexander, M.R. and Angerer, T.B. and Aoyagi, S. and Barnes, J.P. and Benayad, A. and Bernasik, A. and Ceccone, G. and Counsell, J.D.P and Deeks, C. and Fletcher, J.S. and Graham, D.J. and Heuser, C. and Lee, T.G. and Marie, C. and Marzec, M.M. and Mishra, G. and Rading, D. and Renault, O. and Scurr, D.J and Shon, H.K. and Spampinato, V. and Tian, H. and Wang, F. and Winograd, N. and Wu, K. and Wucher, A.} } @Article { , title = {Primary standards for measuring flow rates from 100 nl/min to 1 ml/min – gravimetric principle}, journal = {Biomed. Eng.-Biomed.}, year = {2015}, month = {7}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {301-316}, keywords = {dynamic gravimetric calibration; intercomparison; liquid; metrology for drug delivery; microflow; primary standard; validation.}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0145}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bissig, H. and Petter, H.T. and Lucas, P. and Batista, E. and Fillipe, E. and Almeida, N. and Ribeiro, L.F. and Gala, J. and Martins, R. and Savanier, B. and Ogheard, F. and Niemann, A.K. and L{\"o}tters, J. and Sparreboom, W.} } @Article { , title = {Vectorial ray-based diffraction integral}, journal = {J. Opt. Soc. Am. A}, year = {2015}, month = {7}, day = {2}, volume = {32}, number = {8}, number2 = {SIB08: subnano: Traceability of sub-nm length measurements}, pages = {1403-1424}, keywords = {Diffraction theory; Wave dressing of rays, Propagation methods; Metrology}, web_url = {https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-8-1403}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/JOSAA.32.001403}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Andreas, B. and Mana, G. and Mana, G.} } @Article { , title = {Evaluation of HPGe spectrometric devices in monitoring the level of radioactive contamination in metallurgical industry}, journal = {Nuclear Instruments and Methods in Physics Research, Section A}, year = {2015}, month = {7}, day = {1}, volume = {797}, number = {not available}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {271-277}, keywords = {High Purity Germanium; Minimum detectable activity; Monte Carlo; Spectrometer; Standardisation; Steel factories}, web_url = {http://www.sciencedirect.com/science/article/pii/S0168900215008220}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {ELSEVIER}, address = {Amsterdam}, language = {30}, ISSN = {0168-9002}, DOI = {10.1016/j.nima.2015.07.002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Petrucci, Andrea and Arnold, Dirk and Burda, Oleksiy and De Felice, Pierino and Garc{\'i}a-Tora{\~n}o, Eduardo and Mejuto, Marco and Peyr{\'e}s, Virginia and Šolc, Jaroslav and Vodenik, Branko} } @Article { , title = {Characterization and reduction of the amplitude-to-phase conversion effects in telemetry}, journal = {Meas. Sci. Technol.}, year = {2015}, month = {7}, volume = {26 (8)}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, keywords = {laser diode, photodetection, amplitude modulation, phase measurement, amplitude-to-phase coupling, optical telemetry, absolute distance meter}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {30}, DOI = {10.1088/0957-0233/26/8/084006}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Guillory, J and Garc{\'i}a-M{\'a}rquez, J and Alexandre, C and Wallerand, J-P and Truong, D} } @Article { , title = {Imaging microwave and DC magnetic fields in a vapor-cell Rb atomic clock}, journal = {IEEE Transactions on Instrumentation and Measurement}, year = {2015}, month = {6}, day = {30}, volume = {64}, number = {12}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {3629-3637}, keywords = {Atomic clocks, diode lasers, microwave measurements, microwave resonators, microwave spectroscopy, optical pumping}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7140794}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {The Institute of Electrical and Electronics Engineers (IEEE)}, address = {New York, NY, USA}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2444261}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://arxiv.org/abs/1505.07739}, author = {Affolderbach, C. and Du, G.-X. and Bandi, T. and Horsley, A. and Treutlein, P. and Mileti, G.} } @Article { , title = {Primary standard for liquid flow rates between 30 and 1500 nl/min based on volume expansion}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {6}, day = {26}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {317-335}, keywords = {calibration; comparison; implanted infusion; pumps; micro and nano liquid flow rates; primary standard; uncertainty; validation; volumetric expansion}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0132}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lucas, P. and Ahrens, M. and Geršl, J. and Sparreboom, W. and L{\"o}tters, J.} } @Proceedings { , title = {Application of PMUs for monitoring a 50 kV distribution grid}, journal = {Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 2015}, year = {2015}, month = {6}, day = {15}, volume = {n/a}, number = {n/a}, number2 = {ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality}, pages = {1-5}, keywords = {phasor measurement units, smart grids, renewable energy sources}, web_url = {http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {n/a}, address = {n/a}, event_place = {Lyon, France}, event_name = {23rd International Conference and Exhibition on Electricity Distribution (CIRED)}, event_date = {14-06-15 to 15-06-15}, language = {30}, ISBN = {n/a}, ISSN = {n/a}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf}, author = {Rietveld, G and Jongepier, A and van Seters, J and Visser, M and Liu, P and Acanski, M and Hoogenboom, D and van den Brom, H. E.} } @Article { , title = {An experimental setup for traceable measurement and calibration of liquid flow rates down to 5 nl/min}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {6}, day = {10}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {337-345}, keywords = {calibration; metrology; microflow; nanoflow; traceability; uncertainty.}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0153}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ahrens, M. and Nestler, B. and Klein, S. and Lucas, P. and Petter, H.T. and Damiani, C.} } @Article { , title = {Dynamic torque calibration by means of model parameter identification}, journal = {Acta Imeko}, year = {2015}, month = {6}, volume = {4}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {39-44}, keywords = {model parameter identification; dynamic torque calibration; dynamic measurement; mechanical model}, web_url = {https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-04\%20\%282015\%29-02-07}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Imeko}, address = {Budapest}, language = {30}, ISSN = {ISSN 2221-870X}, DOI = {10.21014/acta_imeko.v4i2.211}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klaus, L. and Arendack{\'a}, B. and Kobusch, M. and Bruns, T.} } @Article { , title = {Verification of statistical calculations in interlaboratory comparisons by simulating input datasets}, journal = {International Journal of Simulation Modelling}, year = {2015}, month = {6}, volume = {14}, number = {2}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {227-237}, keywords = {Interlaboratory Comparison, Validation Software, Performance Metrics, Verification, Simulation}, tags = {MAT}, web_url = {http://www.ijsimm.com/Full_Papers/Fulltext2015/text14-2_227-237.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {DAAAM International Vienna }, address = {Vienna}, language = {30}, ISSN = {1726-4529}, DOI = {10.2507/IJSIMM14(2)4.288}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Acko, BA and Brezovnik, SB and Crepinsek-Lipus, LCL and Klobucar, RK} } @Proceedings { , title = {TRANSIENT INCOMPRESSIBLE FLOW IN A PARTIALLY POROUS BUOYANCY DRIVEN TALL CAVITY}, year = {2015}, month = {5}, day = {19}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, web_url = {http://www.asmeatiuit2015.com/public/index.php}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Villa Doria D'Angri, Napoli}, event_name = {ASME ATI UIT 2015}, event_date = {17-20 June, 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arpino, F. and Cortellessa, G. and Dell'Isola, M. and Ficco, G. and Carotenuto, A. and Massarotti, N.} } @Article { , title = {Novel automated methods for coarse and fine registrations of point clouds in high precision metrology}, journal = {The International Journal of Advanced Manufacturing Technology}, year = {2015}, month = {5}, day = {14}, volume = {81}, number = {5}, number2 = {IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products}, pages = {795-810}, keywords = {Coarse registration, Fine registration, Discrete curvatures, Hough transform, Moving least squares surface, Computational tomography, Measurement errors, Dimensional metrology}, web_url = {http://link.springer.com/article/10.1007/s00170-015-7131-1}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Springer}, address = {London}, language = {30}, ISSN = {0268-3768}, DOI = {10.1007/s00170-015-7131-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Rantoson, R. and Nouira, H. and Anwer, N. and Mehdi-Souzani, C.} } @Article { SuranKBAMSHTLT2015, title = {A new large-volume metal reference standard for radioactive waste management}, journal = {Radiation Protection Dosimetry}, year = {2015}, month = {5}, day = {13}, volume = {168}, number = {3}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {293-299}, keywords = {reference materials, calibration, ionizing radiation, free release measurement}, web_url = {http://rpd.oxfordjournals.org}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Oxford University Press (OUP)}, language = {30}, ISSN = {0144-8420, 1742-3406}, DOI = {10.1093/rpd/ncv309}, stag_bib_extends_levelofaccess = {NA}, author = {Šur{\'a}ň, J. and Kov{\'a}ř, P. and Burda, O. and Arnold, D. and Marissens, G. and Stroh, H. and Hult, M. and Tzika, F. and Listkowska, A. and Tyminski, Z.} } @Proceedings { , title = {Systematische Fehler bei der Anwendung verschiedener Verfahren zur Ermittlung des Schallleistungspegels [Systematic errors by applying different procedures for determining the sound power level]}, journal = {Fortschritte der Akustik - DAGA 2015}, year = {2015}, month = {5}, day = {11}, volume = {41. Jahrestagung f{\"u}r Akustik}, number2 = {SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound}, keywords = {sound power level determination, sound intensity, systematic differences}, web_url = {http://daga2015.de/de/}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {Deutsche Gesellschaft f{\"u}r Akustik e.V. (DEGA)}, address = {Berlin}, event_place = {N{\"u}rnberg}, event_name = {Fortschritte der Akustik - DAGA 2015}, event_date = {16. bis 19. M{\"a}rz 2015}, language = {43}, ISBN = {978-3-939296-08-9}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arendt, I. and Berger, A.} } @Article { , title = {Frequency and time transfer for metrology and beyond using telecommunication network fibres}, journal = {Comptes Rendus Physique}, year = {2015}, month = {5}, day = {8}, volume = {16}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {531–539}, keywords = {Time and frequency metrology Optical links Frequency stabilized lasers Fibre optics}, web_url = {www.sciencedirect.com}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1016/j.crhy.2015.04.005}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopez, O. and K{\'e}f{\'e}lian, F. and Jiang, H. and Haboucha, A. and Bercy, A. and Stefani, F. and Chanteau, B. and Kanj, A. and Rovera, D. and Achkar, J. and Chardonnet, C and Pottie, P.-O. and Amy-Klein, A. and Santarelli, G.} } @Article { , title = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, journal = {Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements}, year = {2015}, month = {5}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {Dirac-point physics, epitaxial graphene, magneto-transport, measurement, graphene, hall effect, electron-hole puddles,}, web_url = {http://arxiv.org/abs/1505.03747}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1103/PhysRevB.92.075407}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, J. and Alexander-Webber, J.A. and Baker, A.M.R. and Janssen, T.J.B.M. and Tzalenchuk, A. and Antonov, V. and Yager, T. and Lara-Avila, S. and Kubatkin, S. and Yakimova, R. and Nicholas, R.J.} } @Article { , title = {Phase Locking a Clock Oscillator to a Coherent Atomic Ensemble}, journal = {Phys. Rev. X}, year = {2015}, month = {4}, day = {27}, volume = {5}, number = {2}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {021011}, keywords = {Atomic and Molecular Physics, Quantum Physics}, web_url = {http://arxiv.org/abs/1501.03709}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {2160-3308}, DOI = {10.1103/PhysRevX.5.021011}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kohlhaas, R and Bertoldi, A and Cantin, E and Aspect, A and Landragin, A and Bouyer, P} } @Article { , title = {Multiphoton luminescence imaging of chemically functionalized multi-walled carbon nanotubes in cells and solid tumors†}, journal = {ChemComm}, year = {2015}, month = {4}, day = {24}, volume = {51}, number = {45}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {9366-9369}, keywords = {N/A}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2015/CC/c5cc02675j\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Royal Society of Chemistry}, address = {Picadilly UK}, language = {30}, ISSN = {N/A}, DOI = {10.1039/c5cc02675j}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Rubio, N. and Hirvonen, L.M. and Chong, E.Z. and Wang, J.T.W. and Bourgognon, M. and Kafa, H. and Hassan, H.A.F.M. and Al-Jamal, W.T. and McCarthy, D. and Hogstrand, C. and Festy, F. and Al-Jamal, K.T.} } @Article { , title = {Epitaxial graphene on SiC: Modification of structural and electron transport properties by substrate pretreatment}, journal = {Epitaxial graphene on SiC: modification of structural and electron transport properties by substrate pretreatment}, year = {2015}, month = {4}, day = {20}, volume = {27}, number = {18}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {185303}, keywords = {Epitaxial graphene, step bunching, graphene buffer layer, graphene bilayer, resistance anisotropy, quantum Hall resistance, hydrogen, argon, pretreatment, transport properties, SiC substrate, annealing, shallowly stepped}, web_url = {http://iopscience.iop.org/article/10.1088/0953-8984/27/18/185303/meta}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing Ltd}, language = {30}, ISSN = {0953-8984}, DOI = {10.1088/0953-8984/27/18/185303}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Kruskopf, M. and Pierz, K. and Wundrack, S. and Stosch, R. and Dziomba, T. and Kalmbach, C.C. and M{\"u}ller, A. and Ahlers, F.J. and Schumacher, H.W. and Baringhaus, J. and Tegenkamp, C.} } @Article { , title = {Interaction-free measurements by quantum Zeno stabilization of ultracold atoms}, journal = {Nature Communications}, year = {2015}, month = {4}, day = {14}, volume = {6}, number = {1}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {6811}, keywords = {Physical sciences Atomic and molecular physics}, web_url = {http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html\#affil-auth}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Macmillan Publishers Limited}, address = {Basingstoke, Hampshire RG21 6XS, United Kingdom}, language = {30}, ISSN = {2041-1723}, DOI = {10.1038/ncomms7811}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html\#affil-auth}, author = {Peise, J and L{\"u}cke, B and Pezze, L and Deuretzbacher, F and Ertmer, W and Arlt, J and Smerzi, A and Santos, L and Klempt, C} } @Article { , title = {Tackling the limits of optical fiber links}, journal = {J. Opt. Soc. Am. B}, year = {2015}, month = {4}, day = {9}, volume = {32}, number = {5}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {787 - 797}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/JOSAB.32.000787}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Stefani, F. and Lopez, O. and Bercy, A. and Lee, W.-K. and Chardonnet, C. and Santarelli, G. and Pottie, P.-E. and Amy-Klein, A.} } @Article { , title = {Sensing earth's rotation with a helium-neon ring laser operating at 1.15 \(\mu\)m}, journal = {Opt. Lett.}, year = {2015}, month = {4}, day = {8}, volume = {40}, number = {8}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {1705}, keywords = {(120.5790) Sagnac effect; (140.3370) Laser gyroscopes; (140.3560) Lasers, ring.}, web_url = {https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-8-1705}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington, DC, USA}, language = {30}, ISSN = {1539-4794}, DOI = {10.1364/OL.40.001705}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Schreiber, U and Thirkettle, R and Hurst, R and Follman, D and Cole, G and Aspelmeyer, M and Wells, J-P} } @Article { , title = {Evaluation and Selection of High-Temperature Fixed-Point Cells for Thermodynamic Temperature Assignment}, journal = {Int J Thermophys}, year = {2015}, month = {4}, day = {5}, volume = {36}, number = {8}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {1834-1847}, keywords = {High-temperature fixed points · Metal-carbon eutectics · Radiation thermometry · Temperature standards · Thermodynamic temperature}, web_url = {http://link.springer.com/article/10.1007/s10765-015-1860-0}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer Link}, address = {Europe/Asia/Africa}, language = {30}, ISSN = {NA}, DOI = {10.1007/s10765-015-1860-0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Yamada, Y and Anhalt, K and Battuello, M and Bloembergen, P and Khlevnoy, B and Machin, G and Matveyev, M and Sadli, M and Todd, A and Wang, T} } @Article { , title = {Electroluminescence from a diamond device with ion-beam-micromachined buried graphitic electrodes}, journal = {Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms}, year = {2015}, month = {4}, day = {1}, volume = {348}, number = {8}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {187-190}, keywords = {Diamond; Electroluminescence; Graphite; Ion beam micro-machining}, web_url = {http://www.sciencedirect.com/science/journal/0168583X}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Elsevier}, address = {London}, language = {30}, ISSN = {0168-583X}, DOI = {10.1016/j.nimb.2014.12.036}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Forneris, J. and Battiato, A. and Gatto Monticone, D. and Picollo, F. and Amato, G. and Boarino, L. and Brida, G. and Degiovanni, I.P. and Enrico, E. and Genovese, M. and Moreva, E. and Traina, P. and Verona, C. and Verona Rinati, G. and Olivero, P.} } @Article { , title = {Positive operator-valued measure reconstruction of a beam-splitter tree-based photon-number-resolving detector}, journal = {OPTICS LETTERS}, year = {2015}, month = {4}, day = {1}, volume = {40}, number = {7}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {1548-1551}, keywords = {Quantum optics, Quantum detectors, Quantum information and processing.}, web_url = {https://www.osapublishing.org/ol/home.cfm}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {Optical Society of America}, address = {Washington}, language = {30}, ISSN = {0146-9592}, DOI = {10.1364/OL.40.001548}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-4-1}, author = {Piacentini, F. and Levi, M. P. and Avella, A. and L{\'o}pez, M. and K{\"u}ck, S. and Polyakov, S. V. and Degiovanni, I. P. and Brida, G. and Genovese, M.} } @Article { MeylanGGVBOABBG2015, title = {Characterisation of interaction of radiation with cells - Track structure modelling and biodescriptors of the topology of energy deposition}, journal = {Radiotherapy and Oncology}, year = {2015}, month = {4}, volume = {115}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {S106-S107}, keywords = {BioQuaRT, track structure, ion beam therapy, microdosimetry, nanodosimetry, multi-scale model, reactive species}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier BV}, address = {Suite 800, 230 Park Avenue, New York, NY 10169, United States}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/S0167-8140(15)40209-9}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Meylan, S. and Gruel, G. and Gonon, G. and Villagrasa, C. and Bug, M.U. and Otto, Sandra and Arndt, A. and Baek, W.Y. and Bueno, M. and Giesen, U.} } @Article { AlexanderRVW2015, title = {Exploring the potential of nanometric track structure based quantities for particle beam treatment planning}, journal = {Radiotherapy and Oncology}, year = {2015}, month = {4}, volume = {115}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {S796}, keywords = {BioQuaRT, track structure, ion beam therapy, nanodosimetry, treatment planning}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier BV}, address = {Suite 800, 230 Park Avenue, New York, NY 10169 United States}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/S0167-8140(15)41460-4}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Alexander, F. and Rabus, H. and Villagrasa, C. and Wilkens, J.J.} } @Article { , title = {Ion beam figuring machine for ultra-precision silicon spheres correction}, journal = {Precision Engineering}, year = {2015}, month = {3}, day = {31}, volume = {41}, number = {1}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {119}, keywords = {Ion beam figuring Form error correction Silicon sphere Avogadro project}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Elsevier}, address = {Philadelphia}, language = {30}, ISSN = {0141-6359}, DOI = {10.1016/j.precisioneng.2015.03.009}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arnold, Th. and Pietag, F.} } @Article { , title = {Assessment of drug delivery devices}, journal = {Biomed. Eng.-Biomed. Tech.}, year = {2015}, month = {3}, day = {30}, volume = {60}, number = {4}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {347-357}, keywords = {compliance; drug delivery; infusion; metrology; pump; standards}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1515/bmt-2014-0138}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Batista, E. and Almeida, N. and Fillipe, E. and Sousa, L. and Martins, R. and Lucas, P. and Petter, H.T. and Snijder, R.A and Timmerman, A.M.D.E.} } @Article { AzumaBBBBBCDFFHKKKMMMMNNPRRSSVWWZ, title = {Improved measurement results for the Avogadro constant using a 28Si-enriched crystal}, journal = {Metrologia}, year = {2015}, month = {3}, day = {25}, volume = {52}, number = {2}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, keywords = {fundamental constants, Avogadro constant, kilogram}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0026-1394/52/2/360}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Azuma, Y and Barat, P and Bartl, G and Bettin, H and Borys, M and Busch, I and Cibik, L and D’Agostino, G and Fujii, K and Fujimoto, H and Hioki, A and Krumrey, M and Kuetgens, U and Kuramoto, N and Mana, G and Massa, E and Mee{\ss}, R and Mizushima, S and Narukawa, T and Nicolaus, A and Pramann, A and Rabb, S A and Rienitz, O and Sasso, C and Stock, M and Vocke Jr, R D and Waseda, A and Wundrack, S and Zakel, S} } @Article { , title = {Improvements to the volume measurement of 28Si spheres to determine the Avogadro constant}, journal = {IEEE Transaction on Instrumentation and Measurement}, year = {2015}, month = {3}, day = {19}, volume = {64}, number = {6}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {1650-1656}, keywords = {Avogadro constant, diameter measurement, optical interferometer, silicon crystal, spectroscopic ellipsometer, volume measurement.}, web_url = {http://ieeexplore.ieee.org/xpl/abstractCitations.jsp?arnumber=7063918\&refinements\%3D4294557292\%26filter\%3DAND\%28p_IS_Number\%3A7104190\%29}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institution of Electrical and Electrical Engineering (IEEE)}, address = {Piscataway}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2401212}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {INSPEC 15111473}, author = {Kuramoto, N.K. and Azuma, Y. A and Inaba, H. I. and Hong, F-L. H. and Fujii, K. F} } @Article { , title = {Angle Resolved Scattering as a tribological investigation tool for surface characterization}, journal = {Wear}, year = {2015}, month = {3}, day = {15}, volume = {326-327}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {58-67}, keywords = {Surface roughness, Angle-resolved scattering, Wear, Isotropy}, web_url = {https://www.researchgate.net/publication/270344579_Angle_resolved_scattering_as_a_tribological_investigation_tool_for_surface_characterization}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, ISSN = {0043-1648}, DOI = {10.1016/j.wear.2014.12.040}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Azouigui, SA and Silvestri, ZS and Zerrouki, CZ and Plimmer, MP and Spaltmann, DS and Kovalev, AK and Woydt, MW and Pinot, PP} } @Article { KangGAGM2015, title = {Demonstration of a high-performance pulsed optically pumped Rb clock based on a compact magnetron-type microwave cavity}, journal = {Journal of Applied Physics}, year = {2015}, month = {3}, day = {12}, volume = {117}, number = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, keywords = {atomic clock, microwave cavity, optical pumping, POP}, web_url = {http://scitation.aip.org/content/aip/journal/jap/117/10/10.1063/1.4914493}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {English}, ISSN = {0021-8979}, DOI = {10.1063/1.4914493}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kang, S. and Gharavipour, M. and Affolderbach, C. and Gruet, F. and Mileti, G.} } @Article { , title = {Metrological issues related to BRDF measurements around the specular direction in the particular case of glossy surfaces}, journal = {Proceedings of SPIE}, year = {2015}, month = {3}, day = {3}, volume = {9398}, number = {Measuring, Modeling, and Reproducing Material Appearance 2015}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, keywords = {Bidirectional reflectance transmission function ; Metrology ; Optical design ; Reflection ; Specular reflections ; Equipment and services ; Measurement devices}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2208024}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, address = {Bellingham, WA, USA}, language = {30}, DOI = {10.1117/OL.12.2082518}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Obein, G. and Audenaert, J. and Ged, G. and Leloup, F.} } @Article { PhilippFRAFFYD2015, title = {Experimental design for TBT quantification by isotope dilution SPE–GC–ICP–MS under the European water framework directive}, journal = {Talanta}, year = {2015}, month = {3}, volume = {134}, number2 = {ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC)}, pages = {576-586}, keywords = {experimental design, isotope dilution, organotin compounds, solid-phase extraction, tributyltin, water framework directive}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Elsevier BV}, language = {30}, ISSN = {0039-9140}, DOI = {10.1016/j.talanta.2014.11.064}, stag_bib_extends_levelofaccess = {NA}, author = {Philipp, R. and Fisicaro, P. and Richter, J. and Alasonati, E. and Fabbri, B. and Fettig, I. and Yardin, C. and Del Castillo Busto, M.E.} } @Article { , title = {Digital holography and quantitative phase contrast imaging using computational shear interferometry}, journal = {Optical Engineering}, year = {2015}, month = {2}, day = {26}, volume = {54}, number = {2}, number2 = {SIB08: subnano: Traceability of sub-nm length measurements}, pages = {024110}, keywords = {Shear interferometry, Wave field sensing, Digital holography, Phase contrast imaging}, web_url = {http://opticalengineering.spiedigitallibrary.org/article.aspx?articleid=2174776}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {SPIE}, address = {Bellingham}, language = {30}, ISSN = {1.OE.54.2.024110}, DOI = {10.1117/1.OE.54.2.024110}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Falldorf, C. and Agour, M. and Bergmann, R. B.} } @Article { , title = {Traceability of In-Process Measurement of Workpiece Geometry}, journal = {Procedia Engineering}, year = {2015}, month = {2}, day = {24}, volume = {100}, number = {-}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {376-383}, keywords = {Traceability; production process; calibration; measurement standard; machine-tool capability}, web_url = {http://www.sciencedirect.com/science/article/pii/S1877705815004087}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Elsevier}, address = {Amsterdam}, language = {30}, ISSN = {1877-7058}, DOI = {10.1016/j.proeng.2015.01.381}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Acko, Bojan and Klobucar, Rok and Acko, Matic} } @Article { , title = {¹³C- and ¹H-detection under fast MAS for the study of poorly available proteins: application to sub-milligram quantities of a 7 trans-membrane protein.}, journal = {Journal of Biomolecular NMR}, year = {2015}, month = {2}, day = {21}, volume = {62}, number = {1}, number2 = {HLT10: BiOrigin : Metrology for biomolecular origin of disease}, pages = {17-23}, keywords = {7 trans-membrane proteins Poorly available proteins Fast magic angle spinning Heteronuclear detection 13C-detection Low sample volumes}, web_url = {http://link.springer.com/article/10.1007\%2Fs10858-015-9911-1}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Springer}, address = {Berlin}, language = {30}, DOI = {10.1007/s10858-015-9911-1}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Watts, Anthony and Judge, Peter J. and Asilmovska, Lubica and Pfeil, Marc Philipp and Higman, Victoria A. and Varga, Krisztina and Taylor, Garrick F. and Dannatt, Hugh R W} } @Article { , title = {Precision measurement of a potential-profile tunable single-electron pump}, journal = {Metrologia}, year = {2015}, month = {2}, day = {5}, volume = {52}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {195-200}, keywords = {single electron pump, quantum current standard, QD electron pump}, web_url = {http://m.iopscience.iop.org/0026-1394/52/2/195}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1088/0026-1394/52/2/195}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bae, M.-H. and Ahn, Y.-H. and Seo, M. and Chung, Y. and Fletcher, J. D. and Giblin, S. P. and Kataoka, M. and Kim, N.} } @Article { ZikmundRKHA, title = {Precise scalar calibration of a tri-axial Braunbek coil system}, journal = {IEEE Transactions on Magnetics}, year = {2015}, month = {2}, day = {2}, volume = {51}, number = {1}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2357783}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zikmund, A. and Ripka, P. and Ketzler, R. and Harcken, H. and Albrecht, M.} } @Article { , title = {Surface Layer Analysis of Si Sphere by XRF and XPS}, journal = {IEEE Transaction on Instrumentation and Measurement}, year = {2015}, month = {2}, day = {2}, volume = {64}, number = {6}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {1509-1513}, keywords = {Chemical analysis, silicon, surface contamination, thickness measurement, X-ray spectroscopy}, web_url = {http://ieeexplore.ieee.org/xpl/abstractAuthors.jsp?arnumber=7029043\&refinements\%3D4294557292\%26filter\%3DAND\%28p_IS_Number\%3A7104190\%29}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Institution of Electrical and Electrical Engineering (IEEE)}, address = {Piscataway}, language = {30}, ISSN = {0018-9456}, DOI = {10.1109/TIM.2015.2389352}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {INSPEC Accession Number: 15111454}, author = {Zhang, L. Z. and Azuma, Y. A. and Kurokawa, A. K. and Kuramoto, N. K. and Fujii, K. F.} } @Techreport { , title = {Progress Report of the Department ‘Fundamentals of Dosimetry’}, journal = {CCRI(I) working documents}, year = {2015}, month = {2}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arndt, A. and Baek, W. Y. and Bennett, D. and Bug, M. U. and Buhr, T. and Hilgers, G. and Nettelbeck, H. and Pfl{\"u}ger, T. and Rabus, H. and Rahm, J. and Ren, X. and Rudek, B. and Sellner, S. and Szymanowski, H. and Wang, M. and Weyland, M.} } @Article { , title = {Etching of silicon surfaces using atmospheric plasma jets}, journal = {Plasma Sources Science and Technology}, year = {2015}, month = {1}, day = {27}, volume = {24}, number = {2}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, pages = {025002}, keywords = {plasma jet machining, plasma etching, surface roughness}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, DOI = {10.1088/0963-0252/24/2/025002}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Paetzelt, H. and B{\"o}hm, G. and Arnold, Th.} } @Article { VerbeystABF2015, title = {Asynchronous electro-optic sampling of all-electronically generated ultrashort voltage pulses}, journal = {Measurement Science and Technology}, year = {2015}, month = {1}, day = {20}, volume = {26}, number = {2}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, pages = {025203}, keywords = {electro-optic sampling, pulse generator, waveform metrology}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, language = {30}, ISSN = {0957-0233, 1361-6501}, DOI = {10.1088/0957-0233/26/2/025203}, stag_bib_extends_levelofaccess = {NA}, author = {Verbeyst, F. and Ahmed, S. and Bieler, M. and F{\"u}ser, H.} } @Article { , title = {Contact-free sheet resistance determination of large area graphene layers by an open}, journal = {Journal of Applied Physics}, year = {2015}, month = {1}, day = {9}, volume = {117}, number = {n/a}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {024501}, keywords = {graphene, dielectic thin films, quartz, electrical resistivity, microwaves}, web_url = {http://scitation.aip.org/content/aip/journal/jap/117/2/10.1063/1.4903820}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, ISSN = {n/a}, DOI = {10.1063/1.4903820}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaforost, O and Wang, K and Goniszewski, S and Adabi, M and Guo, Z and Hanham, S and Gallop, J and Hao, L and Klein, N} } @Article { GarciaToranoPCRABLD2015, title = {A novel radionuclide specific detector system for the measurement of radioactivity at steelworks}, journal = {Journal of Radioanalytical and Nuclear Chemistry}, year = {2015}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, keywords = {Metal radioactivity; HPGe detectors; MDA; metallurgy; steel works}, web_url = {http://www.springer.com/chemistry/journal/10967}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, DOI = {10.1007/s10967-014-3901-8}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Garc{\'i}a-Tora{\~n}o, E. and Peyres, V. and Caro, B. and Roteta, M. and Arnold, D. and Burda, O. and Loan, M-R. and De Felice, P.} } @Article { , title = {Ultrastable low-noise current amplifier: a novel device for measuring small electric currents with high accuracy}, journal = {Rev. Sci. Instrum.}, year = {2015}, volume = {86}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1063/1.4907358}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Drung, D. and Krause, C. and Becker, U. and Scherer, H. and Ahlers, F. J.} } @Proceedings { , title = {Compact and high-performance Rb clock based on pulsed optical pumping for industrial application}, year = {2015}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {800-803}, keywords = {Rb clock; POP; frequency stability; magnetron-type cavity.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Denver CO, USA}, event_name = {2015 JOINT CONFERENCE OF THE IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM \& European Frequency and Time Forum}, event_date = {13-17 April 2015}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Kang, S. and Gharavipour, M. and Gruet, F. and Affolderbach, C. and Mileti, G.} } @Proceedings { , title = {Imaging the Static Magnetic Field Distribution in a Vapor Cell Atomic Clock}, year = {2015}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {21-24}, keywords = {Atomic clocks, Magnetic field measurement, Microwave resonators, Microwave spectroscopy, Optical pumping.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Denver CO, USA}, event_name = {2015 JOINT CONFERENCE OF THE IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM \& European Frequency and Time Forum}, event_date = {13-17 April 2015}, language = {30}, DOI = {10.1109/FCS.2015.7138785}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Affolderbach, C. and Du, G.-X. and Bandi, T. and Horsley, A. and Treutlein, P. and Mileti, G.} } @Proceedings { , title = {A Model to Analyze the Skin Heating Produced by Millimeter and Submillimeter Electromagnetic Waves}, journal = {Proceedings of the 2013 International Conference on Electromagnetics in Advanced Applications (ICEAA)}, year = {2015}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {895 - 898}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, event_place = {Torino, Italy}, event_name = {2013 International Conference on Electromagnetics in Advanced Applications (ICEAA)}, event_date = {9-13 September 2013}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, L. and Arduino, A. and Bottauscio, O. and Chiampi, M.} } @Article { , title = {Results of the EURAMET.RI(II)-S6.I-129 Supplementary Comparison}, journal = {Metrologia Tech. Suppl.}, year = {2015}, volume = {52}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {06017}, keywords = {Activity measurements; I-129; International comparisons}, web_url = {http://iopscience.iop.org/0026-1394}, misc2 = {EMRP A169: Call 2010 Environment}, publisher = {Institute of Physcis Science}, address = {Bristol, UK}, language = {30}, ISSN = {1681-7575}, DOI = {10.1088/0026-1394/52/1A/06017}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-1}, author = {Garcia-Tora{\~n}o, E. and Altzitzoglou, T. and Pavel Auerbach, P. and B{\'e}, M.M. and Lourenco, V. and Bobin, C. and Cassette, P. and Dersch, R. and Kossert, K. and N{\"a}hle, O. and Peyr{\'e}s, V. and Pomm{\'e}, S. and Rozkov, A. and Sanchez-Cabezudo, A. and Sochorov{\'a}, J.} } @Proceedings { , title = {Measurement requirements for biogas specifications}, journal = {17 International Congress of Metrology}, year = {2015}, number2 = {ENG54: Biogas: Metrology for biogas}, keywords = {Biogas}, tags = {EnG}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08006.pdf}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {EDP Sciences}, event_place = {Paris}, event_name = {17 International Congress of Metrology}, event_date = {21 September 2015}, language = {30}, DOI = {10.1051/metrology/201508006}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {van der Veen, Adriaan M. H. and Brown, Andrew S. and Heinonen, Martti and Murugan, Arul and Haloua, Frederique and Arrhenius, Karine and Li, Jianrong} } @Proceedings { , title = {Development of a microflow primary standard}, year = {2015}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Flow. uncertainty, measurement}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Coimbra/Portugal}, event_name = {5th National meeting of the Portuguese Society of Metrology}, event_date = {November 2012}, language = {92}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Batista, Elsa and Gala, Jo{\~a}o and Ribeiro, Luis and Almeida, Nelson and Filipe, Eduarda and Martins, Rui} } @Proceedings { , title = {Calibration of infusion pumps using liquids whose physical properties differ from those of water}, year = {2015}, number2 = {HLT07: MeDD: Metrology for drug delivery}, keywords = {Viscosity, density, infusion medical devices}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Funchal/Portugal}, event_name = {IMEKO TC13}, event_date = {September 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Batista, Elsa and Almeida, Nelson and Moura, Sara and Martins, Rui and Furtado, Andreia and Sousa, Luis and Filipe, Eduarda} } @Article { , title = {Comparison of Molecular Iodine Spectral Properties at 514.7 and 532 nm Wavelengths}, journal = {Measurement Science Review}, year = {2015}, volume = {14}, number = {4}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {10.2478, p 213-218}, keywords = {laser spectroscopy, metrology, molecular iodine, absorption cells, frequency doubling, interferometry}, web_url = {http://www.degruyter.com/view/j/msr.2014.14.issue-4/msr-2014-0029/msr-2014-0029.xml}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {De Gruyter Open Sp. z o.o.}, address = {Berlin}, language = {30}, DOI = {10.2748/msr-2014-0029}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Hrabina, J. and Acef, O. and du Burck, F. and Chiodo, N. and Candela, Y. and Sarbort, M. and Hola, M. and Lazar, J.} } @Proceedings { , title = {Optical characterization of laterally and vertically structured oxides and semiconductors}, journal = {Proc. of SPIE}, year = {2015}, volume = {Vol. 8987}, number2 = {IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices}, keywords = {ZnO, Ellipsometry, Scatterometry, Material Structure}, web_url = {http://spiedigitallibrary.org/}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, DOI = {10.1117/12.2042181}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Petrik, P. and Kumar, N. and Agocs, E. and Fodor, B. and Pereira, S. F. and Lohner, T. and Fried, M. and Urbach, H. P.} } @Proceedings { , title = {Characterization of the effects of the turbulence on the propagation of a laser beam in air}, journal = {17 International Congress of Metrology}, year = {2015}, number = {2015}, number2 = {SIB60: Surveying: Metrology for long distance surveying}, pages = {13014 / 4 pages}, keywords = {coordinate measurement, long distance, laser beam, traceability}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_13014/metrology_metr2015_13014.html}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {EDP Sciences}, event_place = {Paris, France}, event_name = {17 International Congress of Metrology}, event_date = {September 21-24, 2015}, language = {37}, DOI = {10.1051/metrology/20150013014}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Zucco, M. and Pisani, M. and Astrua, M.} } @Article { , title = {Review of Devices, Packaging, and Materials for Cryogenic Optoelectronics}, journal = {Journal of Microelectronics and Electronic Packaging (2015) 12, 189-204 Copyright © International Microelectronics Assembly and Packaging Society ISSN: 1551-4897}, year = {2015}, volume = {Volume 12}, number = {, Issue 4}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {189-204}, keywords = {Packaging and interconnection, cryogenic operation, superconductive circuit, photodetector, photodiode, optical fiber, Josephson junction, single-quantum flux electronics}, web_url = {http://www.imapsource.org/doi/abs/10.4071/imaps.485}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {International Microelectronics Assembly and Packaging Society}, address = {Research Triangle Park}, language = {30}, ISSN = {1551-4897}, DOI = {10.4071/imaps.485}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bardalen, Eivind and Akram, Muhammed Nadeem and Malmbekk, Helge and Ohlckers, Per} } @Article { , title = {Accurate experimental determination of the isotope effects on the triple point temperature of water. II. Combined dependence on the 18O and 17O abundances}, journal = {Metrologia}, year = {2015}, volume = {52}, number = {6}, number2 = {SIB10: NOTED: Novel techniques for traceable temperature dissemination}, pages = {827-834}, keywords = {water triple point, thermometry, oxygen isotopes, isotope correction.}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/52/6/827/meta}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {IOP Publishing, Bureau International des Poids et Mesures}, address = {Berlin}, language = {30}, ISSN = {ISSN 0026-1394}, DOI = {10.1088/0026-1394/52/6/827}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Faghihi, V. and Kozick, M. and Aerts-Bijma, A.T and Jansen, H. G. and Spriensma, J.J. and Peruzzi, A. and Meijer, H.A.J.} } @Article { , title = {Energy dependent track structure parametrisations for protons and carbon ions based on nanometric simulations}, journal = {The European Physical Journal D}, year = {2015}, volume = {69}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, pages = {216}, keywords = {track structure; particle beams; radiotherapy}, web_url = {http://link.springer.com/article/10.1140\%2Fepjd\%2Fe2015-60206-5}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer}, address = {Cham, Switzerland}, language = {30}, ISSN = {1434-6079}, DOI = {10.1140/epjd/e2015-60206-5}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Alexander, F and Villagrasa, C and Rabus, H and Wilkens, J J} } @Article { , title = {A measurement system for radiated transient electromagnetic interference based on general purpose instruments}, journal = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC)}, year = {2015}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {1189-1194}, keywords = {Time domain measurements, electromagnetic interference, radiated emissions, spectral estimation, electromagnetic compatibility}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7256338\&isnumber=7256113}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Dresden}, language = {30}, ISBN = {978-1-4799-6615-8}, ISSN = {2158-110X}, DOI = {10.1109/ISEMC.2015.7256338}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Azp{\'u}rua, M.A.A and Pous, M.P. and Silva, F.S. and Pous, Marc} } @Article { , title = {Radiated transient interferences measurement procedure to evaluate digital communication systems}, journal = {2015 IEEE International Symposium on Electromagnetic Compatibility (EMC)}, year = {2015}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {456-461}, keywords = {APD, transient interferences, impulsive noise, radiated emissions, time-domain measurement}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=7256205\&isnumber=7256113}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Dresden}, language = {30}, ISBN = {978-1-4799-6615-8}, ISSN = {2158-110X}, DOI = {10.1109/ISEMC.2015.7256205}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Pous, Marc and Azp{\'u}rua, Marco A. and Silva, Ferran} } @Article { , title = {Two-way optical frequency comparisons at 5x10-21 relative stability over 100-km telecommunication network fibers}, journal = {PHYSICAL REVIEW A}, year = {2014}, month = {12}, day = {22}, volume = {90}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1103/PhysRevA.90.061802}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Bercy, A. and Stefani, F. and Lopez, O. and Chardonnet, C. and Pottie, P.-E. and Amy-Klein, A.} } @Article { , title = {Transient Thermal Analysis of Natural Convection in Porous and Partially Porous Cavities}, journal = {Numerical Heat Transfer, Part A}, year = {2014}, month = {12}, day = {10}, volume = {67}, number = {not available}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {605–631}, keywords = {Benchmark solutions, Finite element method, Stability analysis, Laminar free convection, Time-periodic oscillating flow field, Heat transfer coefficient calculation.}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Taylor \& Francis}, address = {London}, language = {30}, ISSN = {1040-7782 print=1521-0634 online}, DOI = {10.1080/10407782.2014.949133}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arpino, F. and Cortellessa, G. and Mauro, A.} } @Article { , title = {Single-photon emitters based on NIR color centers in diamond coupled with solid immersion lenses}, journal = {International Journal of Quantum Information}, year = {2014}, month = {12}, day = {10}, volume = {12}, number = {07n08}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, pages = {1560011}, keywords = {Diamond; single-photon emitters; color centers.}, web_url = {http://www.worldscientific.com/worldscinet/ijqi}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {worldscientific}, address = {Singapore}, language = {30}, ISSN = {0219-7499}, DOI = {10.1142/S0219749915600114}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Gatto Monticone, D. and Forneris, J. and Levi, M. and Picollo, F. and Olivero, P. and Traina, P. and E. Moreva, E. and Enrico, E. and Brida, G. and Degiovanni, I. P. and Genovese, M. and Amato, G. and Boarino, L.} } @Article { RastelloDSKCPSMIKSHKTBMPTACMKV2014, title = {Metrology for industrial quantum communications: the MIQC project}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {10}, keywords = {Metrology, quantum cryptography, quantum communication}, web_url = {http://iopscience.iop.org/0026-1394/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S267}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rastello, M L and Degiovanni, I P and Sinclair, A G and K{\"u}ck, S and Chunnilall, C J and Porrovecchio, G and Smid, M and Manoocheri, F and Ikonen, E and Kubarsepp, T and Stucki, D and Hong, K S and Kim, S K and Tosi, A and Brida, G and Meda, A and Piacentini, F and Traina, P and Al Natsheh, A and Cheung, J Y and M{\"u}ller, I and Klein, R and Vaigu, A} } @Article { ChunnilallLAHS2014, title = {Traceable metrology for characterizing quantum optical communication devices}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {10}, keywords = {Metrology, quantum key distribution, single-photon}, web_url = {http://iopscience.iop.org/0026-1394/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/6/S258}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Chunnilall, C J and Lepert, G and Allerton, J J and Hart, C J and Sinclair, A G} } @Article { , title = {New source and detector technology for the realization of photometric units}, journal = {Metrologia}, year = {2014}, month = {11}, day = {20}, volume = {51}, number = {6}, number2 = {SIB57: NEWSTAR: New primary standards and traceability for radiometry}, pages = {197-202}, keywords = {candela photometry radiometry}, web_url = {http://iopscience.iop.org/journal/0026-1394}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0195-928X}, DOI = {10.1088/0026-1394/51/6/S276}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Timo D{\"o}nsberg, T. and Tomi Pulli, T. and Tuomas Poikonen, T. and Hans Baumgartner, H. and Anna Vaskuri, A. and Meelis Sildoja, M. and Farshid Manoocheri, F. and Petri K{\"a}rh{\"a}, P. and Erkki Ikonen, E.} } @Article { MaringerSKCPGCDVHRMSJDTAHM2014, title = {Radioactive waste management: Review on clearance levelsand acceptance criteria legislation, requirements and standards}, journal = {Applied Radiation and Isotopes}, year = {2014}, month = {11}, volume = {81}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, keywords = {Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal}, web_url = {http://www.sciencedirect.com/}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {0969-8043}, DOI = {10.1016/j.apradiso.2013.03.046}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Maringer, F.J. and Šur{\'a}ň, J. and Kov{\'a}ř, P. and Chauvenet, B. and Peyres, V. and Garc{\'i}a-Tora{\~n}o, E. and Cozzella, M.L. and De Felice, P. and Vodenik, B. and Hult, M. and Roseng{\aa}rd, U. and Merimaa, M. and Sz{\"u}cs, L. and Jeffery, C. and Dean, J.C.J. and Tymińsk, Z. and Arnold, D. and Hincam, R. and Mirescu, G.} } @Article { CorteLeonKSMAK2014, title = {Tailoring of domain wall devices for sensing applications}, journal = {IEEE}, year = {2014}, month = {11}, volume = {50}, number = {11}, number2 = {EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems}, keywords = {Magnetic domain walls (DWs), magnetic sensors, micromagnetics, nanostructures, numerical simulations}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6971343}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2014.2327803}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Corte-Le{\'o}n, H. and Krzysteczko, P. and Schumacher, H. W. and Manzin, A. and Antonov, V. and Kazakova, O.} } @Proceedings { KangAGGCM2014, title = {Pulsed Optical Pumping in a Rb Vapour Cell Using a Compact Magnetron-Type Microwave cavity}, year = {2014}, month = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {545-547}, keywords = {atomic clock, microwave cavity, optical pumping, POP}, web_url = {http://www.eftf.org/previousmeetings.php}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Neuchatel, Switzerland}, event_name = {28th European Frequency and Time Forum (EFTF)}, event_date = {22-26 June 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kang, S. and Affolderbach, C. and Gruet, F. and Gharavipour, M. and Calosso, C. E. and Mileti, G.} } @Proceedings { IvanovBDHATMS2014, title = {Experimental and numerical study of the microwave field distribution in a compact magnetron-type microwave cavity}, year = {2014}, month = {10}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {208-211}, keywords = {atomic clock, microwave cavity, field imaging, optical pumping.}, web_url = {http://www.eftf.org/previousmeetings.php}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Neuchatel, Switzerland}, event_name = {28th European Frequency and Time Forum (EFTF)}, event_date = {22-26 June 2014}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Ivanov, A. and Bandi, T. and Du, G.-X. and Horsley, A. and Affolderbach, C. and Treutlein, P. and Mileti, G. and Skrivervik, A. K.} } @Article { , title = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene}, journal = {Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene}, year = {2014}, month = {9}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {hot carriers, bilayer graphene, energy loss rate, magnetotransport}, web_url = {http://arxiv.org/abs/1409.6267v1}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {arXiv.org}, language = {30}, DOI = {10.1088/0953-8984/27/16/164202}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Huang, J. and Alexander-Webber, J.A. and Janssen, T.J.B.M. and Tzalenchuk, A. and Yager, T. and Lara Avila, S. and Kubatkin, S. and Myers-Ward, R. L. and Gaskill, D. K. and Nicholas, R.J.} } @Proceedings { , title = {Metrological measurements in terahertz time-domain spectroscopy at LNE (from 100 GHz to 2 THz)}, journal = {Precision Electromagnetic Measurements (CPEM 2014), 2014 Conference on}, year = {2014}, month = {8}, day = {24}, volume = {29}, number = {1}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {180 - 181}, keywords = {Refractive index, Absorption coefficient, Terahertz, Spectrometry, Uncertainty, Thin layers, Metrology.}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6898318}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {Piscataway}, event_place = {Rio de Janeiro, Brazil}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29/08/2014}, language = {30}, ISBN = {978-1-4799-5205-2}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898318}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Charles, M. and Allal, D. and Allal, Djamel} } @Article { KalmbachSAMNLS2014, title = {Towards a graphene-based quantum impedance standard}, journal = {Applied Physics Letters}, year = {2014}, month = {8}, day = {21}, volume = {105}, number = {073511 (2014)}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1063/1.4893940}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kalmbach, C.-C. and Schurr, J. and Ahlers, F. J. and M{\"u}ller, A. and Novikov, S. and Lebedeva, N. and Satrapinski, A.} } @Article { , title = {Experimental test of the quadratic approximation in the partially-Correlated Speed-Dependent Hard-Collision profile}, journal = {Physical Review A}, year = {2014}, month = {8}, day = {11}, volume = {90}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {022503}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {APS}, address = {New York}, language = {30}, DOI = {10.1103/PhysRevA.90.022503}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {De Vizia, Maria Domenica and Castrillo, Antonio and Fasci, Eugenio and Amodio, Pasquale and Moretti, Luigi and Gianfrani, Livio} } @Proceedings { MeesonPPGLMKLZLKEKMA2014, title = {Measurement and control of single-photon microwave radiation on chip}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip}, pages = {324-325}, keywords = {Cryoelectronics, electromagnetic shielding, microwave photons, microwave sensors, microwave sources, nanoelectronics, single-electron devices, superconducting microwave devices, superconducting qubits}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {IEEE}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, event_date = {24-08-2014 to 29-08-2014}, language = {30}, DOI = {10.1109/CPEM.2014.6898390}, stag_bib_extends_levelofaccess = {NA}, author = {Manninen, A.J. and Kemppinen, A. and Enrico, E. and Kataoka, M. and Lindstrom, T. and Zorin, A.B. and Lotkhov, S.V. and Khabipov, M. and M{\"o}tt{\"o}nen, M. and Lake, R.E. and Govenius, J. and Pekola, J.P. and Pashkin, Yu.A. and Meeson, P.J. and Astafiev, O.V.} } @Proceedings { RodriguezPLKKKHGCBABSUWW2014, title = {The EMRP project Metrology for III–V materials based high efficiency multi-junction solar cells}, journal = {29th Conference on Precision Electromagnetic Measurements (CPEM 2014)}, year = {2014}, month = {8}, number2 = {ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells}, keywords = {Nanoscale electrical measurement Multijunction solar cells standards high conversion efficiency III-V materials characterization}, misc2 = {EMRP A169: Call 2013 Energy II}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {25-08-2014 to 29-08-2014}, language = {30}, ISBN = {978-1-4799-2478-3}, ISSN = {no ISSN}, DOI = {10.1109/CPEM.2014.6898387}, stag_bib_extends_levelofaccess = {NA}, author = {Rodriguez, T. G. and Pollakowski, B. and Lackner, D. and Krupka, J. and Kienberger, F. and Kern, R. and Hoffmann, J. and Gambacorti, N. and Cuenat, A. and Baumgartner, H. and Almuneau, G. and Bounouh, A. and Sametoglu, F. and Usydus, L. and Winter, S. and Witt, F.} } @Article { FalkeLGLWGHHAHVSL2014, title = {A strontium lattice clock with 3 x 10\verb=^=-17 inaccuracy and its frequency}, journal = {New Journal of Physics}, year = {2014}, month = {7}, volume = {16}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {073023}, web_url = {http://iopscience.iop.org/1367-2630/16/7/073023}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, DOI = {10.1088/1367-2630/16/7/073023}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Falke, S and Lemke, N and Grebing, C and Lipphardt, B and Weyers, S and Gerginov, V and Huntemann, N and Hagemann, C and Al-Masoudi, A and Haefner, S and Vogt, S and Sterr, U and Lisdat, C} } @Article { , title = {ParametricAnalysisof Transient SkinHeating Induced byTerahertzRadiation}, journal = {Bioelectromagnetics}, year = {2014}, month = {7}, volume = {35}, number = {5}, number2 = {NEW07: THz Security: Microwave and terahertz metrology for homeland security}, pages = {314-323}, keywords = {human exposure to electromagnetic fields; Pennes bioheat equation; terahertz}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Zilberti, L. and Arduino, A. and Bottauscio, O. and Chiampi, M.} } @Article { , title = {High Order Explicit Solutions for the Transient Natural Convection of Incompressible Fluids in Tall Cavities}, journal = {Numerical Heat Transfer, Part A}, year = {2014}, month = {6}, day = {25}, volume = {66}, number = {not available}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {839–862}, keywords = {Matrix-inversion free CBS, Benchmark problem, Finite element method, tall cavity, unsteady oscillations, Real time}, web_url = {http://www.tandfonline.com/doi/abs/10.1080/10407782.2014.892389}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Taylor \& Francis}, address = {London}, language = {30}, ISSN = {1040-7782 print=1521-0634 online}, DOI = {10.1080/10407782.2014.892389}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Arpino, F. and Cortellessa, G. and Dell'Isola, M. and Massarotti, N. and Mauro, A.} } @Article { ElHayekNAGD2014, title = {A new method for aspherical surface fitting with large-volume datasets}, journal = {Precision Engineering}, year = {2014}, month = {6}, day = {19}, volume = {38}, number = {4}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {13}, keywords = {Aspherical surface fitting, Form metrology, Large data, Limited memory BFGS.}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, DOI = {10.1016/j.precisioneng.2014.06.004}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {El-Hayek, N and Nouira, H and Anwer, N and Gibaru, O and Damak, M} } @Article { , title = {Ordering dynamics in symmetric PS-b-PMMA diblock copolymer thin films during rapid thermal processing}, journal = {Journal of Materials Chemistry C}, year = {2014}, month = {6}, day = {7}, volume = {2}, number = {32}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {6655-6664}, web_url = {http://pubs.rsc.org/en/Content/ArticleLanding/2014/TC/c4tc00756e\#!divAbstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Royal Society of Chemistry}, address = {London UK}, language = {30}, ISSN = {0003-2654}, DOI = {10.1039/c4tc00756e}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No option selected}, author = {Perego, M. and Lupi, F.F. and Ceresoli, M. and Giammaria, T.J. and Seguini, G. and Enrico, E. and Boarino, L. and Antoniol, D. and Gianotti, V. and Sparnacci, K. and Laus, M.} } @Proceedings { , title = {TRANSIENT THERMAL ANALYSIS OF POROUS CAVITIES}, journal = {not available}, year = {2014}, month = {6}, day = {4}, volume = {not available}, number = {not available}, number2 = {SIB64: METefnet: Metrology for moisture in materials}, pages = {357-360}, keywords = {Finite element method, Time-periodic oscillating flow field, Heat transfer coefficient calculation.}, web_url = {http://www.thermacomp.com/uploads/Proceedings_ThermaComp2014_website.pdf}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Giannini Editore}, address = {Napoli}, event_place = {Lake Bled, Slovenia}, event_name = {3rd International Conference on Computational Methods for Thermal Problems}, event_date = {June 2-4, 2014}, language = {30}, ISBN = {978-88-7431-727-1}, ISSN = {not available}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arpino, F. and Cortellessa, G. and Massarotti, N. and Mauro, A.} } @Article { , title = {Towards reliable charge-mobility benchmark measurements for organic semiconductors}, journal = {Organic Electronics}, year = {2014}, month = {6}, volume = {15}, number = {6}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1263-1272}, keywords = {Mobility, Space-charge limited current, Injection-limited current, Charge-carrier mobility, Mobility benchmark}, web_url = {http://www.sciencedirect.com/science/article/pii/S1566119914000469}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, language = {30}, ISSN = {1566-1199}, DOI = {10.1016/j.orgel.2014.02.008}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Blakesley, JCB and Castro, FAC and Kylberg, WK and Dibb, GFAD and Valaskib, RV and Cremona, WC and Arantes, CA and Kim, JSK and Kim, JSK} } @Article { , title = {Mathematical modelling to support traceable dynamic calibration of pressure sensors}, journal = {Metrologia}, year = {2014}, month = {5}, day = {28}, volume = {51}, number = {3}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {1-22}, keywords = {Traceability, dynamic measurement, pressure sensor calibration, shock tube, drop-weight system}, web_url = {http://iopscience.iop.org/article/10.1088/0026-1394/51/3/326/meta}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing Ltd}, address = {Bristol}, language = {30}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/51/3/326}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Matthews, CM and Pennecchi, FP and Eichstadt, SE and Malengo, AM and Esward, TE and Smith, IS and Elster, CE and Knott, AK and Arrh{\'e}n, FA and Lakka, AL} } @Article { WoszczynaWGWWSWAT2014, title = {All-Carbon Vertical van der Waals Heterostructures: Non-destructive Functionalization of Graphene for Electronic Applications}, journal = {Wiley Online Library- Advanced Materials}, year = {2014}, month = {5}, day = {23}, volume = {26}, number = {28}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {1521-4095}, keywords = {graphene heterostructures,electric and electromagnetic transport, carbon nanomembrane, chemical functionalization,field-effect devices, molecular self-assembly, graphene-based nanosensors}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1002/adma.201400948}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Woszczyna, M. and Winter, A. and Grothe, M. and Willunat, A. and Wundrack, S. and Stosch, R. and Weimann, T. and Ahlers, F. and Turchanin, A.} } @Article { SchurrAP2014, title = {Magnetocapacitance and loss factor of GaAs quantum Hall effect devices}, journal = {Metrologica (BIPM \& IOP Publishing Ltd)}, year = {2014}, month = {5}, day = {13}, volume = {51}, number = {3}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, keywords = {magnetocapacitance, quantum Hall effect, loss factor}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, language = {English}, DOI = {10.1088/0026-1394/51/3/235}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Schurr, J and Ahlers, F and Pierz, K} } @Proceedings { GattoMonticoneTMFLBDABOG2014, title = {High performing SPS based on native NIR-emitting single colour centers in diamond}, journal = {Proc. SPIE 9136, Nonlinear Optics and Its Applications VIII; and Quantum Optics III}, year = {2014}, month = {5}, day = {1}, volume = {9136}, number = {8}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, web_url = {http://spie.org}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brussels, Belgium}, event_name = {Nonlinear Optics and Its Applications VIII; and Quantum Optics III}, event_date = {April 14, 2014}, language = {English}, DOI = {10.1117/12.2051714}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gatto Monticone, D and Traina, P and Moreva, E and Forneris, J and Levi, M and Brida, G and Degiovanni, I. P and Amato, G and Boarino, L and Olivero, P and Genovese, M} } @Article { GattoMonticoneTMFODTGBAG2014, title = {Native NIR-emitting single colour centres in CVD diamond}, journal = {New Journal of Physics}, year = {2014}, month = {5}, day = {1}, volume = {16}, number = {5}, number2 = {EXL02: SIQUTE: Single-photon sources for quantum technologies}, keywords = {diamond, photoluminescence, single defects, single photon sources, confocal microscopy}, web_url = {http://iopscience.iop.org/1367-2630}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Open excellence call}, language = {English}, ISSN = {1367-2630}, DOI = {10.1088/1367-2630/16/5/053005}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gatto Monticone, D. and Traina, P. and Moreva, E. and Forneris, J. and Olivero, P. and Degiovanni, I. P. and Taccetti, F. and Giuntini, L. and Brida, G. and Amato, G. and Genovese, M.} } @Inbook { StuerwaldAS2014, title = {Analyse und Minimierung von systematischen Messfehlern beim Einsatz von CGHs zur Asph{\"a}renpr{\"u}fung}, year = {2014}, month = {5}, day = {1}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {115-127}, keywords = {optical testing, holograms}, web_url = {http://www.shaker.eu/Online-Gesamtkatalog-Download/2015.03.28-23.14.28-89.244.96.77-rad71B15.tmp/3-8440-2124-8_INH.PDF}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, chapter = {17}, language = {German}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Stuerwald, Stephan and Asfour, Jean-Michel and Schmitt, Robert} } @Article { ElHayekNADG2014, title = {Comparison of tactile and chromatic confocal measurements of aspherical lenses for form metrology}, journal = {International Journal of Precision Engineering and Manufacturing}, year = {2014}, month = {5}, volume = {15}, number = {5}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {821 to 829}, keywords = {Aspherical surface, chromatic confocal probe, form metrology, L-BFGS method, profilometer, tactile probe}, web_url = {http://link.springer.com/article/10.1007/s12541-014-0405-y}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {2005-4602}, DOI = {10.1007/s12541-014-0405-y}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {El-Hayek, Nadim and Nouira, Hichem and Anwer, Nabil and Damak, Mohamed and Gibaru, Olivier} } @Article { , title = {Detecting multiparticle entanglement of Dicke states}, journal = {Phys. Rev. Lett.}, year = {2014}, month = {4}, day = {17}, volume = {112}, number = {15}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {155304}, keywords = {67.85.−d, 03.67.Bg, 03.67.Mn, 03.75.Mn}, web_url = {http://arxiv.org/abs/1403.4542v2}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.112.155304}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {L{\"u}cke, B and Peise, J and Vitagliano, G and Arlt, J and Santos, L and T{\'o}th, G and Klempt, C} } @Article { , title = {Evolution of lateral ordering in symmetric block copolymer thin films upon rapid thermal processing}, journal = {Nanotechnology}, year = {2014}, month = {4}, day = {15}, volume = {25}, number = {27}, number2 = {NEW01: TReND: Traceable characterisation of nanostructured devices}, pages = {10 PP}, keywords = {block copolymers, thermal stability, self-assembly, polystyrene-b-poly(methylmethacrylate), ordering}, web_url = {http://iopscience.iop.org/article/10.1088/0957-4484/25/27/275601/meta}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IOP}, address = {Bristol, UK}, language = {30}, DOI = {10.1088/0957-4484/25/27/275601}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Ceresoli, M. and Lupi, F.F. and Seguini, G. and Sparnacci, K. and Gianotti, V. and Antonioli, D. and Laus, M. and Boarino, L. and Perego, M.} } @Article { , title = {Thermal desorption mass spectrometer for mass metrology}, journal = {REVIEW OF SCIENTIFIC INSTRUMENTS 85, 045111 (2014)}, year = {2014}, month = {4}, day = {14}, volume = {85}, number = {85}, number2 = {SIB05: NewKILO: Developing a practical means of disseminating the new kilogram}, pages = {045111}, keywords = {Thermal, desorption, mass spectrometer, mass metrology}, web_url = {http://scitation.aip.org/docserver/fulltext/aip/journal/rsi/85/4/1.4870921.pdf?expires=1460456419\&id=id\&accname=2118383\&checksum=AC3FCE73DE77059689EE889598D57A63}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {AIP Publishing}, address = {Melville}, language = {30}, DOI = {10.1063/1.4870921}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Silvestri, Z and Azouigui, S and Bouhtiyya, S and Mac{\'e}, S and Plimmer, M D and Pinot, P and Tayeb-Chandoul, F and Hannachi, R} } @Article { ElHayekNDGA2014, title = {Reconstruction of freeform surfaces for metrology}, journal = {Journal of Physics: Conference Series 483 (2014) 012003}, year = {2014}, month = {4}, day = {7}, volume = {483}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, web_url = {http://iopscience.iop.org/1742-6596/483/1/012003}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {Online ISSN: 1742-6596}, DOI = {10.1088/1742-6596/483/1/012003}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {El-Hayek, N and Nouira, H and Damak, M and Gibaru, O and Anwer, N} } @Article { , title = {Determination of the association constant between the B domain of protein A and the Fc region of IgG}, journal = {Surface and Interface Analysis}, year = {2014}, month = {4}, day = {2}, volume = {46}, number = {10-11}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, pages = {689-692}, keywords = {biosensor; binding; 1FC2; antibody; association constant and Brownian's dynamics}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5500/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley}, address = {New Yotk}, language = {30}, DOI = {10.1002/sia.5500}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-4-2}, author = {Ansalone, P} } @Article { , title = {Recent advances in vacuum sciences and applications}, journal = {Journal of Physics D: Applied Physics}, year = {2014}, month = {3}, day = {27}, volume = {47}, number = {15}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, pages = {24}, keywords = {vacuum, surface, plasma, interface, nanoscience}, web_url = {http://iopscience.iop.org/article/10.1088/0022-3727/47/15/153001}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, address = {Bristol}, language = {30}, ISSN = {0022-3727}, DOI = {10.1088/0022-3727/47/15/153001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-3-27}, author = {Mozetič, M and Ostrikov, K and Ruzic, D.N and Curreli, D and Cvelbar, U and Tagliaferro, A and Conde, O. and Silvestre, A.J and Giapintzakis, J. and Buljan, M. and Radić, N. and Dražić, G. and Bernstorff, S. and Biederman, H. and Kyli{\'a}n, O. and Hanuš, J. and Miloševič, S. and Galtayries, A. and Dietrich, P. and Unger, W. and Sedlarik, V. and Stana-Kleinschek, K. and Drmota-Petrič, A. and Pireaux, J.J and Rogers, J.,.W and Anderle, M.} } @Article { , title = {Cation-mediated electrostatic interaction in collagen–integrin complex}, journal = {Surface and Interface Analysis}, year = {2014}, month = {3}, day = {21}, volume = {46}, number = {10-11}, number2 = {HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices}, pages = {693-697}, keywords = {boundary element method; linearized Poisson–Boltzmann equation; collagen; integrins; electrostatic complementarity; cell adhesion}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/sia.5431/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Wiley}, address = {New York}, language = {30}, DOI = {10.1002/sia.5431}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-3-21}, author = {Ansalone, P. and O. Bottauscio, O. and Manzin, A.} } @Thesis { , title = {Gonio-espectrofot{\'o}metro para medidas de BRDF de patrones de reflectancia y objetos gonio-aparentes}, year = {2014}, month = {3}, day = {18}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, keywords = {Gonio-spectrophotometer, BRDF, retroreflexion, diffuse reflectance standards, special effect coatings, absolute measurement, low-uncertainty, PCA}, web_url = {http://zaguan.unizar.es/record/15614}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {Tesis de la Universidad de Zaragoza}, address = {Zaragoza}, school = {Universidad de Zaragoza}, language = {112}, ISBN = {2254-7606}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {http://zaguan.unizar.es/record/15614}, author = {Ana Maria, Rabal} } @Article { , title = {Current Sensing Noise Thermometry: A Fast Practical Solution to Low Temperature Measurement}, journal = {Journal of Low Temperature Physics}, year = {2014}, month = {3}, day = {18}, volume = {175}, number = {5-6}, number2 = {SIB01: InK: Implementing the new kelvin}, pages = {764-775}, keywords = {Johnson noise, Fixed point device, Precision, SQUID}, web_url = {http://link.springer.com/article/10.1007/s10909-014-1147-z}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {Springer US}, address = {New York}, language = {30}, ISSN = {1573-7357}, DOI = {10.1007/s10909-014-1147-z}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Casey, A and Arnold, F and Levitin, L V and Lusher, C P and Nyeki, J and Saunders, J and Shibahara, A and van der Vliet, H and Yager, B and Drung, D and Schurig, Th and Batey, G and Cuthbert, M N and Matthews, A J} } @Article { , title = {Performance metrics for testing statistical calculations in interlaboratory comparisons}, journal = {Advances in Production Engineering \& Management}, year = {2014}, month = {3}, day = {12}, volume = {9}, number = {1}, number2 = {NEW06: TraCIM: Traceability for computationally-intensive metrology}, pages = {44-52}, keywords = {Interlaboratory comparisons, Data generator, Software validation}, tags = {MAT}, web_url = {http://apem-journal.org/Archives/2014/Abstract-APEM9-1_044-052.html}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Production Engineering Institute (PEI), University of Maribor}, address = {Maribor}, language = {30}, ISSN = {1854-6250}, DOI = {10.14743/apem2014.1.175}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Acko, BA and Sluban, BS and Tasic, TT and Brezovnik, SB} } @Article { NouiraSEDDA2014, title = {Setup of a high-precision profilometer and comparison of tactile and optical measurements of standards}, journal = {Measurement Science and Technology}, year = {2014}, month = {3}, day = {5}, volume = {25}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {profilometer, atomic force microscopy, confocal chromatic probe, tactile/inductive probe, error sources, dimensional and mechanical metrology, evaluation}, web_url = {http://iopscience.iop.org/0957-0233/25/4/044011/article?fromSearchPage=true}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {Online ISSN: 1742-6596}, DOI = {10.1088/0957-0233/25/4/044011}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nouira, H and Salgado, J-A and El-Hayek, N and Ducourtieux, S and Delvall{\'e}e, A and Anwer, N} } @Article { , title = {Towards quantitative modelling of surface deformation of polymer micro-structures under tactile scanning measurement}, journal = {Measurement Science and Technology}, year = {2014}, month = {3}, day = {5}, volume = {25}, number = {4}, number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials}, pages = {044010}, web_url = {http://iopscience.iop.org/article/10.1088/0957-0233/25/4/044010?fromSearchPage=true}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IOP Publishing}, address = {London, UK}, language = {30}, ISSN = {0957-0233}, DOI = {10.1088/0957-0233/25/4/044010}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Li, ZL and Brand, UB and Ahbe, TA} } @Article { PottieLSCSGBA2014, title = {In-line extraction of an ultrastable frequency signal over an optical fiber link}, journal = {Journal of the Optical Society of America B}, year = {2014}, month = {3}, volume = {31}, number = {4}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {678}, keywords = {optical frequency transfer, optical fiber}, web_url = {https://www.osapublishing.org/josab/fulltext.cfm?uri=josab-31-4-678\&id=281177}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, publisher = {The Optical Society}, language = {30}, ISSN = {0740-3224, 1520-8540}, DOI = {10.1364/JOSAB.31.000678}, stag_bib_extends_levelofaccess = {NA}, author = {Pottie, P.E. and Lopez, O. and Santarelli, G. and Chardonnet, C. and Stefani, F. and Guellati-Khelifa, S. and Bercy, A. and Amy-Klein, A.} } @Proceedings { , title = {Rapid determination of the photometric bidirectional scatter distribution function by use of a near field goniophotometer}, journal = {PROCEEDINGS OF SPIE VOLUME 9018: Measuring, Modeling, and Reproducing Material Appearance}, year = {2014}, month = {2}, day = {24}, volume = {9018}, number = {NA}, number2 = {IND52: XD Reflect: Multidimensional reflectometry for industry}, pages = {8 pages / Article no. 901803}, keywords = {bidirectional reflectance distribution function, near-field goniophotometry, optical metrology, material appearance characterization}, web_url = {http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835519}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {SPIE}, address = {Bellingham}, event_place = {San Francisco}, event_name = {Measuring, Modeling, and Reproducing Material Appearance}, event_date = {2 February 2014}, language = {30}, ISBN = {NA}, ISSN = {NA}, DOI = {10.1117/12.2035958}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Leloup, F.B. and De Ketelaere, W. and Audenaert, J. and Hanselaer, P.} } @Article { , title = {Non-existence of pure S and P-polarized surface waves at the interface between a perfect dielectric and a real metal.}, journal = {Physical Review A}, year = {2014}, month = {2}, day = {19}, volume = {89}, number = {2}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {1-8}, web_url = {http://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.023834}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {American Physical Society (APS)}, address = {Maryland}, language = {30}, ISSN = {1050-2947}, DOI = {10.1103/PhysRevA.89.023834}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {El Gawhary, OEG and Adam, AA and Urbach, HPU} } @Article { AvellaGSBCG2014, title = {Separable Schmidt modes of a nonseparable state}, journal = {PHYSICAL REVIEW A}, year = {2014}, month = {2}, day = {7}, volume = {89}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {023808 [1-8]}, web_url = {http://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.023808}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {1050-2947}, DOI = {10.1103/PhysRevA.89.023808}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Avella, A. and Gramegna, M. and Shurupov, A. and Brida, G. and Chekhova, M. and Genovese, M.} } @Article { WanGWSALHLHS2014, title = {Precision spectroscopy by photon-recoil signal amplification}, journal = {Nature Communications}, year = {2014}, month = {1}, day = {30}, volume = {5}, number = {3096}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, keywords = {Physical sciences, atomic and molecular physics, optical physics}, web_url = {http://www.nature.com/ncomms/2014/140130/ncomms4096/full/ncomms4096.html}, web_url2 = {http://arxiv.org/abs/1309.7033}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, DOI = {10.1038/ncomms4096}, extern = {1}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Wan, Y and Gebert, F and W{\"u}bbena, J.B and Scharnhorst, N and Amairi, S and Leroux, I.D and Hemmerling, B and L{\"o}rch, N and Hammerer, K and Schmidt, P.O} } @Article { , title = {Line-narrowing effects in the near-infrared spectrum of water and precision determination of spectroscopic parameters}, journal = {J . Chem. Phys}, year = {2014}, month = {1}, day = {24}, volume = {140}, number2 = {SIB01: InK: Implementing the new kelvin}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1063/1.4862482}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Amodio, Pasquale and Moretti, Luigi and Castrillo, Antonio and Gianfrani, Livio} } @Article { , title = {Tip-enhanced Raman Spectroscopy – 1 An Interlaboratory Reproducibility and Comparison Study}, journal = {Journal of Raman Spectroscopy}, year = {2014}, month = {1}, day = {9}, volume = {45}, number = {1}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {22-31}, keywords = {tip-enhanced Raman spectroscopy, interlaboratory comparison study, thiophenol self- assembled monolayer, spectra interpretation, metrology}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/jrs.4423/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Wiley Online}, address = {Hoboken}, language = {30}, ISSN = {0377-0486}, DOI = {10.1002/jrs.4423}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1}, author = {Blum, C. and Opilik, L. and Atkin, J.M. and Braun, K. and Kammer, S.B and Kravtsov, V. and Kumar, N. and Lemeshko, S. and Li, J.F and Luszcz, K. and Makeki, T. and Meixner, A.J. and Minne, S. and Raschke, M.B. and Ren, B. and Rogalski, J. and Roy, D. and Stephanidis, B. and Wang, X. and Zhang, D. and Zhong, J.H. and Zenobi, R.} } @Article { MonteGAKEOH2014, title = {Radiometric calibration of the in-flight blackbody calibrationsystem of the GLORIA interferometer}, journal = {Atmos. Meas. Tech}, year = {2014}, volume = {7}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {Radiation Thermometry, Radiance, Remote Sensing, Vacuum, Emissivity}, web_url = {http://www.atmos-meas-tech.net/7/13/2014/amt-7-13-2014.html}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, DOI = {10.5194/amt-7-13-2014}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Gutschwager, B. and Adibekyan, A. and Kehrt, M. and Ebersoldt, A. and Olschewski, F. and Hollandt, J.} } @Article { PaetzeltABPS2014, title = {Surface Patterning by Local Plasma Jet Sacrificial Oxidation of Silicon}, journal = {Plasma Processes and Polymers}, year = {2014}, volume = {10}, number = {5}, number2 = {SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies}, keywords = {plasma jet, silicon oxides; surface modification; thin films}, web_url = {http://onlinelibrary.wiley.com/journal/10.1002/(ISSN)1612-8869}, web_url2 = {http://onlinelibrary.wiley.com/doi/10.1002/ppap.201200099/abstract}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {English}, ISSN = {1612-8869}, DOI = {10.1002/ppap.201200099}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Paetzelt, H. and Arnold, T. and B{\"o}hm, G. and Pietag, F. and Schindler, A.} } @Proceedings { Margolis2014, title = {International Timescales with Optical Clocks}, journal = {Proceedings of European Frequency and Time Forum \& International Frequency Control Symposium (EFTF/IFC)}, year = {2014}, number2 = {SIB55: ITOC: International timescales with optical clocks}, pages = {908-911}, keywords = {geodesy, international timescales, optical clock, redefinition of the second, time and frequency transfer}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6702183}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Prague, Czech Republic}, event_name = {European Frequency and Time Forum \& International Frequency Control Symposium (EFTF/IFC)}, event_date = {21 - 25 July 2013}, language = {English}, DOI = {10.1109/EFTF-IFC.2013.6702183}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Margolis, H. and Godun, R. and Gill, P. and Johnson, L. and Shemar, L. and Whibberley, P. and Calonico, D. and Levi, F. and Lorini, L. and Pizzocaro, M. and Delva, P. and Bize, S. and Achkar, J. and Denker, H. and Timmen, L. and Voigt, C. and Falke, S. and Piester, D. and Lisdat, C. and Sterr, U. and Vogt, S. and Weyers, S. and Gersl, J. and Lindvall, T. and Merimaa, M.} } @Proceedings { KummeTRBGA2014, title = {Force traceability within the meganewton range}, journal = {Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque}, year = {2014}, number2 = {SIB63: Force: Force traceability within the meganewton range}, pages = {2}, keywords = {Force, Build-up Systems, Mega Newton}, web_url = {http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-027.pdf}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Cape Town, Republic of South Africa}, event_name = {IMEKO 22nd TC3, 15th TC5 and 3rd TC22 International Conferences}, event_date = {3 to 5 February}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kumme, R. and Tegtmeier, F. and R{\"o}ske, D. and Barthel, A. and Germak, A. and Averlant, P.} } @Article { SvecCSAWCMPBTGdT2014_2, title = {Ionising radiation metrology for the metallurgical industry}, journal = {International Journal of Metrology and Quality Engineering}, year = {2014}, volume = {5}, number = {3}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, pages = {301}, keywords = {Ionising radiation measurements / interlaboratory comparisons / EURAMET / EMRP}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {EDP Sciences}, language = {30}, ISSN = {2107-6839, 2107-6847}, DOI = {10.1051/ijmqe/2014010}, stag_bib_extends_levelofaccess = {NA}, author = {Svec, A. and Carconi, P. and Sochor, V. and Arnold, D. and W{\"a}tjen, U. and Crespo, T. and Mejuto, M. and Peyres, V. and Burda, O. and Tzika, F. and Garc{\'i}a-Tora{\~n}o, E. and De Felice, P. and Tecl, J.} } @Proceedings { AckoM2014, title = {Temperature-invariant material standard for monitoring performance of machine tools}, journal = {Journal of Trends in the Development of Machinery and Associated Technology}, year = {2014}, volume = {18}, number = {1}, number2 = {IND62: TIM: Traceable in-process dimensional measurement}, pages = {191 to 194}, keywords = {In-process measurement, traceability, standard of measurement}, web_url = {http://www.tmt.unze.ba/journal2014.php}, misc = {A169}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, event_place = {Budapest, Hungary}, event_name = {”Trends in the Development of Machinery and Associated Technology” TMT 2014}, event_date = {10 - 12 September 2014}, language = {English}, ISSN = {ISSN 2303-4009 (online) ISSN 1840-4944}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Acko, Bojan and Milfelner, Matjaz} } @Proceedings { , title = {Ultrastable Low-Noise Current Amplifier}, journal = {Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR}, year = {2014}, number2 = {SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere}, pages = {656-657}, keywords = {Ammeters, calibration, current measurement, measurement uncertainty, precision measurements}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Rio de Janeiro}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {24-29 August 2014}, language = {30}, ISBN = {978-1-4799-2478-3}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Drung, D. and Krause, Ch. and Becker, U. and Scherer, H. and Ahlers, F. J.} } @Proceedings { OzturkKKMBCATA2014, title = {ERROR ANALYSIS IN WAVEFORMS SYNTHESIZED WITH A COMBINED JOSEPHSON SYSTEM FOR AC COMPONENT CHARACTERIZATION}, journal = {CPEM 2014 Digest}, year = {2014}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, pages = {734 - 735}, keywords = {analog to digital converter, error analysis, Josephson voltage standards, sampling techniques}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6898595\&refinements\%3D4270696875\%26queryText\%3DCPEM+2014}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Rio de Janeiro, Brazil}, event_name = {29th Conference on Precision Electromagnetic Measurements}, event_date = {24 - 29 August 2014}, language = {English}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898595}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {{\"O}zt{\"u}rk, T. C. and Kohlmann, J. and Kieler, O. and M{\"o}hring, T. and Behr, R. and \c{C}aycı, H. and Arifovi\c{c}, M. and Turhan, S. and Ata, L.D.} } @Article { , title = {Spectral properties of molecular iodine in absorption cells filled to specified saturation pressure}, journal = {Applied Optics}, year = {2014}, volume = {53}, number = {31}, number2 = {IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom}, pages = {7435-7441}, keywords = {spectroscopy, absorbtion, laser stabilisation, metrological instrumentation}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, language = {30}, DOI = {10.1364/AO.53.007435}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Hrabina, Jan and Šarbort, Martin and Acef, Ouali and Du Burck, Fr{\'e}d{\'e}ric and Chiodo, Nicola and Hol{\'a}, Miroslava and Č{\'i}p, Ondřej and Lazar, Josef} } @Proceedings { , title = {Assessment of uncalibrated light attenuation filters constructed from industrial woven wire meshes for use in photovoltaic research.}, journal = {EU PVSEC Proceedings 2014}, year = {2014}, number2 = {ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification}, pages = {3214-3218}, keywords = {light attenuation, uncalibrated filters, meshes, IEC 61853}, misc2 = {EMRP A169: Call 2013 Energy II}, event_place = {Amsterdam}, event_name = {29th European PV Solar Energy Conference and Exhibition}, event_date = {22.-26.9.2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Adri{\'a}n, A. and Lancia, Santamar{\'i}a and Bardizza, Giorgio and M{\"u}llejans, Harald} } @Manual { , title = {Good Practice Guide: Guidelines for High Temperature Nanoindentation}, year = {2014}, number2 = {IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures}, keywords = {nanoindentation indenter geometry frame compliance}, web_url = {http://projects.npl.co.uk/T3D/publications.html}, misc2 = {EMRP A169: Call 2010 Industry}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Maxwell, A. and Alvarez, L.M.} } @Proceedings { , title = {Towards Quantum Resistance Metrology Based on Graphene}, journal = {The EMRP Project GraphOhm - Towards Quantum Resistance Metrology Based on Graphene}, year = {2014}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {548-549}, keywords = {Measurement standards, resistance, quantum hall effect, graphene, C, Calibration, EMRP project GraphOhm, Electrical resistance measurement, Hall effect devices, JRP, Materials, Metrology, Resistance, Standards, electric resistance measurement, electrical measurement, intrinsically referenced resistance standard disse, joint research project, quantum resistance metrology standard, semiconductor quantum Hall device}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898502}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_date = {24-29 Aug. 2014}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898502}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Ahlers, F. and Kučera, J. and Poirier, W. and Jeanneret, B. and Satrapinski, A. and Tzalenchuk, A. and Vrabček, P. and Bergsten, T. and Hwang, C. and Yakimova, R. and Kubatkin, S.} } @Proceedings { , title = {Breakdown of the quantum Hall effect in epitaxial graphene}, journal = {Breakdown of the quantum Hall effect in epitaxial graphene}, year = {2014}, number2 = {SIB51: GraphOhm: Quantum resistance metrology based on graphene}, pages = {40-41}, keywords = {Current measurement,Electric breakdown,Electrical resistance measurement,Graphene,Hall effect,Hall effect devices,Resistance,SiC-C,Silicon carbide,carrier density,current density,electric breakdown,graphene,magnetic field,magnetic fields,measurement standards,phase space,polymer gated epitaxial graphene,polymers,quantum Hall effect,quantum Hall effect breakdown,quantum resistance standard,silicon compounds,wide band gap semiconductors}, web_url = {http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898248}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, publisher = {IEEE}, event_place = {Rio de Janeiro}, event_name = {CPEM2014}, event_date = {24-29 Aug. 2014}, language = {30}, ISBN = {978-1-4799-2479-0}, ISSN = {0589-1485}, DOI = {10.1109/CPEM.2014.6898248}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Janssen, T.J.B.M. and Rozhko, S. and Tzalenchuk, A. and Alexander-Webber, J.A. and Nicholas, R.J.} } @Article { , title = {Simple-design ultra-low phase noise microwave frequency synthesizers for high-performing Cs and Rb vapor cell atomic clocks}, journal = {Review of Scientific Intruments}, year = {2014}, volume = {86}, number = {--}, number2 = {IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications}, pages = {094707}, keywords = {syntheis chain, vapor cell atomic clocks, Dick effect}, web_url = {http://scitation.aip.org/content/aip/journal/rsi/86/9/10.1063/1.4929384}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {America Institue of Physics}, address = {--}, language = {30}, ISSN = {--}, DOI = {10.1063/1.4929384}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Francois, B and Calosso, C E and Abdel Hafiz, M and Micalizio, S and Boudot, R} } @Article { , title = {Linear mixed models: GUM and beyond}, journal = {Measurement Science Review}, year = {2014}, volume = {14}, number = {2}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {52-61}, keywords = {linear mixed models, uncertainty, GUM, ANOVA, random effects}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {De Gruyter}, language = {30}, DOI = {10.2478/msr-2014-0009}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arendack{\'a}, B and T{\"a}ubner, A and Eichst{\"a}dt, S and Bruns, Th and Elster, C} } @Proceedings { , title = {MODEL PARAMETER IDENTIFICATION FROM MEASUREMENT DATA FOR DYNAMIC TORQUE CALIBRATION}, year = {2014}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, keywords = {model parameter identification dynamic torque calibration dynamic measurement mechanical model}, web_url = {www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-018.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {International Measurement Conferderation}, address = {Budapest}, event_place = {Cape Town, Republic of South Africa}, event_name = {Joint IMEKO Conference TC3, TC5 \& TC22}, event_date = {03-05, February, 2014}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Klaus, L. and Arendack{\'a}, B. and Kobusch, M. and Bruns, Th.} } @Proceedings { , title = {Time-Domain Electromagnetic Interference Measurement System for intermittent disturbances}, journal = {2014 International Symposium on Electromagnetic Compatibility}, year = {2014}, volume = {1}, number = {1}, number2 = {IND60: EMC: Improved EMC test methods in industrial environments}, pages = {833-837}, keywords = {electromagnetic interference; conducted emissions, time-domain measurement; discret fast Fourier transform (DFFT).}, web_url = {http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=\&arnumber=6931019\&isnumber=6930855}, misc2 = {EMRP A169: Call 2012 Metrology for Industry (II)}, publisher = {IEEE}, address = {Gothenburg}, event_place = {Gothenburg}, event_name = {2014 International Symposium on Electromagnetic Compatibility}, event_date = {01-09-2014 to 04-09-2014}, language = {30}, ISBN = {14696796}, ISSN = {2325-0356}, DOI = {10.1109/EMCEurope.2014.6931019}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, stag_bib_extends_persistent_identifier = {14696796}, author = {Costa, Gerard and Pous, Marc and Atienza, Andreu and Silva, Ferran} } @Article { , title = {Design and uncertainty assessment of a setup for calibration of microfluidic devices down to 5 nL min−1}, journal = {Measurement Science and Technology}, year = {2013}, month = {12}, day = {13}, volume = {25}, number2 = {HLT07: MeDD: Metrology for drug delivery}, pages = {1-9}, keywords = {microfluidics, micro-flow, flow measurement, front tracking, meniscus, uncertainty, calibration}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {30}, DOI = {10.1088/0957-0233/25/1/015301}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Ahrens, M. and Klein, S. and Nestler, B. and Damiani, C.} } @Article { , title = {Spontaneous symmetry breaking in spinor Bose-Einstein condensates}, journal = {Phys. Rev. A}, year = {2013}, month = {11}, day = {19}, volume = {88}, number = {5}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {053624}, keywords = {67.85.Fg, 03.75.Lm, 03.75.Mn, 11.30.Qc}, web_url = {http://arxiv.org/abs/1309.0424}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1094-1622}, DOI = {10.1103/PhysRevA.88.053624}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Scherer, M and L{\"u}cke, B and Peise, J and Topic, O and Gebreyesus, G and Deuretzbacher, F and Ertmer, W and Santos, L and Klempt, C and Arlt, J J} } @Article { , title = {Total electron scattering cross sections of pyrimidine}, journal = {Physical Review A}, year = {2013}, month = {11}, day = {14}, volume = {88}, number = {032702}, number2 = {SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy}, keywords = {Electron scattering cross sections, DNA constituents}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, ISSN = {1050-2947}, DOI = {10.1103/PhysRevA.88.032702}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Baek, W. Y. and Arndt, A. and Bug, M. U. and Rabus, H. and Wang, M.} } @Proceedings { , title = {Roughness and contamination characterizations of worn surfaces}, journal = {Proceedings of the 16th International Congress of Metrology}, year = {2013}, month = {10}, day = {7}, volume = {2013}, number2 = {IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces}, pages = {08001}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_08001.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {EDP Sciences}, address = {Paris}, event_place = {Paris, France}, event_name = {16th International Congress of Metrology}, event_date = {07-10-2013 to 10-10-2013}, language = {30}, DOI = {10.1051/metrology/201308001}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Silvestri, ZS and Azouigui, SA and Pinot, PP and Gee, MG} } @Proceedings { , title = {Novel mathematical and statistical approaches to uncertainty evaluation in the context of regression and inverse problems}, journal = {16th International Congress of Metrology}, year = {2013}, month = {10}, day = {7}, volume = {-}, number = {2013}, number2 = {NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation}, pages = {04003}, keywords = {-}, tags = {MAT}, web_url = {http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_04003.pdf}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {EDP Sciences}, address = {Les Ulis \& London}, event_place = {Paris}, event_name = {16th International Congress of Metrology}, event_date = {07-10-2013 to 10-10-2013}, language = {30}, ISBN = {-}, ISSN = {-}, DOI = {10.1051/metrology/201304003}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Elster, C and Klauenberg, K and B{\"a}r, M and Allard, A and Fischer, N and Kok, G and van der Veen, A and Harris, P and Cox, M and Smith, I and Cowen, S and Wilson, P and Ellison, S} } @Article { , title = {HiTeMS: A pan-European project to solve high temperature measurement problems in industry}, journal = {AIP Conf. Proc. 1552}, year = {2013}, month = {9}, day = {11}, volume = {8}, number = {958}, number2 = {ENG01: GAS: Characterisation of Energy Gases}, pages = {958-963}, keywords = {Industrial high temperature measurement, radiation thermometry, high temperature thermocouples, high temperature fixed points}, web_url = {http://www.npl.co.uk/content/ConPublication/5950}, misc2 = {EMRP A169: Call 2009 Energy}, publisher = {AIP Publishing LLC}, address = {1305 Walt Whitman Rd Suite 300, Melville, NY 11747, United States}, language = {30}, ISSN = {978-0-7354-1178-4}, DOI = {10.1063/1.4821414}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31}, author = {Machin, G and Anhalt, K and Edler, F and Pearce, J and Sadli, M and Strnad, R and Veulban, E} } @Article { , title = {Comparative measurements on atomic layer deposited Al2O3 thin films using ex situ table top and mapping ellipsometry, as well as X-ray and VUV reflectometry}, journal = {Thin Solid Films}, year = {2013}, month = {8}, day = {31}, volume = {541}, number = {Current Trends in Optical and X-Ray Metrology of Advanced Materials for Nanoscale Devices III}, number2 = {IND07: Thin Films: Metrology for the manufacturing of thin films}, pages = {131-135}, keywords = {Spectroscopic ellipsometry, X-ray reflectometry, VUV reflectometry, Atomic layer deposition, Ultra-thin layer}, web_url = {http://www.sciencedirect.com/science/article/pii/S0040609013000175}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Elsevier}, address = {Amsterdam, Netherlands}, language = {30}, ISSN = {0040-6090}, DOI = {10.1016/j.tsf.2012.12.091}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Petrik, PP and Gumprecht, TG and Nutsch, AN and Roeder, GR and Lemberger, ML and Juhasz, GJ and Polgar, OP and Major, CM and Kozma, PK and Janosov, MJ and Fodor, BF and Agocs, EA and Fried, MF} } @Proceedings { , title = {Microwave characterization of large area graphene using a TE011 dielectric resonator}, journal = {Proceedings of Microwaves, Millimeter and Submillimeter Waves}, year = {2013}, month = {8}, day = {13}, number2 = {NEW08: MetNEMS: Metrology with/for NEMS}, pages = {427-429}, keywords = {graphene, dielectrics, resonators, microwave, Substrates, Microwave theory and techniques, Resistance, Apertures, Electric fields}, web_url = {http://ieeexplore.ieee.org/document/6622095/?arnumber=6622095}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {IEEE}, address = {Melville}, event_place = {Kharkov, Ukraine}, event_name = {International Kharkov Symposium on Physics and Engineering of Microwaves, Millimeter and Submillimeter Waves}, event_date = {23-06-2013 to 28-06-2013}, language = {30}, ISBN = {978-1-4799-1068-7}, DOI = {10.1109/MSMW.2013.6622095}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Shaforost, O and Wang, K and Adabi, M and Guo, Zh and Hao, L and Gallop, J and Klein, N} } @Article { PanchalILYAK2013, title = {Magnetic Scanning Probe Calibration Using Graphene Hall Sensor}, journal = {IEEE TRANSACTIONS ON MAGNETICS}, year = {2013}, month = {7}, volume = {49}, number = {7}, number2 = {IND08: MetMags: Metrology for Advanced Industrial Magnetics}, keywords = {Epitaxial graphene, Hall sensor, Kelvin probe force microscopy (KPFM), magnetic probe calibration}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6558904}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, ISSN = {0018-9464}, DOI = {10.1109/TMAG.2013.2243127}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Panchal, Vishal and Iglesias-Freire, {\'O}scar and Lartsev, Arseniy and Yakimova, Rositza and Asenjo, Agustina and Kazakova, Olga} } @Article { GeorgJCESPBHVA2013, title = {Dosimetry auditing procedure with alanine dosimeters for light ion beam therapy}, journal = {Radiotherapy and Oncology}, year = {2013}, month = {7}, volume = {108}, number = {1}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {99-106}, keywords = {Alanine; Audit; Carbon ions; Dosimetry; Protons}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {Elsevier BV}, language = {30}, ISSN = {0167-8140}, DOI = {10.1016/j.radonc.2013.04.029}, stag_bib_extends_levelofaccess = {NA}, author = {Georg, D. and J{\"a}kel, O. and Chaudhri, N. and Ecker, S. and Sharpe, P. and Palmans, H. and Bassler, N. and Herrmann, R. and Vatnitsky, S. and Ableitinger, A.} } @Article { TrainaGACCDBG2013, title = {Review on recent groundbreaking experiments on quantum communication with orthogonal states}, journal = {Quantum Matter}, year = {2013}, month = {6}, day = {1}, volume = {2}, number = {3}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {153-166}, web_url = {http://www.ingentaconnect.com/content/asp/qm/2013/00000002/00000003/art00001}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {2164-7615}, DOI = {10.1166/qm.2013.1041}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Traina, P. and Gramegna, M. and Avella, A. and Cavanna, A. and Carpentras, D. and Degiovanni, I. and Brida, G. and Genovese, M.} } @Article { , title = {Feedback control of trapped coherent atomic ensembles}, journal = {Phys. Rev. Lett.}, year = {2013}, month = {5}, day = {23}, volume = {110}, number = {21}, number2 = {EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors}, pages = {210503}, keywords = {03.67.-a, 03.65.Yz, 37.30.+i}, web_url = {http://arxiv.org/abs/1207.3203}, misc2 = {EMRP A169: Call 2012 Open excellence call}, publisher = {American Physical Society}, address = {College Park, MD}, language = {30}, ISSN = {1079-7114}, DOI = {10.1103/PhysRevLett.110.210503}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Vanderbruggen, T and Kohlhaas, R and Bertoldi, A and Bernon, S and Aspect, A and Landragin, A and Bouyer, P} } @Article { , title = {Reducing effects of thermal noise in optical cavities}, journal = {Applied Physics B}, year = {2013}, month = {5}, day = {18}, volume = {113}, number = {2013}, number2 = {SIB04: Ion Clock: High-accuracy optical clocks with trapped ions}, pages = {233-242}, web_url = {http://download.springer.com/static/pdf/221/art\%253A10.1007\%252Fs00340-013-5464-8.pdf?auth66=1386329855_1ff0f343cbf51cf62e1a31453bdb0df2\&ext=.pdf}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1007/s00340-013-5464-8}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Amairi, S. and Legero, T. and Kessler, T. and Sterr, U. and W{\"u}bbena, J. and Mandel, O. and Schmidt, O.} } @Proceedings { , title = {Random effects ANOVA in uncertainty evaluation}, year = {2013}, month = {5}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {39-42}, keywords = {random effects, ANOVA, type A uncertainty}, web_url = {http://www.measurement.sk/M2013/doc/proceedings/039_Arendacka-1.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Institute of Measurement Science}, address = {Bratislava}, event_place = {Smolenice, Slovakia}, event_name = {9th International Conference on Measurement}, event_date = {27-05-2013 to 30-05-2013}, language = {30}, ISBN = {978-80-969-672-5-4}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arendack{\'a}, B and T{\"a}ubner, A. and Eichst{\"a}dt, S. and Bruns, T. and Elster, C.} } @Article { AcerbiDTZ2013, title = {Fast Active Quenching Circuit for Reducing Avalanche Charge and Afterpulsing in InGaAs/InP Single-Photon Avalanche Diode}, journal = {Quantum Electronics, IEEE Journal of}, year = {2013}, month = {4}, day = {30}, volume = {49}, number = {7}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {563-569}, keywords = {Afterpulsing, avalanche photodiode, avalanche charge, optical crosstalk, quenching circuit, single photon, singlephoton avalanche diode}, web_url = {http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6510432}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, language = {English}, ISSN = {0018-9197}, DOI = {10.1109/JQE.2013.2260726}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Acerbi, F. and Della Frera, A. and Tosi, A. and Zappa, F.} } @Article { RossommeDMBLSAAPTK2013, title = {Fluence correction factors for graphite calorimetry in a low-energy clinical proton beam: I. Analytical and Monte Carlo simulations}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {4}, day = {30}, volume = {58}, number = {10}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {3481-3499}, keywords = {graphite calorimetry, monte carlo, fluence correction, proton beam}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, publisher = {IOP Publishing}, language = {30}, ISSN = {0031-9155, 1361-6560}, DOI = {10.1088/0031-9155/58/10/3481}, stag_bib_extends_levelofaccess = {NA}, author = {Rossomme, S and Dobrovodsk{\'y}, J and Martinkovič, J and Bassler, N and L{\"u}hr, A and Shipley, D and Andreo, P and Al-Sulaiti, L and Palmans, H and Thomas, R A S and Kacperek, A} } @Article { AntonKKVGZM2013, title = {Difference in the relative response of the alanine dosimeter to megavoltage x-ray and electron beams}, journal = {Physics in Medicine and Biology}, year = {2013}, month = {3}, day = {24}, volume = {58 (2013)}, number = {10}, number2 = {HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields}, pages = {3259 - 3282}, keywords = {EPR, alanine, response, dosimetry, absorbed dose to water, megavoltage x-rays, high energy electrons}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, language = {English}, ISSN = {0031-9155 (print) ; 1361-6560 (online)}, DOI = {10.1088/0031-9155/58/10/3259}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Anton, Mathias and Kapsch, Ralf-Peter and Krauss, Achim and Voigts-Rhetz, Philip von and Giessen-Friedberg, Giessen and Zink, Klemens and McEwen, Malcolm} } @Article { , title = {The use of Raman spectroscopy to characterize the carbon materials found in Amazonian anthosoils}, journal = {Journal of Raman Spectroscopy}, year = {2013}, month = {2}, day = {1}, volume = {44}, number = {2}, number2 = {NEW02: Raman: Metrology for Raman Spectroscopy}, pages = {283–289}, keywords = {soil science; Terra Preta de {\'I}ndio; carbon}, web_url = {http://onlinelibrary.wiley.com/doi/10.1002/jrs.4191/abstract}, misc2 = {EMRP A169: Call 2011 Metrology for New Technologies}, publisher = {Wiley}, address = {Hobeken}, language = {30}, ISSN = {0377-0486}, DOI = {10.1002/jrs.4191}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-2-28}, author = {Ribeiro-Soares, j. and Can\c{c}ado, L.G and Falc{\~a}ob, N.P.S and Martins Ferreirac;, E.H and Achetec, C.A and Jorio, A} } @Article { GutschwagerTMARFH2013, title = {Comparison of the radiation temperature scales of the PTB and the NPL in the temperature range from −57 \(^{\circ}\)C to 50 \(^{\circ}\)C}, journal = {Measurement Science and Technology}, year = {2013}, volume = {24}, number = {6}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {065002 (9pp)}, keywords = {radiation thermometry, infrared, radiometer, blackbody, low temperature,}, web_url = {http://m.iopscience.iop.org/0957-0233/24/6/065002/pdf/0957-0233_24_6_065002.pdf}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, ISSN = {0957-0233/13/065002+09$33.00}, DOI = {10.1088/0957-0233/24/6/065002}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Gutschwager, B. and Theocharous, E. and Monte, C. and Adibekyan, A. and Reiniger, M. and Fox, N. and Hollandt, J.} } @Proceedings { SeifertABBB2013_2, title = {Qualit{\"a}tsgesichertes Laserstrahlhaerten durch mobile Temperaturkalibrierung (Quality assured laser heat treatment by mobile temperature calibration)}, journal = {Proceedings Fachtagung Temperatur 2013}, year = {2013}, number2 = {IND01: HiTeMS: High temperature metrology for industrial applications (>1000 \(^{\circ}\)C)}, keywords = {laser heat treatment, fixed point, calibration, steel, temperature control}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Berlin, Germany}, event_name = {Fachtagung Temperatur 2013}, event_date = {5 - 6 June 2013}, language = {German}, ISSN = {3-9810021-8-0}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Seifert, M. and Anhalt, K. and Baltruschat, C. and Bonss, S. and Brenner, B.} } @Proceedings { AlexandrescuV2013, title = {On-site Power Quality Measurements in a Photovoltaic System Connected with the Distribution Network}, journal = {Proceedings of The 9th International Conference on Measurement}, year = {2013}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, keywords = {Power Quality, Photovoltaic System, Distribution Network Grid, Harmonics, Voltage Unbalance}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Smolenice, Slovakia}, event_name = {The 9th International Conference on Measurement}, event_date = {27 - 30 May 2013}, language = {English}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Alexandrescu, D. and Vrabcek, P.} } @Proceedings { MerloneLABBBdDDEGGHHJKKMMMdSSSSSV2013, title = {A new challenge for meteorological measurements: The ''MeteoMet'' project - Metrology for meteorology}, journal = {AIP Conference Proceedings}, year = {2013}, volume = {8}, number = {1552}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, pages = {1030-1035}, keywords = {air humidity, air pressure, air temperature, air speed and direction, historical temperature data series, meteorological instruments calibration, traceable climate measurements}, web_url = {http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821419}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Los Angeles (USA)}, event_name = {9th International Temperature Symposium}, event_date = {19-23 March 2012}, DOI = {10.1063/1.4821419}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Merlone, A. and Lopardo, G. and Antonsen, I. and Bell, S. and Benyon, R and Boese, N. and del Campo, D. and Dobre, M. and Drnovsek, J. and Elkatmis, A. and Georgin, E. and Grudniewicz, E. and Heinonen, M. and Holstein-Rathlou, C. and Johansson, J. and Klason, P. and Knorova, R. and Melvad, C. and Merrison, J. and Migaa, K. and de Podesta, M. and Saathoff, H. and Smorgon, D. and Sparasci, F. and Strnad, R. and Szmyrka-Grzebyk, A. and Vuillermoz, E.} } @Proceedings { KovarSSA2013, title = {European project 'Metrology for radioactive waste management'}, journal = {NENE2013}, year = {2013}, number2 = {ENV09: MetroRWM: Metrology for Radioactive Waste Management}, pages = {902.1 to 902.8}, keywords = {Free release measurement, activity measurement, gamma-ray spectrometry, low-background shield, reference materials, Monte Carlo simulations.}, web_url = {http://www.nss.si/nene2013/Contents.htm\#3912}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Bled}, event_name = {NENE 2013}, event_date = {9 to12 September 2013}, ISBN = {978-961-6207-36-2}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kovar, Petr and Suran, Jiri and Solc, Jaroslav and Arnold, Dirk} } @Proceedings { AndreasMMP2013, title = {Modelling laser interferometers for the measurement of the Avogadro constant}, journal = {SPIE Proceedings}, year = {2013}, volume = {8789}, number2 = {SIB08: subnano: Traceability of sub-nm length measurements}, keywords = {Interferometry, optics simulation, metrology, measurement uncertainty, diffraction.}, web_url = {http://spie.org/Publications/Proceedings/Paper/10.1117/12.2020282}, misc = {A169}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, event_place = {Munich}, event_name = {SPIE Optical Metrology}, event_date = {13 to 14 May 2013}, ISSN = {0277-786X}, DOI = {10.1117/12.2020282}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Andreas, Birk and Mana, Giovanni and Massa, Enrico and Palmisano, Carlo} } @Proceedings { SahagiaLALTG2014, title = {Comparison of analysis methods for the characterisation of the radioactive content of metallurgical slag used within the EURAMET-EMRP JRP IND04 MetroMetal}, year = {2013}, number2 = {IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry}, keywords = {EURAMET.EMRP-JRP IND04, metallurgical samples, natural radioactivity measurement}, web_url = {http://www.infim.ro/rrp}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brasov, Romania}, event_name = {4th International Proficiency Testing Conference}, event_date = {18-20th September 2013}, language = {English}, ISSN = {1221-1451 43 822 on line 1841-8759}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Sahagia, M. and Luca, A. and Antohe, A. and Loan, R. and Tanase, M. and Garcia Torano, E.} } @Proceedings { DiazdeAguilarASCSN2013, title = {Los convertidores digitales como futuro patr{\'o}n corriente alterna. El proyecto europeo ''Q-Wave''.}, journal = {5th Congreso Espa{\~n}ol de Metrologia}, year = {2013}, number2 = {SIB59: Q-WAVE: A quantum standard for sampled electrical measurements}, keywords = {SI, convertidores digitales, EMRP, convertidores anal{\'o}gico-digitales, muestreo digital.}, misc = {A169}, misc2 = {EMRP A169: Call 2012 SI Broader scope (II)}, event_place = {Madrid, Spain}, event_name = {5th Congreso Espa{\~n}ol de Metrolog{\'i}a}, event_date = {12 - 14 June 2013}, language = {Spanish}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {D{\'i}az de Aguilar, Javier and Anguas, M{\'o}nica and Sanmamed, Yolanda A. and Caballero, Ra{\'u}l and Schweiger, Kurt and Neira, Miguel} } @Proceedings { , title = {Evaluation of measurement uncertainty for time-dependent quantities.}, journal = {EPJ Web of Conferences}, year = {2013}, volume = {77}, number = {00003 [open access]}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, pages = {1-8}, keywords = {dynamic measurement, uncertainty, Monte Carlo, digital filter, signal processing}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {EDP Sciences}, address = {Les Ulis}, event_place = {Paris, France}, event_name = {International Congress of Metrology}, event_date = {07-10-2013 to 10-10-2013}, language = {30}, ISSN = {ISSN: 2100-014X}, DOI = {10.1051/epjconf/20147700003}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, stag_bib_extends_persistent_identifier = {https://cfmetrologie.edpsciences.org/index.php?option=com_toc\&url=/articles/metrology/abs/2013/01/contents/contents.html}, author = {Eichst{\"a}dt, S. and Arendack{\'a}, B. and Link, A. and Elster, C.} } @Proceedings { , title = {Experimental apparatus for the measurement of the ultrasound attenuationcoefficient}, year = {2013}, number2 = {HLT03: DUTy: Dosimetry for ultrasound therapy}, pages = {695-698}, keywords = {ultrasound, tissue mimicking materials, attenuation measurement}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Merano}, event_name = {AIA-DAGA 2013 Merano}, language = {30}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Musacchio, C and Cuccaro, R and Albo, P and Lago, S and Troia, A.} } @Proceedings { AvellaBCCDGGT2012, title = {Report on proof-of-principle implementations of novel QKD schemes performed at INRIM}, journal = {Proc. SPIE 8542, Electro-Optical Remote Sensing, Photonic Technologies, and Applications VI}, year = {2012}, month = {11}, day = {19}, volume = {8542}, number2 = {IND06: MIQC: Metrology for Industrial Quantum Communications}, pages = {13}, web_url = {http://spie.org}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Edinburgh, United Kingdom}, event_name = {Electro-Optical Remote Sensing, Photonic Technologies, and Applications VI}, event_date = {September 24, 2012}, language = {English}, DOI = {10.1117/12.974608}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Avella, A and Brida, G and Carpentras, D and Cavanna, A and Degiovanni, I. P and Genovese, M and Gramegna, M and Traina, P} } @Article { , title = {Ultra-stable long distance optical frequency distribution using the Internet fiber network}, journal = {Optics Express}, year = {2012}, month = {10}, day = {8}, volume = {20}, number = {21}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, pages = {23518 - 23526}, web_url = {https://www.osapublishing.org/oe/abstract.cfm?uri=oe-20-21-23518}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1364/OE.20.023518}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopez, O. and Haboucha, A. and Chanteau, B. and Chardonnet, C. and Amy-Klein, A. and Santarelli, G.} } @Article { , title = {Simultaneous remote transfer of accurate timing and optical frequency over a public fiber network}, journal = {Applied Physics B}, year = {2012}, month = {10}, day = {4}, volume = {Lasers and Optics 110}, number = {1 (2013) 3-6}, number2 = {SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks}, web_url = {http://arxiv.org/abs/1209.4715}, misc2 = {EMRP A169: Call 2011 SI Broader Scope}, language = {30}, DOI = {10.1007/s00340-012-5241-0}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Lopez, O. and Kanj, A. and Pottie, P.-E. and Rovera, D. and Achkar, J. and Chardonnet, C. and Amy-Klein, A. and Santarelli, G.} } @Proceedings { AkmalH2012, title = {Channel timebase errors for Digital Sampling Oscilloscopes}, journal = {2012 Conference on Precision electromagnetic Measurements}, year = {2012}, month = {7}, number2 = {IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications}, keywords = {Sampling oscilloscope, timebase correction, large-signal measurements}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {IEEE}, event_place = {Washington, DC, USA}, event_name = {Conference on Precision Electromagnetic Measurements}, event_date = {01-07-2013 to 06-07-2012}, language = {30}, DOI = {10.1109/CPEM.2012.6251032}, stag_bib_extends_levelofaccess = {NA}, author = {Akmal, M. and Humphreys, D.} } @Proceedings { , title = {In-situ characterisation of the probing force of contact stylus profilers using a micromachined nanoforce actuator}, journal = {Proceedings of the 12th euspen International Conference}, year = {2012}, month = {6}, volume = {1}, number = {International Conference European Society for Precision Engineering and Nanotechnology 12th}, number2 = {IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials}, pages = {179-182}, web_url = {http://training.euspen.eu/content/News-and-events/euspen-events/Stockholm\%202012/proceedings/VolumePro1/VolumePro1/HTML/files/assets/basic-html/page179.html}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {Euspen conference proceedings }, address = {Leuven, Belgium}, event_place = {Nacka Strandsm{\"a}ssan, Stockholm, Sweden}, event_name = {12th International Conference European Society for Precision Engineering and Nanotechnology}, event_date = {04-06-2012 to 08-06-2012}, language = {30}, extern = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Li, ZL and Ahbe, TA and Gao, SG and Brand, UB} } @Article { GorenADKMY2012, title = {Fatty acid composition and chemotaxonomic evaluation of species of Stachys}, journal = {Natural Product Research}, year = {2012}, volume = {26}, number2 = {ENG09: Biofuels: Metrology for Biofuels}, pages = {84-90}, tags = {EnG}, misc2 = {EMRP A169: Call 2009 Energy}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {G{\"o}ren, A. C. and Ak\c{c}icek, E. and Dirmenci, T. and Kilic, T. and Mozioglu, E. and Yilmaz, H.} } @Article { PollingerHVDAMM2012, title = {Effective humidity in length measurements: comparison of three approaches}, journal = {Measurement Science and Technology}, year = {2012}, volume = {23}, number = {2}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {025502-025503}, web_url = {http://stacks.iop.org/MST/23/025503}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pollinger, F. and Hieta, T. and Vainio, M. and Doloca, N. R. and Abou-Zeid, A. and Meiners-Hagen, K. and Merimaa, M.} } @Article { PollingerMBDSNJHAM2012, title = {The upgraded PTB 600 m baseline: a high-accuracy reference for the calibration and the development of long distance measurement devices}, journal = {Measurement Science and Technology}, year = {2012}, volume = {23}, number = {9}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {094018}, keywords = {geodetic baseline, long distance measurement, refractivity compensation, calibration, measurement uncertainty, length measurement, femtosecond laser-based time-of-flight distance meter}, web_url = {http://stacks.iop.org/MST/23/094018}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, ISSN = {0957-0233}, DOI = {10.1088/0957-0233/23/9/094018}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pollinger, F. and Meyer, T. and Beyer, J. and Doloca, N. and Schellin, W. and Niemeier, W. and Jokela, J. and H{\"a}kli, P. and Abou-Zeid, A. and Meiners-Hagen, K.} } @Article { ArseneSKH2012, title = {High Sensitivity Mass Spectrometric Quantification of Serum Growth Hormone by Amphiphilic Peptide Conjugation}, journal = {Journal of Mass Spectrometry}, year = {2012}, volume = {47}, number = {12}, number2 = {T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine}, pages = {1554–1560}, keywords = {quantitative proteomics; derivatization; tandem mass spectrometry; acromegaly; glucose tolerance tests}, web_url = {http://arxiv.org/pdf/1205.4981.pdf}, misc2 = {iMERA-Plus: Call 2007 Health}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Arsene, C. and Schulze, D. and Kratzsch, J. and Henrion, A.} } @Article { AckoMHB2012, title = {Standards for testing freeform measurement capability of optical and tactile co-ordinate measuring machines}, journal = {Measurement Science and Technology}, year = {2012}, volume = {23}, number = {9}, number2 = {T3.J2.2: NIMTech: Metrology for New Industrial Measurement Technologies}, keywords = {traceability, coordinate measuring machine, freeform, 3D artefact, performance test, gear standard}, web_url = {http://iopscience.iop.org/0957-0233}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, ISSN = {957-0233}, DOI = {10.1088/0957-0233/23/9/094013}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Acko, B. and McCarthy, M. and Haertig, F. and Buchmeister, B.} } @Proceedings { BouhourasMAL2012, title = {Load signatures improvement through the determination of a spectral distribution coefficient for load identification}, journal = {Proceedings of the 9th International Conference on the European Energy Market (EEM)}, year = {2012}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6254662\&queryText\%3Dbouhouras}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Florence, Italy}, event_name = {2012 9th International Conference on the European Energy Market (EEM)}, event_date = {8 - 10 May 2012}, language = {English}, DOI = {10.1109/EEM.2012.6254662}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bouhouras, A. and Milioudis, A. and Andreou, G. and Labridis, D.} } @Proceedings { BouhourasAML2012, title = {Signature of Residential Low Voltage Loads}, journal = {Proceedings of the IEEE International Conference on Industrial Technology (ICIT)}, year = {2012}, number2 = {ENG04: SmartGrid: Metrology for Smart Electrical Grids}, web_url = {http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=\&arnumber=6209919\&queryText\%3Dbouhouras}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Athens, Greece}, event_name = {IEEE International Conference on Industrial Technology (ICIT)}, event_date = {19 - 21 March 2012}, language = {English}, DOI = {10.1109/ICIT.2012.6209919}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Bouhouras, A. and Andreou, G. and Milioudis, A. and Labridis, D.} } @Proceedings { MonteGAKOH2012, title = {Radiation thermometry for remote sensing at PTB}, journal = {AIP Conference Proceedings}, year = {2012}, volume = {8}, number = {1552}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, keywords = {Radiation Thermometry, Radiance, Remote Sensing, Vacuum, Emissivity}, misc2 = {EMRP A169: Call 2010 Environment}, event_place = {Anaheim, USA}, event_name = {Temperature: Its Measurement and Control in Science and Industry}, event_date = {19 - 23 March 2012}, language = {English}, DOI = {10.1063/1.4819631}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Monte, C. and Gutschwager, B. and Adibekyan, A. and Kehrt, M. and Olschewski, F. and Hollandt, J.} } @Article { ZibordiRAMKIR2012, title = {In situ determination of the remote sensing reflectance: an inter-comparison}, journal = {Ocean Science}, year = {2012}, volume = {8}, number2 = {ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate}, pages = {567-586}, misc2 = {EMRP A169: Call 2010 Environment}, language = {English}, DOI = {10.5194/os-8-567-2012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Zibordi, G. and Ruddick, K. and Ansko, I. and Moore, G. and Kratzer, S. and Icely, J. and Reinart, A.} } @Proceedings { GalindoSantosAMCC2012, title = {Application of Brillouin scattering to optical frequency combs}, journal = {Proceedings of SPIE: Nonlinear Optics and Applications VI}, year = {2012}, volume = {8434}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, keywords = {Optical frequency combs, Brillouin scattering amplification, metrology}, misc2 = {EMRP A169: Call 2010 Industry}, event_place = {Brussels, Belgium}, event_name = {Nonlinear Optics and Applications VI}, event_date = {16 - 18 April 2012}, language = {English}, DOI = {10.1117/12.922392}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Galindo-Santos, J. and Alcon-Camas, M. and Martin-Lopez, S. and Carrasco-Sanz, A. and Corredera, P.} } @Article { CorrederaGMAC2012, title = {Desarrollo de patrones de frecuencia {\'o}pticos para comunicaciones {\'o}pticas}, journal = {e-medida}, year = {2012}, volume = {2}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, web_url = {http://www.e-medida.es/documentos/Numero-2/desarrollo_de_patrones_de_frecuencia_opticos_para_comunicaciones_opticas}, misc2 = {EMRP A169: Call 2010 Industry}, language = {Spanish}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Corredera, P. and Galindo-Santos, J. and Martin-Lopez, S. and Alcon-Camas, M. and Carrasco-Sanz, A.} } @Article { GalindoSantosACMC2012, title = {Development of IR frequency standards based on laser diodes}, journal = {{\'O}ptica Pura y Aplicada}, year = {2012}, volume = {45}, number = {2}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {221-231}, keywords = {Optical Frequency Comb, Stable Laser, Frequency Standards}, web_url = {http://www.sedoptica.es/Menu_Volumenes/Pdfs/OPA45-2-221.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, language = {Spanish}, DOI = {10.7149/OPA.45.2.221}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Galindo-Santos, J. and Alcon-Camas, M. and Carrasco-Sanz, A. and Martin-Lopez, S. and Corredero, P.} } @Inbook { , title = {Generaci{\'o}n de frecuencias {\'o}pticas de referencia mediante peines de frecuencia filtrados por amplificaci{\'o}n Brillouin en fibra {\'o}ptica}, year = {2012}, number2 = {IND14: Frequency: New generation of frequency standards for industry}, pages = {277 - 284}, web_url = {http://www.cenam.mx/sm_2012}, misc2 = {EMRP A169: Call 2010 Industry}, language = {112}, ISBN = {978-607-96162-0-5}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Galindo-Santos, J. and Alcon-Camas, M. and Martin-Lopez, S. and Carrasco-Sanz, A. and Corredera, P.} } @Article { AndreasFKM2012_2, title = {A model to estimate the uncertainty of the phase-correction in sphere-diameter measurements}, journal = {Metrologia}, year = {2012}, volume = {49}, number = {4}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, keywords = {spatial dimensions, interferometry, fundamental constants, volume standards}, web_url = {http://m.iopscience.iop.org/0026-1394/49/4/479}, misc = {iMERA-Plus}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, ISSN = {0026-1394}, DOI = {10.1088/0026-1394/49/4/479}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Andreas, B and Fujii, K and Kuramoto, N and Mana, G} } @Proceedings { DawidLindelGWDSFRAFSNI, title = {Cardiac CINE MRI at 7 T using a transmit array}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2012}, volume = {20}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/12/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Melbourne, Australia}, event_name = {ISMRM 20th Annual Meeting and Exhibition}, event_date = {5-11 May 2012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Dawid Lindel, Tomasz and Greiser, Andreas and Waxmann, Patrick and Dietterle, Martin and Seifert, Frank and Fontius, Ulrich and Renz, Wolfgang and Alexander Dieringer, Matthias and Frauenrath, Tobias and Schulz-Menger, Jeanette and Niendorf, Thoralf and Ittermann, Bernd} } @Proceedings { AlexanderDieringerdHHNS, title = {Design, Implementation, Application and Evaluation of a MR Compatible Left Ventricle Model}, journal = {Proc. Intl. Soc. Mag. Reson. Med.}, year = {2012}, volume = {20}, number2 = {HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI}, web_url = {http://www.ismrm.org/12/}, misc = {A169}, misc2 = {EMRP A169: Call 2011 Metrology for Health}, event_place = {Melbourne, Australia}, event_name = {ISMRM 20th Annual Meeting and Exhibition}, event_date = {5-11 May 2012}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Alexander Dieringer, Matthias and de Quadros, Thiago and Hentschel, Jan and Hoffmann, Werner and Niendorf, Thoralf and Schulz-Menger, Jeanette} } @Thesis { , title = {Realizzazione di un datalogger per l’acquisizione ad elevata sensibilit{\`a} di misure di temperatura dell’aria tramite sensori Pt100 in centraline meteorologiche automatiche}, year = {2012}, number2 = {ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere}, keywords = {centraline automatiche, PT100, datalogger}, misc2 = {EMRP A169: Call 2010 Environment}, school = {Politecnico di Torino}, language = {59}, ISBN = {not applicable}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {No, EURAMET is never allowed to make the publication publicly available.}, author = {Asiatici, Mikhail} } @Proceedings { , title = {STEP RESPONSE OF VACUUM SENSORS – A PRELIMINARY STUDY}, year = {2012}, number2 = {IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities}, keywords = {vacuum gauge dynamic pressure about 20ms}, web_url = {www.imeko.org/publications/wc-2012/IMEKO-WC-2012-TC16-O8.pdf}, misc2 = {EMRP A169: Call 2010 Industry}, publisher = {International Measurement Conferderation}, address = {Budapest}, event_place = {Busan, Republic of Korea}, event_name = {XX IMEKO World Congress: Metrology for Green Growth}, event_date = {09-14, September, 2012}, language = {30}, ISBN = {978-89-9500005-2}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website.}, author = {Arrh{\'e}n, F.} } @Article { ArslanovSNCLPBH2011, title = {Rapid and sensitive trace gas detection with continuous wave Optical Parametric Oscillator-based Wavelength Modulation Spectroscopy}, journal = {Applied Physics B}, year = {2011}, month = {9}, day = {25}, volume = {103}, number = {1}, number2 = {T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection}, pages = {223-228}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Arslanov, D.D. and Spunei, M. and Ngai, A.K.Y. and Cristescu, S.M. and Lindsay, I.D. and Persijn, S.T. and Boller, K.J. and Harren, F.J. M.} } @Article { MeinersHagenKA20110, title = {A Multiwavelength Interferometer for Geodetic Lengths}, journal = {VDI-Berichte}, year = {2011}, month = {9}, volume = {2156}, number = {125}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, keywords = {Interferometry, refractive index of air}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Meiners-Hagen, K. and K{\"o}chert, P. and Abou-Zeid, A.} } @Article { AndrieuxZCRZ2011, title = {500 GHz mode-hop-free idler tuning range with a frequency-stabilized singly resonant optical parametric oscillator}, journal = {Optics Letters}, year = {2011}, month = {4}, day = {1}, volume = {36}, number = {7}, number2 = {T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection}, pages = {1212-1214}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Andrieux, E. and Zanon, Thomas and Cadoret, Malo and Rihan, Abdallah and Zondy, Jean-Jacques} } @Article { AndreasABBBBBFFFKKKMNPPRSVWZ2011, title = {Counting the atoms in a 28Si crystal for a new kilogram definition}, journal = {Metrologia}, year = {2011}, month = {3}, day = {22}, volume = {48}, number = {2}, number2 = {T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram}, keywords = {Avogadro constant, kilogram redefinition, silicon, XRCD method}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0026-1394/48/2/S01}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Andreas, B. and Azuma, Y. and Bartl, G. and Becker, P. and Bettin, H. and Borys, M. and Busch, I. and Fuchs, P. and Fujii, K. and Fujimoto, H. and Kessler, E. and Krumrey, M. and Kuetgens, U. and Mizushima, N. and Nicolaus, A. and Picard, A. and Pramann, A. and Rienitz, O. and Schiel, D. and Valkiers, S. and Waseda, A. and Zakel, S.} } @Article { AndreasFFKM2011, title = {Phase corrections in the optical interferometer for Si sphere volume measurements at NMIJ}, journal = {Metrologia}, year = {2011}, month = {3}, day = {22}, volume = {48}, number = {2}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, keywords = {Phase corrections, Fizeau cavity, Gouy phase}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0026-1394/48/2/S13}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Andreas, B. and Ferroglio, L. and Fujii, K. and Kuramoto, N. and Mana, G.} } @Article { BuschABCFFKKKM2011, title = {Surface layer determination for the Si spheres of the Avogadro project}, journal = {Metrologia}, year = {2011}, month = {3}, day = {22}, volume = {48}, number = {2}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, keywords = {surface layer, XPS measurements, XRF measurements.}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1088/0026-1394/48/2/S10}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Busch, I. and Azuma, Y. and Bettin, H. and Cibik, L. and Fuchs, P. and Fujii, K. and Krumrey, M. and Kutegens, U. and Kuramoto, N. and Mizushima, S.} } @Article { HaoAGCRKJDS2011, title = {Detection of single magnetic nanobead with a nano-superconducting quantum interference device}, journal = {Applied Physics Letters}, year = {2011}, month = {2}, day = {28}, volume = {98}, number = {9}, number2 = {T4.J02: NanoSpin: Nanomagnetism and Spintronics}, note = {No pdf received}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, DOI = {10.1063/1.3561743}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Hao, L. and Assmann, C. and Gallop, J. C. and Cox, D. and Ruede, F. and Kazakova, O. and Josephs-Franks, P. and Drung, D. and Schurig, Th.} } @Article { AndreasABBBBBGFFFKKKKMMMMNPPRSVW2011, title = {Determination of the Avogadro Constant by Counting the Atoms in a 28Si Crystal}, journal = {Physical Review Letters}, year = {2011}, month = {1}, day = {21}, volume = {106}, number = {3}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, keywords = {Avogadro constant, kilogram redefinition, silicon, XRCD method}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Andreas, B. and Azuma, Y. and Bartl, G. and Becker, P. and Bettin, H. and Borys, M. and Busch, I. and Gray, M. and Fuchs, P. and Fujii, K. and Fujimoto, H. and Kessler, E. and Krumrey, M. and Kuetgens, U. and Kuramoto, N. and Mana, G. and Manson, P. and Massa, E. and Mizushima, S. and Nicolaus, A. and Picard, A. and Pramann, A. and Rienitz, O. and Schiel, D. and Valkiers, S. and Waseda, A.} } @Article { LacquanitiDFSAB2011, title = {Improved characteristics of intrinsically shunted Nb/Al-AlOx-Nb Josephson junctions}, journal = {Applied Superconductivity Conference}, year = {2011}, number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lacquaniti, Vincenzo and De Leo, Natascia and Fretto, Matteo and Sosso, Andrea and Andreone, D. and Belogolovskii, M.} } @Proceedings { PollingerMDA2011, title = {Spectroscopic determination of the effective humidity for distance measurements in air}, journal = {Proceedings of the 56th International Scientific Colloquium: ''Innovation in mechanical engineering-shaping the future}, year = {2011}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {7pp.}, keywords = {tunable diode laser absorption spectroscopy, humidity, air refractive index, length metrology, long distance}, misc2 = {iMERA-Plus: Call 2007 Length}, event_place = {Ilmenau, Germany}, event_name = {56th International Scientific Colloquium: ''Innovation in mechanical engineering-shaping the future}, event_date = {12 - 16 September 2011}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pollinger, F. and Meiners-Hagen, K. and Doloca, N. R. and Abou-Zeid, A.} } @Proceedings { RossiSRAI2011, title = {MEASURING MAN AND SOFT METROLOGY: INFLUENCE OF VISUAL AND AUDITORY DISTURBING FACTORS ON CONTRAST DETECTION}, journal = {Proceedings of the 15th International Congress of Metrology}, year = {2011}, number2 = {ENG05: Lighting: Metrology for Solid State Lighting}, misc2 = {EMRP A169: Call 2009 Energy}, event_place = {Paris, France}, event_name = {15th International Congress of Metrology}, event_date = {3 - 6 October 2011}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Rossi, L. and Schiavi, A. and Rossi, G. and Astolfi, A. and Iacomussi, P.} } @Article { FerreroAMNv2010, subid = {2794}, title = {Design and Characterization of an RF Applicator for In Vitro Tests of Electromagnetic Hyperthermia}, journal = {Sensors}, year = {2010}, month = {5}, day = {22}, volume = {22}, number = {10}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, pages = {3610}, keywords = {thermal therapies, electromagnetic hyperthermia, RF applicator, TEM mode, coaxial cable, electromagnetic modelling, thermal modelling, temperature measurements, phantoms}, web_url = {https://www.mdpi.com/1424-8220/22/10/3610}, misc2 = {EMPIR 2018: Health}, publisher = {MDPI}, language = {30}, DOI = {10.3390/s22103610}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Androulakis, I. and Martino, L. and Nadar, R. and van Rhoon, G.C.} } @Article { ArseneHDMB2010_2, title = {Quantification of growth hormone in serum by isotope dilution mass spectrometry}, journal = {Analytcial Biochemistry}, year = {2010}, month = {3}, day = {10}, volume = {401}, number = {2}, number2 = {T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine}, pages = {228-235}, keywords = {Growth hormone (GH); Somatotropin; Serum; Quantification; Standardization; Reference measurement; LC–MS/MS; Isotope dilution mass spectrometry (IDMS)}, web_url = {http://precedings.nature.com/documents/4050/version/1}, misc2 = {iMERA-Plus: Call 2007 Health}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Arsene, C. G. and Henrion, A. and Diekmann, N. and Manolopoulou, J. and Bidlingmaier, M.} } @Proceedings { PalmansAATSMK2010, title = {Conversion of dose-to-graphite to dose-to-water in clinical proton beams}, journal = {Proceedings IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry}, year = {2010}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, pages = {107}, misc2 = {iMERA-Plus: Call 2007 Health}, event_place = {Vienna, Austria}, event_name = {IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry}, event_date = {09-12 November 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Palmans, H. and Al-Sulaiti, L. and Andreo, P. and Thomas, R. A. S. and Shipley, D. R. and Martinkovic, J. and Kacperek, A.} } @Proceedings { AntonKKH2010, title = {Response of alanine dosimeters in small photon fields}, journal = {Proceedings IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry}, year = {2010}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, pages = {2267-2274}, misc2 = {iMERA-Plus: Call 2007 Health}, event_place = {Vienna, Austria}, event_name = {IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry}, event_date = {09-12 November 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Anton, M. and Krauss, A. and Kapsch, R.-P. and Hackel, T.} } @Article { AlSualitiSTKRP2010, title = {Water equivalence of various materials for clinical proton dosimetry by experiment and Monte Carlo simulation}, journal = {Nuclear Instruments and Methods}, year = {2010}, volume = {A 619}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, pages = {344-347}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Al-Sulaiti, L. and Shipley, D. and Thomas, R. and Kacperek, A. and Regan, P. and Palmans, H.} } @Article { LemarchandDDLACBBD2010, title = {Determination of the Boltzmann Constant by Laser Spectroscopy as a Basis for Future Measurements of the Thermodynamic Temperature}, journal = {International Journal of Thermophysics}, year = {2010}, volume = {31}, number = {7}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {1347-1359}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1007/s10765-010-0755-}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lemarchand, C. and Djerroud, K. and Darqui{\'e}, B. and Lopez, O. and Amy-Klein, A. and Chardonnet, C. and Bord{\'e}, C. and Briaudeau, S. and Daussy, C.} } @Article { DolocaMWPA2010, title = {Absolute distance measurement system using a femtosecond laser as a modulator}, journal = {Measurement Science and Technology}, year = {2010}, volume = {21}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {115302 (7pp)}, keywords = {absolute distance measurement, femtosecond laser, time-of-flight}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {English}, DOI = {10.1088/0957-0233/21/11/115302}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Doloca, N. R. and Meiner-Hagen, K. and Wedde, M. and Pollinger, F. and Abou-Zeid, A.} } @Article { DolocaWMA2010, title = {Femtosekundenlaserbasierendes Messsystem f{\"u}r geod{\"a}tische L{\"a}ngen}, journal = {PTB-Mitteilungen}, year = {2010}, volume = {120}, number = {2}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {120-123}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {German}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Doloca, N. R. and Wedde, M. and Meiners-Hagen, K. and Abou-Zeid, A.} } @Article { MeinersHagenPA2010, title = {Brechzahlkompensation mittels Mehrwellenl{\"a}ngen-Interferometrie}, journal = {PTB-Mitteilungen}, year = {2010}, volume = {120}, number = {2}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, pages = {110-114}, misc2 = {iMERA-Plus: Call 2007 Length}, language = {German}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Meiners-Hagen, K. and Pollinger, F. and Abou-Zeid, A.} } @Proceedings { PollingerDWMA2010, title = {Measurements of absolute long distances}, journal = {Proceedings of SPIE: 7544}, year = {2010}, number2 = {T3.J3.1: Long distance: Absolute long distance measurement in air}, misc2 = {iMERA-Plus: Call 2007 Length}, event_place = {Hangzhou}, event_name = {ISPEMI 2010, 6th International Symposium on Precision Engineering Measurements and Instrumentation}, event_date = {08-11 August 2010}, language = {English}, ISBN = {978-0-8194-7940-2}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Pollinger, F. and Doloca, N. R. and Wedde, M. and Meiners-Hagen, K. and Abou-Zeid, A.} } @Article { WunderliA2010, title = {Vergleichbare Messresultate dank R{\"u}ckverfolgbarkeit - R{\'e}sultats de mesure comparables grace {\`a} la tracabilit{\'e}}, journal = {METinfo}, year = {2010}, volume = {2}, number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry}, pages = {15-19}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {German-French}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Wunderli, Samuel and Wunderli, Samuel and Andres, H.} } @Proceedings { SchraderSKLAA2010, title = {Traceable measurements of field strength and SAR for the Physical Agents Directive - an update}, journal = {2010 Asia-Pacific International Symposium on Electromagnetic Compatibility : proceedings of tutorials \& workshops}, year = {2010}, number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive}, pages = {564-567}, web_url = {http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=5470270}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, event_place = {Bejing, China}, event_name = {2010 Asia-Pacific International Symposium on Electromagnetic Compatibility}, event_date = {12 - 16 April 2010}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Schrader, T. and Salhi, M. and Kleine-Ostmann, T. and Loader, B. and Adamson, D. and Allal, D.} } @Article { DjerroudLGDBDLACB2009, title = {Measurement of the Boltzmann constant by the Doppler broadening technique at a 3.8\(\times\)10\(^{-5}\) accuracy level}, journal = {Comptes Rendus Physique}, year = {2009}, month = {11}, volume = {10}, number = {9}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, pages = {883-893}, keywords = {Fundamental constants; Laser spectroscopy; Absorption line shape}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1016/j.crhy.2009.10.020}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Djerroud, K. and Lemarchand, C. and Gauguet, A. and Daussy, C. and Briaudeau, S. and Darqui{\'e}, B. and Lopez, O. and Amy-Klein, A. and Chardonnet, C. and Bord{\'e}, C.} } @Article { KemppinenKPTAP2010, title = {Experimental investigation of hybrid single-electron turnstiles with high charging energy}, journal = {Applied Physics Letters}, year = {2009}, volume = {94}, number = {172108}, number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere}, pages = {1-3}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1063/1.3127229}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Kemppinen, A. and Kafanov, S. and Pashkin, Yu. A. and Tsai, J. S. and Averin, D. V. and Pekola, J. P.} } @Article { LacquanitiADFSB2009, title = {Engineering Overdamped Niobium-Based Josephson Junctions for Operation Above 4.2 K}, journal = {IEEE Transactions on Applied Superconductivity}, year = {2009}, volume = {19}, number = {3}, number2 = {T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications}, pages = {234-237}, keywords = {Josephson junctions; superconducting devices; voltage standard}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, ISSN = {1051-8223}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Lacquaniti, V. and Andreone, D. and DeLeo, N. and Fretto, M. and Sosso, A. and Belogolovskii, M.} } @Article { AlleviABBGGTOPZ2009, title = {State reconstruction by on/off measurements}, journal = {Physical Review A}, year = {2009}, volume = {80}, number = {022114}, number2 = {T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1103/PhysRevA.80.022114}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Allevi, A. and Andreoni, A. and Bondani, M. and Brida, G. and Genovese, M. and Gramegna, M. and Traina, P. and Olivares, S. and Paris, M. G. A. and Zambra, G.} } @Article { TrincheroSLGFdABTBV2009, title = {Experimental setup for the characterization of field probes performance in presence of digitally modulated radio signals}, journal = {IEEE Antennas and Wireless Propagation Letters}, year = {2009}, volume = {8}, number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive}, pages = {224-227}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Trinchero, D. and Stefanelli, R. and Longobardi, F. and Galardini, A. and Fiorelli, B. and d'Amore, G. and Anglesio, L. and Benedetto, A. and Trinchero, S. and Borsero, M. and Vizio, G.} } @Article { TrincheroSLGFdABTBV2009_2, title = {Field probes performance for the measurement of spread-spectrum radio signals}, journal = {IEEE Antennas and Wireless Propagation Letters}, year = {2009}, volume = {8}, number2 = {T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive}, pages = {494-497}, misc2 = {iMERA-Plus: Call 2007 Electricity and Magnetism}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Trinchero, D. and Stefanelli, R. and Longobardi, F. and Galardini, A. and Fiorelli, B. and d'Amore, G. and Anglesio, L. and Benedetto, A. and Trinchero, S. and Borsero, M. and Vizio, G.} } @Article { BerdatAW2009, title = {Development of Suitable ISE Measurement Procedures for SI-Traceable Chemical Activity Determination}, journal = {Chimia}, year = {2009}, volume = {63}, number = {10}, number2 = {T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry}, pages = {670-677}, keywords = {Clinical chemistry, electrolyte, ion-selective electrode, Pitzer activity, potentiometry}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, DOI = {10.2533/chimia.2009.670}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Berdat, D. and Andres, H. and Wunderli, S.} } @Article { ApolloniMPZ2008, title = {X-ray and gamma-ray propagation in bent crystals with flat and cylindrical surfaces}, journal = {Acta Crystallographica Section A}, year = {2008}, month = {7}, day = {10}, volume = {A64}, number2 = {T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram}, pages = {549-559}, keywords = {X-ray optics; X-ray interferometry; instrumentation, measurement, and metrology; interferometry}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Apolloni, A. and Mana, G. and Palmisano, C. and Zosi, G.} } @Article { ArseneOBPHOBG2008_2, title = {Protein quantification by isotope dilution mass spectrometry of proteolytic fragments: cleavage rate and accuracy}, journal = {Analytical Chemistry}, year = {2008}, month = {4}, day = {30}, volume = {80}, number = {11}, number2 = {T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine}, pages = {4154-4160}, web_url = {http://pubs.acs.org/doi/abs/10.1021/ac7024738}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, DOI = {10.1021/ac7024738}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Arsene, C. G. and Ohlendorf, R. and Burkitt, W. I. and Pritchard, C. and Henrion, A. and O'Connor, G. and Bunk, D. M. and Guettler, B.} } @Article { WrightBGTPJHAJNR20100, title = {Enhanced current quantization in high-frequency electron pumps in a perpendicular magnetic field}, journal = {Physical Review Letters B}, year = {2008}, volume = {78}, number = {233311}, number2 = {T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere}, pages = {1-4}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, DOI = {10.1103/PhysRevB.78.233311}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Wright, S. J. and Blumenthal, M. D. and Gumbs, Godfrey and Thorn, A. L. and Pepper, M. and Janssen, T. J. B. M. and Holmes, S. N. and Anderson, D. and Jones, G. A. C. and Nicoll, C. A. and Ritchie, D. A.} } @Article { AlfonsoACSKKMPRSUV2008, title = {A new formalism for reference dosimetry of small and non-standard fields}, journal = {Medical Physics}, year = {2008}, volume = {35}, number2 = {T2.J07: EBCT: External Beam Cancer Therapy}, pages = {5179-5186}, misc2 = {iMERA-Plus: Call 2007 Health}, language = {English}, DOI = {10.1118/1.3005481}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Alfonso, R. and Andreo, P. and Capote, R. and Saiful Huq, M. and Kilby, W. and Kj{\"a}ll, P. and Mackie, T. R. and Palmans, H. and Rosser, K. and Seuntjens, J. and Ullrich, W. and Vatnitsky, S.} } @Article { DaussyGADHBBC2007, title = {Direct Determination of the Boltzmann Constant by an Optical Method}, journal = {Physical Review Letters}, year = {2007}, volume = {98}, number = {250801}, number2 = {T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin}, misc2 = {iMERA-Plus: Call 2007 SI and Fundamental Metrology}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Daussy, C. and Guinet, M. and Amy-Klein, A. and Djerroud, K. and Hermier, Y. and Briaudeau, S. and Bord{\'e}, C. and Chardonnet, C.} } @Article { NouiraEYAS201, title = {Metrological characterization of optical confocal sensors measurements (20 and 350 travel ranges)}, journal = {Journal of Physics: Conference Series}, year = {201}, month = {4}, day = {7}, volume = {483}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, pages = {12}, web_url = {http://iopscience.iop.org/1742-6596/483/1/012015}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, ISSN = {1742-6596}, DOI = {10.1088/1742-6596/483/1/012015}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {Nouira, H and El-Hayek, N and Yuan, X and Anwer, N and Salgado, J} } @Article { AkcadagS0008, subid = {2804}, title = {New apparatus for the determination of liquid density at primary level in TUBITAK UME}, journal = {International Journal of Metrology and Quality Engineering}, year = {8}, month = {6}, day = {22}, volume = {13}, number = {Int. J. Me}, number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements}, pages = {1-6}, keywords = {liquid density reference liquids / hydrostatic weighing}, web_url = {https://www.metrology-journal.org/articles/ijmqe/abs/2022/01/contents/contents.html}, misc2 = {EMPIR 2017: Research Potential}, publisher = {EDP Sciences}, language = {30}, ISSN = {2107-6847}, DOI = {10.1051/ijmqe/2022006}, stag_bib_extends_levelofaccess = {NA}, author = {Akcadag, U.Yu. and Sariyerli, G.S.} } @Miscellaneous { PottieAQLCRWKKG, subid = {2291}, title = {Data set from ''Combining fiber Brillouin amplification with a repeater laser station for fiber-based optical frequency dissemination over 1400 km''}, journal = {Zenodo}, number2 = {18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks}, pages = {4046057}, keywords = {frequency transfer, optical fiber link, optical atomic clocks}, web_url = {https://doi.org/10.5281/zenodo.4046057}, misc2 = {EMPIR 2018: SI Broader Scope}, publisher = {Zenodo}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4046057}, author = {Pottie, P-E. and Amy-Klein, A. and Quintin, N. and Lopez, O. and Cantin, E. and Raupach, S.M.F. and Waterholter, T. and Kuhl, A. and Koke, S. and Grosche, G.} } @Miscellaneous { HutzschenreuterSLSKAH, subid = {2337}, title = {SmartCom Digital-SI (D-SI) XML exchange format for metrological data version 2.0.0}, number2 = {17IND02: SmartCom: Communication and validation of smart data in IoT-networks}, keywords = {Digital-SI (D-SI), data communication, IoT-communication, IoT-networking, metrology data, SmartCom, digital exchange format, XML, EMPIR, Horizon 2020}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4709001}, author = {Hutzschenreuter, D. and Shan, L. and Loewe, J.H. and Scheibner, A. and Klobucar, R. and Acko, B. and Heindorf, L.} } @Miscellaneous { ManaraUAAS, subid = {2548}, title = {Spectral emissivity of isotropic graphite from 1290 K to 2300 K}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Spectral emissivity, High temperature, Isotropic graphite}, misc2 = {EMPIR 2017: Industry}, publisher = {ZENODO}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6033315}, author = {Manara, J. and Urban , D. and Anhalt, K. and Arduini, M. and Stark, T.} } @Miscellaneous { AnhaltUMASPP, subid = {2550}, title = {Spectral emissivity of sandblasted tungsten from 1370 K to 4100 K}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Spectral emissivity, High temperature, Tungsten}, misc2 = {EMPIR 2017: Industry}, publisher = {ZENODO}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6033061}, author = {Anhalt, K. and Urban , D. and Manara, J. and Arduini, M. and Stark, T. and Pichler, P. and Pottlacher, G.} } @Miscellaneous { AnhaltUMASPP_2, subid = {2549}, title = {Spectral emissivity of sandblasted molybdenum from 1250 K to 3190 K}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Spectral emissivity, High temperature, Molybdenum}, misc2 = {EMPIR 2017: Industry}, publisher = {ZENODO}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6033246}, author = {Anhalt, K. and Urban , D. and Manara, J. and Arduini, M. and Stark, T. and Pichler, P. and Pottlacher, G.} } @Miscellaneous { VidiMRHAUPPM, subid = {2562}, title = {Specific heat of tungsten from 23 \(^{\circ}\)C to 3266 \(^{\circ}\)C}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Specific heat, High temperature, Tungsten}, misc2 = {EMPIR 2017: Industry}, publisher = {ZENODO}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6091579}, author = {Vidi , S. and Manara, J. and Razouk, R. and Hay, B. and Anhalt, K. and Urban , D. and Pichler, P. and Pottlacher, G. and Milosevic, N.} } @Miscellaneous { VidiMRHAUPPM_2, subid = {2561}, title = {Specific heat of molybdenum from 23 \(^{\circ}\)C to 2607 \(^{\circ}\)C}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Specific heat, High temperature, Molybdenum}, misc2 = {EMPIR 2017: Industry}, publisher = {ZENODO}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6091492}, author = {Vidi , S. and Manara, J. and Razouk, R. and Hay, B. and Anhalt, K. and Urban , D. and Pichler, P. and Pottlacher, G. and Milosevic, N.} } @Miscellaneous { RazoukHAUM, subid = {2560}, title = {Specific heat of isotropic graphite from 1000 \(^{\circ}\)C to 2800 \(^{\circ}\)C}, number2 = {17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties}, keywords = {Specific heat, High temperature, Isotropic graphite}, misc2 = {EMPIR 2017: Industry}, publisher = {ZENODO}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/6091274}, author = {Razouk, R. and Hay, B. and Anhalt, K. and Urban , D. and Milosevic, N.} } @Miscellaneous { NaydenovDAEBGJSMTDFJO, subid = {1463}, title = {Mapping the Local Spatial Charge in Defective Diamond by Means of N-V Sensors—A Self-Diagnostic Concept}, number2 = {17FUN06: SIQUST: Single-photon sources as new quantum standards}, keywords = {Crystal defectsQuantum Information with hybrid SystemsQuantum sensingelemantal semiconductorsNitrogen vacancy centers in Diamondwide band gap Systemsoptically detected magnetic resonance}, web_url = {https://zenodo.org/record/3711403\#.Xnh5L0BFz8d}, misc2 = {EMPIR 2017: Fundamental}, language = {30}, stag_bib_extends_levelofaccess = {NA}, author = {Naydenov, B. and Degiovanni, I.P. and Amato, G. and Enrico, E. and Bosia, F. and Grilj, V. and Jakšić, M. and Skukan, N. and Moreva, E. and Traina, P. and Ditalia, T. and Forneris, J. and Jelezko, F. and Olivero, P.} } @Proceedings { ElHayekANGDB, title = {3D Measurement and Characterization of Ultra-precision Aspheric Surfaces}, journal = {This paper will be published in Procedia CIRP}, number2 = {IND10: Form metrology: Optical and tactile metrology for absolute form characterization}, keywords = {Aspheric surface; form characterization; high precision metrology; non linear least-squares method; computational metrology.}, misc = {A169}, misc2 = {EMRP A169: Call 2010 Industry}, event_name = {13th CIRP Conference on Computer Aided Tolerancing}, language = {English}, reviewed = {1}, stag_bib_extends_fe_group = {59}, stag_bib_extends_levelofaccess = {NA}, author = {El-Hayek, N. and Anwer, N. and Nouira, H. and Gibaru, O. and Damak, M. and Bourdet, P.} } @Miscellaneous { SchwarzDABLSWRLL, subid = {1715}, title = {Additional data for the publication ''Long term measurement of the 87Sr clock frequency at the limit of primary Cs clocks}, number2 = {18SIB05: ROCIT: Robust Optical Clocks for International Timescales}, keywords = {Optical clocks ; Primary frequency standards ; Absolute frequency measurement ; Clock stability}, web_url = {https://oar.ptb.de/resources/show/10.7795/720.20201113}, misc2 = {EMPIR 2018: SI Broader Scope}, DOI = {10.7795/720.20201113}, stag_bib_extends_levelofaccess = {NA}, author = {Schwarz, R. and D{\"o}rscher, S. and Al-Masoudi, A. and Benkl{\"o}er, E. and Legero, T. and Sterr, U. and Weyers, S. and Rahm, J. and Lipphardt, B. and Lisdat, C.} } @Miscellaneous { BottauscioABCZ, subid = {1395}, title = {Dataset related to publication ''In silico evaluation of the thermal stress induced by MRI switched gradient fields in patients with metallic hip implant''}, journal = {Zenodo}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {Dosimetry, Magnetic Resonance Imaging (MRI), MR Safety, Gradient Coils, Medical Implants, Prostheses, Numerical Simulation}, misc2 = {EMPIR 2017: Industry}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.3625218}, author = {Bottauscio, O. and Arduino, A. and Br{\"u}hl, R. and Chiampi, M. and Zilberti, L.} } @Miscellaneous { ChiampiBZHZAB, subid = {2159}, title = {Dataset related to publication ''Heating of hip joint implants in MRI: the combined effect of radiofrequency and switched-gradient fields''}, journal = {Zenodo}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {Dosimetry, Magnetic Resonance Imaging (MRI), MR Safety, Medical Implants, Prostheses, Numerical Simulation}, misc2 = {EMPIR 2017: Industry}, DOI = {10.5281/zenodo.4049839}, stag_bib_extends_levelofaccess = {NA}, author = {Chiampi, M. and Br{\"u}hl, R. and Zilberti, L. and Hand, J. and Zanovello, U. and Arduino, A. and Bottauscio, O.} } @Miscellaneous { WooldridgeAZZCB, subid = {2162}, title = {Simulations of Gradient Coil and Radiofrequency Induced Heating of Orthopaedic Implants in MRI}, journal = {Zenodo}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {MRI, implant heating}, web_url = {https://zenodo.org/record/4926767\#.YUHysbgzbIU}, misc2 = {EMPIR 2017: Industry}, DOI = {10.5281/zenodo.4926767}, stag_bib_extends_levelofaccess = {NA}, author = {Wooldridge, J. and Arduino, A. and Zilberti, L. and Zanovello, U. and Chiampi, M. and Bottauscio, O.} } @Miscellaneous { ClementiZAABBCZB, subid = {2161}, title = {Heating risk evaluation for MRI on patients with hip, knee and shoulder arthroplasty}, journal = {Zenodo}, number2 = {17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations}, keywords = {MRI heating risk, MRI safety, Orthopaedic implants, Radiofrequency heating, Gradient coil heating}, web_url = {https://zenodo.org/record/4388310\#.YUHxNbgzbIU}, misc2 = {EMPIR 2017: Industry}, DOI = {10.5281/zenodo.4388310}, stag_bib_extends_levelofaccess = {NA}, author = {Clementi, V. and Zanovello, U. and Arduino, A. and Ancarani, C. and Baruffaldi, F. and Bordini, B. and Chiampi, M. and Zilberti, L. and Bottauscio, O.} } @Miscellaneous { EdlerBIMTAASZ, subid = {2515}, title = {Pt-40\%Rh Versus Pt-6\%Rh Thermocouples: An emf-Temperature Reference Function for the Temperature Range 0 \(^{\circ}\)C to 1769 \(^{\circ}\)C}, journal = {International Journal of Thermophysics}, volume = {42}, number2 = {17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2}, pages = {150}, keywords = {Noble metal thermocouples · Reference function · Thermoelectricstability and homogeneity}, web_url = {https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf}, misc2 = {EMPIR 2017: Industry}, publisher = {Springer}, ISSN = {1572-9567}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5163783}, author = {Edler, F. and Bojkovski, J. and Izquierdo, C.G. and Martin, M.J. and Tucker, D. and Arifovic, N. and Andersen, S.L. and Sindelorva, L. and Žužek, V.} } @Miscellaneous { FischerHSPA, subid = {1518}, title = {CAsoft Example - Zener diode}, number2 = {17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty}, keywords = {CASoftConformity assessmentRiskConformance probability}, tags = {MAT}, web_url = {https://zenodo.org/record/3895759\#.XuiTkEUzZPY}, misc2 = {EMPIR 2017: Support for Impact}, language = {30}, DOI = {10.5281/zenodo.3895759}, stag_bib_extends_levelofaccess = {NA}, author = {Fischer, N. and Harris, P. and Smith, I. and Pendrill, L. and Allard, A.} } @Miscellaneous { FischerHSPA_2, subid = {1526}, title = {CAsoft example - Multicomponent measurement - Multimeter}, number2 = {17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty}, keywords = {Conformity assessmentConformance probability Specific risk Uncertainty Metrology}, tags = {MAT}, misc2 = {EMPIR 2017: Support for Impact}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {10.5281/zenodo.3909017}, author = {Fischer, N. and Harris, P. and Smith, I. and Pendrill, L. and Allard, A.} } @Miscellaneous { AllardPSHF, subid = {1558}, title = {CAsoft Example - Precision resistors - Global risk}, number2 = {17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty}, keywords = {Conformity assessment Global risk Uncertainty MetrologyCAsoft}, tags = {MAT}, misc2 = {EMPIR 2017: Support for Impact}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/3908190}, author = {Allard, A. and Pendrill, L. and Smith, I. and Harris, P. and Fischer, N.} } @Miscellaneous { PeinerVFMABLBXDBKDH, subid = {1495}, title = {Long Slender Piezo-Resistive Silicon Microprobes for Fast Measurements of Roughness and Mechanical Properties inside Micro-Holes with Diameters below 100 µm}, journal = {Open Access Repository PTB}, number2 = {17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements}, keywords = {cantilever microprobe, high-speed, contact resonance, tip wear, piezo-resistive, mechanical damping, tip-testing standard, cantilevers, micromechanical devices, surface topography measurement, shape measurement}, web_url = {https://oar.ptb.de/resources/show/10.7795/720.20200515}, misc2 = {EMPIR 2017: Industry}, publisher = {Physikalisch-Technische Bundesanstalt (PTB)}, language = {30}, DOI = {10.7795/720.20200515}, stag_bib_extends_levelofaccess = {NA}, author = {Brand, U. and XU, M. and Doering, L. and Langfahl-Klabes, J. and Behle, H. and B{\"u}tefisch, S. and Ahbe, T. and Mickan, B. and Peiner, E. and V{\"o}llmeke, S. and Frank, T. and Kiselev, I. and Drexel, M. and Hauptmannl, M.} } @Proceedings { KarhaAMDI, subid = {2124}, title = {Differential spectral responsivity measurements of large bifacial solar cells}, journal = {Proceedings of NEWRAD 2021}, number2 = {19ENG01: Metro-PV: Metrology for emerging PV applications}, pages = {73 - 74}, keywords = {Solar cell, differential spectral responsivity, LED, Halogen lamp, Lock-in amplifier}, misc2 = {EMPIR 2019: Energy}, publisher = {Aalto University / NIST}, language = {30}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4882794}, author = {K{\"a}rh{\"a}, P. and Askola, J. and Maham, K. and D{\"o}nsberg, T. and Ikonen, E.} } @Miscellaneous { FurtadoPQSLMAARLBCLA, subid = {2053}, title = {First density comparison on viscoelastic samples by oscillation-type densimetry}, journal = {ACTA IMEKO}, volume = {9}, number2 = {17RPT02: rhoLiq: Establishing traceability for liquid density measurements}, pages = {79-84}, keywords = {density; viscoelasticity; oscillationtype densimetry: degree of equivalence; rhoLiq}, misc2 = {EMPIR 2017: Research Potential}, publisher = {IMEKO}, ISSN = {2221-870X}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4792271}, author = {Furtado, A. and Pereira, J. and Quendera, R. and Schiebl, M. and Lenard, E. and Malejczyk, E. and Alic, A. and Alisic, S. and Rauch, J. and Lorenz, F. and Bescupschii, A. and Ciubara, A. and Laky, B. and Ams{\"u}ss, R.} } @Miscellaneous { ZuccaFLFA, subid = {1888}, title = {Testing 3D modelling software. Modelling charging pads for WPT of electric vehicles for EM emissions simulation}, volume = {1}, number2 = {16ENG08: MICEV: Metrology for inductive charging of electric vehicles}, pages = {1-2}, keywords = {Validation software, Wireless power transfer, Electric Vehicle}, misc2 = {EMPIR 2016: Energy}, publisher = {CERN}, ISSN = {0000-0000}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/4476252}, author = {Zucca, M. and Freschi, F. and Liorni, I. and Fallahi, A. and Ankarson, P.} } @Miscellaneous { AqeelSTMMBBGPB, subid = {2456}, title = {Microwave spectroscopy of the low-temperature skyrmion state in Cu2OSeO3}, journal = {Physical Review Letters}, volume = {126}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {017202-1 - 017202-7}, keywords = {Lattice dynamics, Magnetic order, Magnetism, Magnetization dynamics, Skyrmions, Spin waves, Microwave techniques}, misc2 = {EMPIR 2017: Fundamental}, publisher = {American Physical Society}, DOI = {10.5281/zenodo.5793226}, stag_bib_extends_levelofaccess = {NA}, author = {Aqeel, A. and Sahliger, J. and Taniguchi, T. and M{\"a}ndl, S. and Mettus, D. and Berger, H. and Bauer, A. and Garst, M. and Pfleiderer, C. and Back, C.H.} } @Miscellaneous { RibeiroCSMLASBS, subid = {2012}, title = {EMUE-D4-1-WaterVolumeMeasurement}, number2 = {17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards}, keywords = {Measurement uncertainty; Water Supply Networks; Volume Totalization}, misc2 = {EMPIR 2017: Pre-Co-Normative}, DOI = {10.5281/zenodo.4700500}, stag_bib_extends_levelofaccess = {NA}, author = {Ribeiro, A.S. and Cox, M.G. and Sousa, J.A. and Martins, L.L. and Loureiro, D. and Almeida, M.C. and Silva, M.A. and Brito, R. and Soares, A.C.} } @Miscellaneous { AntonioDCM, subid = {1745}, title = {Dataset for publication ''Uncertainty Evaluation on the Absolute Phase Error of Digitizers''}, journal = {Zenodo}, volume = {1}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1}, keywords = {Phase measurement, digitizer, calibration, discrete Fourier transform, phasor measurement unit, synchrophasor, digital low power instrument transformer}, web_url = {https://zenodo.org/record/4319974}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, ISSN = {1}, DOI = {10.5281/zenodo.4319974}, stag_bib_extends_levelofaccess = {NA}, author = {Antonio, D.F. and Daniele, G. and Carmine, L. and Mario, L.} } @Miscellaneous { CrottiADDCM, subid = {1744}, title = {Dataset for publication ''Measurement of the Absolute Phase Error of Digitizers''}, journal = {Zenodo}, volume = {1}, number2 = {17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation}, pages = {1}, keywords = {Phase measurement, Clocks, Delay effects, Delays, Measurement uncertainty, Frequency measurement}, misc2 = {EMPIR 2017: Industry}, publisher = {Zenodo}, ISSN = {1}, DOI = {10.5281/zenodo.4319968}, stag_bib_extends_levelofaccess = {NA}, author = {Crotti, G. and Antonio, D.F. and Daniele, G. and Domenico, G. and Carmine, L. and Mario, L.} } @Miscellaneous { FernandezScarioniBCSHALRCKS, subid = {1799}, title = {Dataset associated with ''Thermoelectric signature of individual skyrmions''}, journal = {Zenodo}, volume = {N/A}, number2 = {17FUN08: TOPS: Metrology for topological spin structures}, pages = {N/A}, keywords = {skyrmions, anomalous Nernst effect, topological Nernst effect}, web_url = {https://zenodo.org/record/4322235\#.X_wh1RYxlaQ}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Zenodo}, ISSN = {N/A}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4322235}, author = {Fern{\'a}ndez Scarioni, A. and Barton, C. and Corte-Le{\'o}n, H. and Sievers, S. and Hu, X. and Ajejas, F. and Legrand, W. and Reyren, N. and Cros, V. and Kazakova, O. and Schumacher, H.W.} } @Miscellaneous { Aksulu, subid = {2050}, title = {Random Profile Data}, number2 = {18RPT01: ProbeTrace: Traceability for contact probe and stylus instrument measurements}, keywords = {Random noise, sine wave}, misc2 = {EMPIR 2018: Research Potential}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4481965}, author = {Aksulu, M.} } @Miscellaneous { Aksulu_2, subid = {2049}, title = {Profile Data for Stylus Device Calibration using Ball Standard}, number2 = {18RPT01: ProbeTrace: Traceability for contact probe and stylus instrument measurements}, keywords = {Surface roughness measurement device, calibration, ball standard}, misc2 = {EMPIR 2018: Research Potential}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.4471347}, author = {Aksulu, M.} } @Miscellaneous { AssoulineJBWTJGKRPR, subid = {2631}, title = {Excitonic nature of magnons in a quantum Hall ferromagnet}, journal = {Nature Physics}, volume = {17}, number2 = {17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements}, pages = {1369-1374}, keywords = {Graphene, p-n junction, interferometer, magnons}, web_url = {https://doi.org/10.5281/zenodo.6500310}, misc2 = {EMPIR 2017: Fundamental}, publisher = {Springer Science and Business Media LLC}, address = {Dordrecht, GX, Netherlands}, language = {30}, ISSN = {1745-2473, 1745-2481}, DOI = {10.1038/s41567-021-01411-z}, stag_bib_extends_levelofaccess = {NA}, author = {Assouline, A. and Jo, M. and Brasseur, P. and Watanabe, K. and Taniguchi, T. and Jolicoeur, Th. and Glattli, D. C. and Kumada, N. and Roche, P. and Parmentier, F. D. and Roulleau, P.} } @Miscellaneous { FerreroCBVSYACMT, subid = {2164}, title = {Dataset: Experimental and Modelling Analysis of the Hyperthermia Properties of Iron Oxide Nanocubes}, journal = {Zenodo}, number2 = {18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept}, keywords = {nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations}, misc2 = {EMPIR 2018: Health}, DOI = {10.5281/zenodo.5040394}, stag_bib_extends_levelofaccess = {NA}, author = {Ferrero, R. and Celegato, F. and Barrera, G. and Vicentini, M. and S{\"o}zeri, H. and Yıldız, N. and Atila Din\c{c}er, C. and Co{\"i}sson, M. and Manzin, A. and Tiberto, P.} } @Miscellaneous { AlKhafajiGWBV, subid = {2246}, title = {SAXS dataset and algorithms for the paper ''Particle Size Distribution of Bimodal Silica Nanoparticles: A Comparison of Different Measurement Techniques''}, journal = {Materials}, volume = {13}, number2 = {18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses}, pages = {3101}, keywords = {silica nanoparticle, size distribution, light scattering, small-angle X-ray scattering, microfluidic resistive pulse sensing}, misc2 = {EMPIR 2018: Health}, publisher = {Multidisciplinary Digital Publishing Institute}, ISSN = {1996-1944}, DOI = {10.5281/zenodo.4545822}, stag_bib_extends_levelofaccess = {NA}, author = {Al-Khafaji, M. and Ga{\'a}l, A. and Wacha, A. and B{\'o}ta, A. and Varga, Z.} } @Miscellaneous { RiemanAEBMSSRIF, subid = {2335}, title = {NeuroMET - SPECIAL MRS Reproducibility}, number2 = {18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases}, keywords = {magnetic resonance spectroscopy (MRS), 7T, Reproducibility, Repeatability, Neurochemicals}, web_url = {https://zenodo.org/record/5500320\#.YZ9eudDP1aS}, misc2 = {EMPIR 2018: Health}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.5500319}, author = {Rieman, L.T. and Aigner, C.S. and Ellison, S.L.R. and Br{\"u}hl, R. and Mekle, R. and Schmitter, S.. and Speck, O. and Rose, G. and Itterman, B. and Fillmer, A.} } @Miscellaneous { ArconesOAGK, subid = {2495}, title = {Dataset for publication: Error in the measurement of partial discharge pulses according to the frequency response of HFCT sensors}, journal = {2021 IEEE Electrical Insulation Conference (EIC)}, volume = {N/A}, number2 = {19ENG02: FutureEnergy: Metrology for future energy transmission}, pages = {242}, keywords = {sensor phenomena and characterization, performance evaluation, partial discharges, insulation testing, condition monitoring}, tags = {SEG}, misc2 = {EMPIR 2019: Energy}, publisher = {IEEE}, address = {N/}, language = {1}, ISSN = {N/A}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5913201}, author = {Arcones, E. and Ortego, J. and Alvarez, F. and Garnacho, F. and Kamlichi, A.} } @Miscellaneous { PanniAGT, subid = {2466}, title = {Sensor data set radial forging at AFRC testbed v2}, journal = {Zenodo}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {forming, forge, sensors, uncertainty, European Union (EU), Horizon 2020, EMPIR}, misc2 = {EMPIR 2017: Industry}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://doi.org/10.5281/zenodo.2573860}, author = {Panni, O. and Andonovic, I. and Gourlay, G. and Tachtatzis, C.} } @Miscellaneous { TachtatzisAG, subid = {2538}, title = {DOE1 and DOE2 - Sensor data set radial forging at AFRC testbed}, journal = {Zenodo}, number2 = {17IND12: Met4FoF: Metrology for the Factory of the Future}, keywords = {MEMS, Calibrations, European Union (EU), Horizon 2020, EMPIR}, misc2 = {EMPIR 2017: Industry}, stag_bib_extends_levelofaccess = {NA}, stag_bib_extends_persistent_identifier = {https://zenodo.org/record/5705521}, author = {Tachtatzis, C. and Andonovic, I. and Gourlay, G.} }