This file was created by the TYPO3 extension bib --- Timezone: CEST Creation date: 2022-08-15 Creation time: 03-34-31 --- Number of references 715 article AmicoTPSN2022 2720 Journal of Hazardous Materials 2022 7 433 19NRM03: SI-Hg: Metrology for traceable protocols for elemental and oxidised mercury concentrations 128823 Mercury determination, Microextraction techniques, Environmental monitoring, Exposomics studies, Green analytical chemistry (GAC), Sample preparation https://doi.org/10.1016/j.jhazmat.2022.128823 EMPIR 2019: Pre-Co-Normative Elsevier BV 30 0304-3894 10.1016/j.jhazmat.2022.128823 NA D.Amico A.Tassone N.Pirrone F.Sprovieri A.Naccarato article ChenKKSA2022 2782 arXiv 2022 6 15 arXiv:2105 June 2022 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 1-16 Resonant sensor, diamagnetic levitation, mass sensor, liquid sensing https://arxiv.org/abs/2105.12444 EMPIR 2017: Fundamental Cornell University 30 arXiv:2105.12444v2 NA https://arxiv.org/abs/2105.12444 X.Chen N.Kothari A.Keskekler P.G.Steeneken F.Alijani article ChenKAS2022 2783 arXiv 2022 6 15 arXiv:2006 June 2022 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 1-6 diamagnetically levitating resonators, low-noise oscillators and sensors EMPIR 2017: Fundamental Cornell University 30 arXiv:2006.01733v3 NA https://arxiv.org/abs/2006.01733 X.Chen A.Keskekler F.Alijani P.G.Steeneken article VolkovaHTBCMARERBPN2022 2712 Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 color centers, optical quantum technology EMPIR 2020: Fundamental MDPI 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov article VolkovaHTBCMARERBPN2022_2 2721 Nanomaterials 2022 4 29 12 9 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 1516 NV centers, diamond nano-pillars, fluorescence lifetime, ion implantation, optically detected magnetic resonance (ODMR), spin coherence time, spin relaxation time EMPIR 2020: Fundamental MDPI AG 30 2079-4991 10.3390/nano12091516 NA K.Volkova J.Heupel S.Trofimov F.Betz R.Colom R.W.MacQueen S.Akhundzada M.Reginka A.Ehresmann J.P.Reithmaier S.Burger C.Popov B.Naydenov article RubinSZHFABKLZA2022 2709 Metrologia 2022 4 14 59 3 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 035003 quantumpascal, GAMOR, optical pressure standard, gas refractometry, pV-work, Invar-based EMPIR 2018: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/ac5ef9 NA T.Rubin I.Silander J.Zakrisson M.Hao C.Forssén P.Asbahr M.Bernien A.Kussicke K.Liu M.Zelan O.Axner article UrbanA2022 2687 International Journal of Thermophysics 2022 3 19 43 5 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Specific heat, High-temperature, Hi-Trace, Induction heating, Uncertainty EMPIR 2017: Industry Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-022-03005-0 NA D.Urban K.Anhalt article KronerABBBCPSSUW2022 2643 Water Supply 2022 3 14 17IND13: Metrowamet: Metrology for real-world domestic water metering cold water meters, test regime, water quality, water meter accuracy EMPIR 2017: Industry IWA Publishing 30 1606-9749, 1607-0798 10.2166/ws.2022.133 NA C.Kroner B.Akselli M.Benkova A.Borchling O.Büker N.Christoffersen J.Pavlas D.Schumann V.Seypka B.Unsal H.Warnecke article MarlettoVKPBRAGDG2022 2679 Physical Review Letters 2022 2 23 128 8 20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology 080401 Quantum Foundations, Quantum Measurements, Quantum thermodynamics https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401 EMPIR 2020: Industry American Physical Society (APS)

Ridge, NY, United States

30 0031-9007, 1079-7114 10.1103/PhysRevLett.128.080401 NA C.Marletto V.Vedral L.T.Knoll F.Piacentini E.Bernardi E.Rebufello A.Avella M.Gramegna I.P.Degiovanni M.Genovese article MarlettoVKPBRAGDG20220 2679 Physical Review Letters 2022 2 23 128 8 17FUN06: SIQUST: Single-photon sources as new quantum standards 080401 Quantum Foundations, Quantum Measurements, Quantum thermodynamics https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401 EMPIR 2017: Fundamental American Physical Society (APS)

Ridge, NY, United States

30 0031-9007, 1079-7114 10.1103/PhysRevLett.128.080401 NA C.Marletto V.Vedral L.T.Knoll F.Piacentini E.Bernardi E.Rebufello A.Avella M.Gramegna I.P.Degiovanni M.Genovese article MarlettoVKPBRAGDG20221 2679 Physical Review Letters 2022 2 23 128 8 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 080401 Quantum Foundations, Quantum Measurements, Quantum thermodynamics https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.128.080401 EMPIR 2020: Fundamental American Physical Society (APS)

Ridge, NY, United States

30 0031-9007, 1079-7114 10.1103/PhysRevLett.128.080401 NA C.Marletto V.Vedral L.T.Knoll F.Piacentini E.Bernardi E.Rebufello A.Avella M.Gramegna I.P.Degiovanni M.Genovese article AguirreSM2022 2580 Micromachines 2022 2 19 13 2 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 330 memristor; resistive switching; memory; memdiode https://doi.org/10.3390/mi13020330 EMPIR 2020: Fundamental MDPI AG 30 2072-666X 10.3390/mi13020330 NA F.L.Aguirre J.Suñé E.Miranda article ForssenSZZA2022 2600 Journal of Optics 2022 2 17 24 3 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 033002 optical, pascal, Sweden, refractometry, pressure, Fabry–Perot https://iopscience.iop.org/article/10.1088/2040-8986/ac4ea2 EMPIR 2018: SI Broader Scope IOP Publishing 30 2040-8978, 2040-8986 10.1088/2040-8986/ac4ea2 NA C.Forssén I.Silander J.Zakrisson M.Zelan O.Axner article XuZAPB2022 2576 Sensors 2022 2 22 3 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements 1298 roughness measurement, piezoresistive microprobe, silicon fracture, tip characterization https://www.mdpi.com/1424-8220/22/3/1298 EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s22031298 NA M.XU Z.Zhou T.Ahbe E.Peiner U.Brand article ArrheniusFB2022 2685 Analytical and bioanalytical chemistry 2022 2 20IND10: Decarb: Metrology for decarbonising the gas grid Material compatibility, Renewable gases, Sampling EMPIR 2020: Industry Springer 30 10.1007/s00216-022-03949-0 NA K.Arrhenius L.Francini O.Büker article GuilloryTWA2022 2169 Precision Engineering 2022 1 73 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 214-227 Large volume metrologyAbsolute distance metreRetroreflecting glass spheresCoordinate measurement systemMultilateration technique with self-calibration EMPIR 2018: SI Broader Scope Elsevier BV 30 0141-6359 10.1016/j.precisioneng.2021.09.009 NA J.Guillory D.Truong J.-P.Wallerand C.Alexandre article GuilloryTWA2022_2 2172 Precision Engineering 2022 1 73 17IND03: LaVA: Large Volume Metrology Applications 214-227 Large Volume Metrology; Absolute Distance Metre; retroreflecting glass spheres; coordinate measurementsystem; multilateration technique with self-calibration. https://hal.archives-ouvertes.fr/hal-03349168v1 EMPIR 2017: Industry Elsevier BV 30 0141-6359 10.1016/j.precisioneng.2021.09.009 NA J.Guillory D.Truong J-P.Wallerand C.Alexandre article MinelliWBCIDGKMJMSFHTBNHRKHKRCAMGPOTJKHRLWSGSLLCBJAHLKKZGCCGlJBWFERDKPNOPBCHGGMFCTSTMPLASCTTPDGLFCGBVHKKPKGS2022 2764 Nanoscale 2022 14 12 18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration 4690-4704 nanoparticle, concentration, standardization, VAMAS, interlaboratory EMPIR 2018: Support for Impact Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/D1NR07775A NA C.Minelli M.Wywijas D.Bartczak S.Cuello-Nuñez H.G.Infante J.Deumer C.Gollwitzer M.Krumrey K.E.Murphy M.E.Johnson A.R.Montoro Bustos I.H.Strenge B.Faure P.Høghøj V.Tong L.Burr K.Norling F.Höök M.Roesslein J.Kocic L.Hendriks V.Kestens Y.Ramaye M.C.Contreras Lopez G.Auclair D.Mehn D.Gilliland A.Potthoff K.Oelschlägel J.Tentschert H.Jungnickel B.C.Krause Y.U.Hachenberger P.Reichardt A.Luch T.E.Whittaker M.M.Stevens S.Gupta A.Singh F-h.Lin Y-H.Liu A.L.Costa C.Baldisserri R.Jawad S.E.L.Andaloussi M.N.Holme T.G.Lee M.Kwak J.Kim J.Ziebel C.Guignard S.Cambier S.Contal A.C.Gutleb J.“Kuba” Tatarkiewicz B.J.Jankiewicz B.Bartosewicz X.Wu J.A.Fagan E.Elje E.Rundén-Pran M.Dusinska I.P.Kaur D.Price I.Nesbitt S.O′ Reilly R.J.B.Peters G.Bucher D.Coleman A.J.Harrison A.Ghanem A.Gering E.McCarron N.Fitzgerald G.Cornelis J.Tuoriniemi M.Sakai H.Tsuchida C.Maguire A.Prina-Mello A.J.Lawlor J.Adams C.L.Schultz D.Constantin N.T.K.Thanh L.D.Tung L.Panariello S.Damilos A.Gavriilidis I.Lynch B.Fryer A.Carrazco Quevedo E.Guggenheim S.Briffa E.Valsami-Jones Y.Huang A.A.Keller V-T.Kinnunen S.Perämäki Z.Krpetic M.Greenwood A.G.Shard article ArrheniusBSCGBB2021 2487 Processes 2021 12 24 10 1 19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2 20 sensors, hydrogen quality, FCEV, testing protocols EMPIR 2019: Energy MDPI AG 30 2227-9717 10.3390/pr10010020 NA K.Arrhenius T.Bacquart K.Schröter M.Carré B.Gozlan C.Beurey C.Blondeel article MiloroABBZFR2021 2444 International Journal of Hyperthermia 2021 12 22 39 1 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 57-68 HIFU; thermal ablation; quality control; phantom; thermal dosimetry https://www.tandfonline.com/doi/full/10.1080/02656736.2021.2017023 EMPIR 2018: Health Informa UK Limited 30 0265-6736, 1464-5157 10.1080/02656736.2021.2017023 NA PMiloro S.Ambrogio F.Bosio R.M.Baêsso B.Zeqiri F.Fedele K.V.Ramnarine article WooldridgeAZZCCB2021 2546 Physics in Medicine & Biology 2021 12 21 66 24 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 245024 MRI; finite element modelling; implant heating https://iopscience.iop.org/article/10.1088/1361-6560/ac3eab EMPIR 2017: Industry IOP Publishing 30 0031-9155, 1361-6560 10.1088/1361-6560/ac3eab NA J.Wooldridge A.Arduino L.Zilberti U.Zanovello M.Chiampi V.Clementi O.Bottauscio article ForssenSZZA2021 2351 Journal of Vacuum Science & Technology B 2021 12 39 6 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 065001 Refractometry, Fabry-Perot cavity, Penetration depth https://avs.scitation.org/doi/10.1116/6.0001501 EMPIR 2018: SI Broader Scope American Vacuum Society 30 2166-2746, 2166-2754 10.1116/6.0001501 NA C.Forssén I.Silander J.Zakrisson M.Zelan O.Axner article DizdarAV2021 2673 Measurement: Sensors 2021 12 18 18SIB08: ComTraForce: Comprehensive traceability for force metrology services 100216 Piezoelectric force sensor; Continuous force calibration https://www.sciencedirect.com/science/article/pii/S2665917421001793 EMPIR 2018: SI Broader Scope Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100216 NA H.Dizdar B.Aydemir C.Vatan article ZelenkaAHKPZM2021 2205 Measurement: Sensors 2021 12 18 19RPT02: RealMass: Improvement of the realisation of the mass scale 100228 Mass scale, Weights, Kilogram, Multiples and submultiples, Subdivision, OIML R111 EMPIR 2019: Research Potential Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100228 NA Z.Zelenka S.Alisic R.Hanrahan I.Kolozinsky G.Popa J.Zůda A.Malengo article LieberherrACCCGKMMMOSSTV2021 2368 Atmospheric Measurement Techniques 2021 12 14 12 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 7693-7706 bioaerosol monitors, calibration, counting efficiency, fluorescence https://amt.copernicus.org/articles/14/7693/2021/ EMPIR 2019: Environment Copernicus GmbH 30 1867-8548 10.5194/amt-14-7693-2021 NA G. Lieberherr K.Auderset B.Calpini B.Clot B.Crouzy M.Gysel-Beer T.Konzelmann J.Manzano A.Mihajlovic A.Moallemi D.O'Connor B.Sikoparija E.Sauvageat F.Tummon K.Vasilatou article BatistaFFGAAM2021 2277 Measurement: Sensors 2021 12 18 18HLT08: MEDDII: Metrology for drug delivery 100155 MicroflowFront trackingMethodPending drop methodMeasurement uncertainty EMPIR 2018: Health Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100155 NA E.Batista A.Furtado M. do C.Ferreira I.Godinho M.Alvares J.Afonso R.F.Martins article BatistaSAAM2021 2276 Measurement: Sensors 2021 12 18 18HLT08: MEDDII: Metrology for drug delivery 100152 Microflow measurementFront trackingCalibrationMeasurement uncertainty EMPIR 2018: Health Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100152 NA E.Batista J.A.Sousa M.Alvares J.Afonso R.F.Martins article AssoulineJBWTJGKRPR2021 2371 Nature Physics 2021 12 17 12 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 1369-1374 Graphene, mangons, interferometry, p-n-junction https://arxiv.org/abs/2102.02068 EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 1745-2473, 1745-2481 10.1038/s41567-021-01411-z NA A.Assouline M.Jo P.Brasseur K.Watanabe T.Taniguchi Th.Jolicoeur D.C.Glattli N.Kumada P.Roche F.D.Parmentier P.Roulleau article OgrincRDBMBKOAGQMUOG2021 2701 Measurement: Sensors 2021 12 18 20NET02: Food-MetNet: Support for a European Metrology Network on Food Safety 100285 Food; Metrology; Network; Safety; Stakeholders EMPIR 2020: Support for Networks Elsevier BV 30 2665-9174 10.1016/j.measen.2021.100285 NA N.Ogrinc A.M.Rossi F.Durbiano R.Becker M.Milavec A.Bogožalec Košir E.Kakoulides H.Ozer F.Akçadag H.Goenaga-Infante M.Quaglia S.Mallia G.Umbricht G.O'Connor B.Guettler article RottgerVSPDISBAGGBWPiN2021 2317 Advances in Geosciences 2021 11 17 57 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation 1-7 supportBSS, EMN for Radiation Protection, metrology, regulation, EURAMET, EURATOM EMPIR 2019: Support for Networks Copernicus GmbH 30 1680-7359 10.5194/adgeo-57-1-2021 NA A.Röttger A.Veres V.Sochor M.Pinto M.Derlacinski M-R.Ioan A.Sabeta R.Bernat C.Adam-Guillermin J.H.Gracia Alves D.Glavič-Cindro S.Bell B.Wens L.Persson M.Živanović R.Nylund article RiemannAEBMSSRIF2021 2569 Magnetic Resonance in Medicine 2021 11 16 87 3 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 1119-1135 CRLBs, measurement precision, minimal detectable change, MR spectroscopy, reproducibility/repeatability, SPECIAL https://onlinelibrary.wiley.com/doi/10.1002/mrm.29034 EMPIR 2018: Health Wiley 30 0740-3194, 1522-2594 10.1002/mrm.29034 NA L.T.Riemann C.S.Aigner S.L.R.Ellison R.Brühl R.Mekle S.Schmitter O.Speck G.Rose B.Ittermann A.Fillmer article RagusaAFd2021 2397 AIP Advances 2021 11 11 11 19ENG06: HEFMAG: Metrology of magnetic losses in electrical steel sheets for high-efficiency energy conversion 115208 Magnetic hysteresis,Magnetic properties,Electrical grid,Magnetization dynamics,Eddy current,Magnetic materials,Magneto-optical imaging,Transformer Ferromagnetic materials EMPIR 2019: Energy AIP

College Park, Maryland

30 2158-3226 10.1063/5.0066131 NA C.Ragusa C.Appino E.Ferrara O.de la Barrière article HuiMZAABBBBBBBBBBCCCCCCCCDdDDDDDDEEEEFFFGGGGHHHHHHHJJJJJKKLLLLLLLLMMMMMMMMMNNNNOOOPPPPPPPPPRRRRRROSSSSSSSSSSSSSTTTTTTTvVVVWWWWWWWWXLYZZZE2021 2336 NeuroImage 2021 11 241 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases 118430 Magnetic resonance spectroscopy (MRS), Frequency drift, 3T, Press, Multi-vendor, Multi-site EMPIR 2018: Health Elsevier BV 30 1053-8119 10.1016/j.neuroimage.2021.118430 NA S.C.N.Hui M.Mikkelsen H.J.Zöllner V.Ahluwalia S.Alcauter L.Baltusis D.A.Barany L.R.Barlow R.Becker J.I.Berman A.Berrington P.K.Bhattacharyya J.U.Blicher W.Bogner M.S.Brown V.D.Calhoun R.Castillo K.M.Cecil Y.B.Choi W.C.W.Chu W.T.Clarke A.R.Craven K.Cuypers M.Dacko C.de la Fuente-Sandoval P.Desmond A.Domagalik J.Dumont N.W.Duncan U.Dydak K.Dyke D.A.Edmondson G.Ende L.Ersland C.J.Evans A.S.R.Fermin A.Ferretti A.Fillmer T.Gong I.Greenhouse J.T.Grist M.Gu A.D.Harris K.Hat S.Heba E.Heckova J.P.Hegarty K-F.Heise S.Honda A.Jacobson J.F.A.Jansen C.W.Jenkins S.J.Johnston C.Juchem A.Kangarlu A.B.Kerr K.Landheer T.Lange P.Lee S.R.Levendovszky C.Limperopoulos F.Liu W.Lloyd D.J.Lythgoe M.G.Machizawa E.L.MacMillan R.J.Maddock A.V.Manzhurtsev M.L.Martinez-Gudino J.J.Miller H.Mirzakhanian M.Moreno-Ortega P.G.Mullins S.Nakajima J.Near R.Noeske W.Nordhøy G.Oeltzschner R.Osorio-Duran M.C.G.Otaduy E.H.Pasaye R.Peeters S.J.Peltier U.Pilatus N.Polomac E.C.Porges S.Pradhan J.J.Prisciandaro N.A.Puts C.D.Rae F.Reyes-Madrigal T.P.L.Roberts C.E.Robertson J.T.Rosenberg D-G.Rotaru R.L.O'Gorman Tuura M.G.Saleh K.Sandberg R.Sangill K.Schembri A.Schrantee N.A.Semenova D.Singel R.Sitnikov J.Smith Y.Song C.Stark D.Stoffers S.P.Swinnen R.Tain C.Tanase S.Tapper M.Tegenthoff T.Thiel M.Thioux P.Truong P.van Dijk N.Vella R.Vidyasagar A.Vovk G.Wang L.T.Westlye T.K.Wilbur W.R.Willoughby M.Wilson H-J.Wittsack A.J.Woods Y-C.Wu J.Xu M.Y.Lopez D.K.W.Yeung Q.Zhao X.Zhou G.Zupan R.A.E.Edden article DubovikFLLLDXDCTDLHHKMSEPLFPCKCAMBHLHF2021 2365 Frontiers in Remote Sensing 2021 10 19 2 19ENV04: MAPP: Metrology for aerosol optical properties GRASP, Radiative Transfer, Inversion model https://www.frontiersin.org/articles/10.3389/frsen.2021.706851/full EMPIR 2019: Environment Frontiers Media SA 30 2673-6187 10.3389/frsen.2021.706851 NA O.Dubovik D.Fuertes P.Litvinov A.Lopatin T.Lapyonok I.Doubovik F.Xu F.Ducos C.Chen B.Torres Y.Derimian L.Li M.Herreras-Giralda M.Herrera Y.Karol C.Matar G.L.Schuster R.Espinosa A.Puthukkudy Z.Li J.Fischer R.Preusker J.Cuesta A.Kreuter A.Cede M.Aspetsberger D.Marth L.Bindreiter A.Hangler V.Lanzinger C.Holter C.Federspiel article ArrheniusABMBWBGLCSBNR2021 2482 International Journal of Hydrogen Energy 2021 10 11 46 70 19ENG04: MetroHyVe 2: Metrology for hydrogen vehicles 2 34839-34853 Hydrogen,Refuelling stations,Sampling device,Fuel quality assessment https://www.sciencedirect.com/science/article/pii/S0360319921031694 EMPIR 2019: Energy Elsevier 30 0360-3199 10.1016/j.ijhydene.2021.08.043 NA K.Arrhenius T.A.Aarhaug T.Bacquart A.Morris S.Bartlett L.Wagner C.Blondeel B.Gozlan Y.Lescornes N.Chramosta C.Spitta E.Basset Q.Nouvelot M.Rizand article FrigoA2021 2322 Metrology 2021 10 1 2 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 93-106 measuring bridge; calibration; non-conventional instrument transformer; sampled values;digital output; synchronization https://www.mdpi.com/2673-8244/1/2/7 EMPIR 2017: Industry MDPI AG

Basel, Switzerland

30 2673-8244 10.3390/metrology1020007 NA G.Frigo M.Agustoni article SteindlSABK2021 2345 New Journal of Physics 2021 10 23 10 17FUN06: SIQUST: Single-photon sources as new quantum standards 103029 Quantum Dots, carrier dynamics, optical spectroscopy, memory devices EMPIR 2017: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ac2bd6 NA P.Steindl E.M.Sala B.Alén D.Bimberg P.Klenovský article SteindlSABK20210 2345 New Journal of Physics 2021 10 23 10 20FUN05: SEQUME: Single- and entangled photon sources for quantum metrology 103029 Quantum Dots, carrier dynamics, optical spectroscopy, memory devices EMPIR 2020: Fundamental IOP Publishing 30 1367-2630 10.1088/1367-2630/ac2bd6 NA P.Steindl E.M.Sala B.Alén D.Bimberg P.Klenovský article SteindlSABK20211 2345 New Journal of Physics 2021 10 23 10 20IND05: QADeT: Quantum sensors for metrology based on single-atom-like device technology 103029 Quantum Dots, carrier dynamics, optical spectroscopy, memory devices EMPIR 2020: Industry IOP Publishing 30 1367-2630 10.1088/1367-2630/ac2bd6 NA P.Steindl E.M.Sala B.Alén D.Bimberg P.Klenovský article CorderoVALPP2021 2259 Phys. Rev. A 2021 10 104 4 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 042401 Quantum Optics, non-classical correlations, quantum metrology EMPIR 2017: Fundamental American Physical Society 30 2469-9934 NA https://arxiv.org/abs/2107.14265 O.Cordero A.Villegas J.R.Alvarez R. de J.Leon Montiel M.H.M. Passos JuanP. Torres article AguirrePPMSM2021 2451 Electronics 2021 10 10 19 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 2427 stuck-at fault; RRAM; pattern recognition; memristor; QMM; neural network; neuromorphics https://www.mdpi.com/2079-9292/10/19/2427 EMPIR 2020: Fundamental MDPI AG 30 2079-9292 10.3390/electronics10192427 NA F.L.Aguirre S.M.Pazos F.Palumbo A.Morell J.Suñé E.Miranda article RottgerRGVCOHCCBIRKCAYFMM2021 2224 Measurement Science and Technology 2021 9 23 19ENV01: traceRadon: Radon metrology for use in climate change observation and radiation protection at the environmental level radon, metrology, tracer, environmental measurements EMPIR 2019: Environment IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac298d NA A.Röttger S.Röttger C.Grossi A.Vargas R.Curcoll P.Otáhal M.Á.Hernández-Ceballos G.Cinelli S.Chambers S.A.Barbosa M-R.Ioan I.Radulescu D.Kikaj E.Chung T.Arnold C.Yver Kwok M.Fuente F.Mertes V.Morosh article AguirrePPSM2021 2450 Frontiers in Physics 2021 9 23 9 20FUN06: MEMQuD: Memristive devices as quantum standard for nanometrology 735021 RRAM, resistive switching, cross-point, memristor, neuromorphic, pattern recognition, write-verify,frequency https://www.frontiersin.org/articles/10.3389/fphy.2021.735021/full EMPIR 2020: Fundamental Frontiers Media SA 30 2296-424X 10.3389/fphy.2021.735021 NA F.L.Aguirre S.M.Pazos F.Palumbo J.Suñé E.Miranda article ForssenSZAZ2021 2174 Sensors 2021 9 18 21 18 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 6272 refractometry,pressure, short-term performance,Fabry–Perot cavity, gas modulation, modulation techniques, metrology https://www.mdpi.com/1424-8220/21/18/6272 EMPIR 2018: SI Broader Scope MDPI AG 30 1424-8220 10.3390/s21186272 NA C.Forssén I.Silander J.Zakrisson O.Axner M.Zelan article ArduiniMSEH2021 2199 Sensors 2021 9 17 21 18 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties 6252 emissivity, reflectivity, infrared radiation, high temperature, FTIR-spectrometer, blackbody,uncertainty, X-point, inductive heating, direct radiative method EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s21186252 NA M.Arduini J.Manara T.Stark H-P.Ebert J.Hartmann article LainelaLHCACS2021 2180 Water 2021 9 15 13 18 17FUN09: UnipHied: Realisation of a Unified pH Scale 2522 acidity;seawater;pH scales; unified scaleabsolute pHdifferential potentiometric measurementsminimization of liquid junction potential ionic liquid salt bridgesresidual liquid junction potential EMPIR 2017: Fundamental MDPI AG 30 2073-4441 10.3390/w13182522 NA S.Lainela I.Leito A.Heering G.Capitaine B.Anes F.Camões D.Stoica article LainelaLHCACS2021_2 2288 Water 2021 9 15 13 18 17FUN09: UnipHied: Realisation of a Unified pH Scale 2522 acidity; seawater; pH scales; unified scale; absolute pH; differential potentiometric measurements; minimization of liquid junction potential; ionic liquid salt bridges; residual liquid junction potential EMPIR 2017: Fundamental MDPI AG 30 2073-4441 10.3390/w13182522 NA S.Lainela I.Leito A.Heering G.Capitaine B.Anes F.Camões D.Stoica article VasilatouWKHISSSWA2021 2082 Journal of Aerosol Science 2021 9 157 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 105818 calibration, aerosol spectrometers, PSL particles, primary standard, particle number concentration EMPIR 2019: Environment Elsevier BV 30 0021-8502 10.1016/j.jaerosci.2021.105818 NA K.Vasilatou C.Wälchli S.Koust S.Horender K.Iida H.Sakurai F.Schneider J.Spielvogel T.Y.Wu K.Auderset article YamakawaATBFBKRD2021 2038 Chemosphere 2021 9 279 16ENV01: MercOx: Metrology for oxidised mercury 130631 Hg isotopic composition, spruce shoots, Hg atmospheric monitoring EMPIR 2016: Environment Elsevier BV 30 0045-6535 10.1016/j.chemosphere.2021.130631 NA A.Yamakawa D.Amouroux E.Tessier S.Bérail I.Fettig J.P.G.Barre J.Koschorreck H.Rüdel O.F.X.Donard article AlegriaL2021 2166 Journal of Instrumentation 2021 9 16 09 16ENV04: Preparedness: Metrology for mobile detection of ionising radiation following a nuclear or radiological incident P09018 Radiation monitoring; Real-time monitoring; Spectrometers; Scintillators and scintillatingfibres and light guides EMPIR 2016: Environment IOP Publishing 30 1748-0221 10.1088/1748-0221/16/09/P09018 NA N.Alegria F.Legarda article FerreroBCVHYACMT2021 2146 Nanomaterials 2021 8 25 11 9 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 2179 nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations EMPIR 2018: Health MDPI 30 2079-4991 10.3390/nano11092179 NA R.Ferrero G.Barrera F.Celegato M.Vicentini H.Hüseyin N.Yıldız C.Atila Dinçer M.Coïsson A.Manzin P.Tiberto article SteenekenDDAv2021 2239 2D Materials 2021 8 12 8 4 17FUN05: PhotOQuant: Photonic and Optomechanical Sensors for Nanoscaled and Quantum Thermometry 042001 2D material, dynamics, mechanics, graphene, NEMS https://arxiv.org/ct?url=https%3A%2F%2Fdx.doi.org%2F10.1088%2F2053-1583%2Fac152c&v=8246bcbf EMPIR 2017: Fundamental IOP Publishing 30 2053-1583 10.1088/2053-1583/ac152c NA P.G.Steeneken R.J.Dolleman D.Davidovikj F.Alijani H.S.J.van der Zant article AhlawatSGTW2021 2479 Metrologia 2021 8 5 58 5 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 8 Faraday cup aerosol electrometer, CPC calibration, inter-comparison https://iopscience.iop.org/journal/0026-1394 EMPIR 2016: Environment IOP Publishing Ltd 30 1681-7575 10.1088/1681-7575/ac0710 NA A.Ahlawat S.Seeger M.Gottschalk T.Tuch A.Wiedensohler article EdlerBGJTAASZ2021 2137 International Journal of Thermophysics 2021 8 42 11 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 1-13 Noble metal thermocouples, Reference function, Thermoelectric stability and homogeneity https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf. EMPIR 2017: Industry Springer Science and Business Media LLC 30 0195-928X, 1572-9567 10.1007/s10765-021-02895-w NA F.Edler J.Bojkovski C.Garcia Izquerdo M.Jose Martin D.Tucker N.Arifovic S.L.Andersen L.Šindelárová V.Žužek article RadtkeCKLSDAHNVRQLDBUL2021 2285 Pure and Applied Chemistry 2021 7 30 93 9 17FUN09: UnipHied: Realisation of a Unified pH Scale 1049-1060 Chemical potential; differential potentiometry; intersolvental;liquid junction potential; pH; traceability EMPIR 2017: Fundamental Walter de Gruyter GmbH 30 0033-4545, 1365-3075 10.1515/pac-2019-0504 NA V.Radtke F.Camões I.Krossing I.Leito D.Stoica L.Deleebeeck B.Anes A.Heering T.Näykki S.Veltzé M.Roziková R.Quendera L.Liv N.Dániel F.Bastkowski E.Uysal N.Lawrence article RibeiroACSMLBSS2021 2198 Metrologia 2021 7 23 58 4 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards 044001 measurement uncertainty, rainfall, precipitation, estimating, arithmetic mean method, Thiessen polygon method, isohyetal method EMPIR 2017: Pre-Co-Normative IOP Publishing

Bristol, United Kingdom

30 0026-1394, 1681-7575 10.1088/1681-7575/ac0d49 NA A.S.Ribeiro M.C.Almeida M.G.Cox J.A.Sousa L.Martins D.Loureiro R.Brito M.Silva A.C.Soares article tenHaveAHPMSL2021 2120 IEEE Transactions on Electromagnetic Compatibility 2021 7 12 1 1 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters 1-8 Electromagnetic interference (EMI), nonlinear waveforms, on-site survey, static energy meters, time domain. SEG EMPIR 2017: Pre-Co-Normative Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9375, 1558-187X 10.1109/TEMC.2021.3089877 NA B.ten Have M.A.Azpurua T.Hartman M.Pous N.Moonen F.Silva F.Leferink article SilanderFZZA2021 2110 Journal of Vacuum Science & Technology B 2021 7 39 4 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 044201 Refractomtery, Fabry-Perot cavity, GAMOR, Accuracy https://avs.scitation.org/doi/10.1116/6.0001042 EMPIR 2018: SI Broader Scope American Vacuum Society 30 2166-2746, 2166-2754 10.1116/6.0001042 NA I.Silander C.Forssén J.Zakrisson M.Zelan O.Axner article AxnerFSZZ2021 2135 Journal of the Optical Society of America B 2021 7 38 8 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 2419-2436 Refractometry, Pascal, Pressure, Fabry-Perot cavity, Gas modulation, GAMOR, drifts, EMPIR 2018: SI Broader Scope The Optical Society of America 30 0740-3224, 1520-8540 10.1364/JOSAB.420982 NA O.Axner C.Forssén I.Silander J.Zakrisson M.Zelan article CrouzierDDASH2021 2045 Ultramicroscopy 2021 7 226 July 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements 113300 SEMElectron landing energyNanoparticlesDimensional propertiesMetrology https://reader.elsevier.com/reader/sd/pii/S0304399121000875?token=909C79CE3C3F38B3A66DB9C19F03753326F07A8C27AA6D2752B29C970B6044F466C12F79E394D396CE7598E6F1497E2E&originRegion=eu-west-1&originCreation=20210517160957 EMPIR 2017: Pre-Co-Normative Elsevier BV 30 0304-3991 10.1016/j.ultramic.2021.113300 NA L.Crouzier A.Delvallée L.Devoille S.Artous F.Saint-Antonin N.Feltin article AmerWJA2021 2343 Sensors 2021 6 29 21 13 17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures 4470 dynamic pressure, shock tube, fast-opening valve, repeatability https://www.mdpi.com/1424-8220/21/13/4470 EMPIR 2017: Industry MDPI AG 30 1424-8220 10.3390/s21134470 NA E.Amer M.Wozniak G.Jönsson F.Arrhén article PrzyklenkBOEYAFPZCMRB2021 2104 Measurement Science and Technology 2021 6 21 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing Advance Manufacturing, Metrology, European Metrology Networks (EMN), Strategic Research Agenda (SRA), Stakeholder EMPIR 2019: Support for Networks IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ac0d25 NA A.Przyklenk A.Balsamo D.O'Connor A.Evans T.Yandayan A.Akgöz O.Flys D.Phillips V.Zelený D.Czułek F.Meli C.Ragusa H.Bosse proceedings PrzyklenkBOEYAFZCPMRB2021 2123 Proceedings 21st euspen International Conference and Exhibition 2021 6 2021 19NET01: AdvManuNet: Support for a European Metrology Network on advanced manufacturing advanced manufacturing, metrology, European metrology networks (EMN), Strategic Research Agenda (SRA), stakeholder, Industry 4.0 EMPIR 2019: Support for Networks Online Conference 21st euspen International Conference and Exhibition 07-06-2021 to 10-06-2021 30 NA https://www.euspen.eu/knowledge-base//ICE21292.pdf A.Przyklenk A.Balsamo D.O’Connor A.Evans T.Yandayan S.Akgöz O.Flys V.Zelený D.Czułek D.Phillips F.Meli C.Ragusa H.Bosse article KhamlichiGOAR2021 2488 2021 IEEE Electrical Insulation Conference (EIC) 2021 6 . . 19ENG02: FutureEnergy: Metrology for future energy transmission . sensor phenomena and characterization, performance evaluation, partial discharges, insulation testing,condition monitoring SEG https://zenodo.org/record/5906679 EMPIR 2019: Energy IEEE 30 2576-6791 10.1109/EIC49891.2021.9612353 NA A.Khamlichi F.Garnacho J.Ortego F.Alvarez J.Rovira proceedings ArsovicMS2021 2610 euspen’s 21st International Conference & Exhibition, Copenhagen, DK, June 2021 2021 6 17NRM03: EUCoM: Standards for the evaluation of the uncertainty of coordinate measurements in industry Coordinate measuring machine, measurement uncertainty, contact scanning probing mode https://www.euspen.eu/knowledge-base/ICE21150.pdf EMPIR 2017: Pre-Co-Normative Virtual Conference - Copenhagen, Denmark euspen’s 21st International Conference & Exhibition 07-06-2021 to 10-06-2021 30 10.5281/zenodo.6323538 NA A.Arsovic M.Menoncin E.Savio article RebufelloPASGDCVDG2021 2446 Light: Science & Applications 2021 5 25 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Quantum Measurement, Weak Values, Single Photons, Quantum Metrology EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2047-7538 10.1038/s41377-021-00539-0 NA E.Rebufello F.Piacentini A.Avella M.A. deSouza M.Gramegna J.Dziewior E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article XuLAP2021 2295 Journal of Lightwave Technology 2021 5 21 39 10 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 3106-3111 Optical fiber link, ultrastable frequency transfer, two-way noise compensation, polarization mode dispersion, reciprocity, non-reciprocity. EMPIR 2018: SI Broader Scope Paul-Eric Pottie 30 1094-4087 10.1364/OE.420661 NA D.Xu O.Lopez A.Amy-Klein P-E.Pottie article XuLAP2021_2 2294 Journal of Lightwave Technology 2021 5 15 39 10 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 3106-3111 Optical fiber link, ultrastable frequency trans- fer, two-way noise compensation, polarization mode dispersion, polarization scrambler EMPIR 2018: SI Broader Scope Paul-Eric Pottie 30 0733-8724, 1558-2213 10.1109/JLT.2021.3057804 NA D.Xu O.Lopez A.Amy-Klein P-E.Pottie proceedings PhungA2021_2 2287 2021 IEEE 25th Workshop on Signal and Power Integrity (SPI) 2021 5 10 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 1-4 coplanar waveguides, leakage, radiation, surface waves https://oar.ptb.de/files/download/618907218e2a000011003f97 EMPIR 2018: SI Broader Scope IEEE Siegen, Germany 2021 IEEE 25th Workshop on Signal and Power Integrity (SPI) 10-05-2021 to 12-05-2021 30 10.1109/SPI52361.2021.9505192 NA G.N.Phung U.Arz article KazemipourHWHRSAGZ2021 2048 IEEE Transactions on Instrumentation and Measurement 2021 5 70 N/A 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 1007310 Material characterization, measurement uncertainty, parameter extraction, standard load, vector network analyzer (VNA) time gating EMPIR 2018: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2021.3077660 NA A.Kazemipour J.Hoffmann M.Wollensack M.Hudlicka J.Rüfenacht D.Stalder D.Allal G.Gäumann M.Zeier article RebufelloPALVTGBCVDG2021 2447 Applied Sciences 2021 5 11 9 17FUN06: SIQUST: Single-photon sources as new quantum standards 4260 Quantum Measurement, Weak Measurement, Quantum Metrology, Single Photons EMPIR 2017: Fundamental MDPI AG 30 2076-3417 10.3390/app11094260 NA E.Rebufello F.Piacentini A.Avella R.Lussana F.Villa A.Tosi M.Gramegna G.Brida E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article AxnerSFZZ2021 1990 Spectrochimica Acta Part B: Atomic Spectroscopy 2021 5 179 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 106121 Gas modulation refractometry (GAMOR)Fabry-Perot cavityPrecisionAccuracyGas molar (or number) density EMPIR 2018: SI Broader Scope Elsevier BV 30 0584-8547 10.1016/j.sab.2021.106121 NA O.Axner I.Silander C.Forssén J.Zakrisson M.Zelan article NagelLASDL2021 2440 Journal of Clinical Medicine 2021 4 20 10 8 18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management electrophysiological simulation, atrial cohort modeling, 12-lead ECG, P wave, atrial fibrosis, atrial fibrillation https://www.mdpi.com/2077-0383/10/8/1797/htm EMPIR 2018: Health MDPI 30 10.3390/jcm10081797 NA C.Nagel G.Luongo L.Azzolin S.Schuler O.Dössel A.Loewe article Arduino2021 2004 Applied Sciences 2021 4 Latest Adv 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers electric properties tomography; open-source software; magnetic resonance imaging; quantitative imaging EMPIR 2018: Health 30 2076-3417 10.3390/app11073237 NA A.Arduino article ChaudharyMAOMPB2021 2656 Frontiers in Physics 2021 4 9 1 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates protontherapy, cancer, radiobiology, laser-driven ions, particle accelerator, ultra-high dose rate EMPIR 2018: Health Frontiers Media SA 30 2296-424X 10.3389/fphy.2021.624963 NA P.Chaudhary G.Milluzzo H.Ahmed B.Odlozilik A.McMurray K.M.Prise M.Borghesi article JoBAFSWTDRGKPR2021 2125 Physical Review Letters 2021 4 126 14 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 146803 Graphene, electron interferometer, Mach-Zehnder, Quantum Hall Valley Beam Splitter https://arxiv.org/abs/2011.04958 EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.126.146803 NA M.Jo P.Brasseur A.Assouline G.Fleury H-S.Sim K.Watanabe T.Taniguchi W.Dumnernpanich P.Roche D.C.Glattli N.Kumada F.D.Parmentier P.Roulleau article GruberBALBPCPDTCFSQ2021 2028 Journal of the European Radon Association 2021 3 31 2 2021 16ENV10: MetroRADON: Metrology for radon monitoring 1-14 radon, mapping, prediction, interpolation, radon priority areas, risk, hazard https://radonjournal.net/index.php/radon/article/view/5755 EMPIR 2016: Environment European Radon Association 30 2736-2272 10.35815/radon.v2.5755 NA V.Gruber S.Baumann O.Alber C.Laubichler P.Bossew E.Petermann G.Ciotoli A.Pereira F.Domingos F.Tondeur G.Cinelli A.Fernandez C.Sainz L.Quindos-Poncela article PanuTTMAKF2021 2201 Measurement Science and Technology 2021 3 26 32 5 17IND09: MetAMCII: Metrology for Airborne Molecular Contaminants II 055206 gas sensing, photoacoustic spectroscopy, laser, bismuth, fibre, cleanroom EMPIR 2017: Industry IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/abd651 NA H.Panu R.Timo F.Thomas J.Makkonen S.Alyshev A.Kharakhordin S.Firstov article SilvaniATC2021 2021 Applied Sciences 2021 3 25 11 7 17FUN08: TOPS: Metrology for topological spin structures 2929 Micromagnetism, DMI, Magnetic dots EMPIR 2017: Fundamental MDPI AG 30 2076-3417 10.3390/app11072929 NA R.Silvani M.Alunni S.Tacchi G.Carlotti article AsconeKWKK2021_2 2541 Scientific Reports 2021 3 12 11 1 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources 5814-5823 air-borne ultrasound, noise assessment, functional magnetic resonance imaging EMPIR 2015: Health Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-021-83527-z NA L.Ascone C.Kling J.Wieczorek C.Koch S.Kühn article SeegerOCGSSOALGFGKB2021 2069 Atmosphere 2021 2 21 12 3 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 309-326 TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS EMPIR 2019: Environment MDPI 30 EISSN 2073-4433 10.3390/atmos12030309 NA S.Seeger J.Osán O.Czömpöly A.Gross H.Stoßnach L.Stabile M.Ochsenkuehn-Petropoulou L.Areti Tsakanika T.Lymperopoulou S.Goddard M.Fiebig F.Gaie-Levrel Y.Kayser B.Beckhoff article SeegerOCGSSOALGFGKB20210 2069 Atmosphere 2021 2 21 12 3 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 309-326 TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS EMPIR 2016: Environment MDPI 30 EISSN 2073-4433 10.3390/atmos12030309 NA S.Seeger J.Osán O.Czömpöly A.Gross H.Stoßnach L.Stabile M.Ochsenkuehn-Petropoulou L.Areti Tsakanika T.Lymperopoulou S.Goddard M.Fiebig F.Gaie-Levrel Y.Kayser B.Beckhoff article SeegerOCGSSOALGFGKB20211 2069 Atmosphere 2021 2 21 12 3 19ENV08: AEROMET II: Advanced aerosol metrology for atmospheric science and air quality 309-326 TXRF, reference method, cascade impactor, ambient aerosols, particles, air qualitymonitoring, element mass concentration, size resolved chemical composition, time resolved chemicalcomposition, ICP-MS EMPIR 2019: Environment MDPI 30 EISSN 2073-4433 10.3390/atmos12030309 NA S.Seeger J.Osán O.Czömpöly A.Gross H.Stoßnach L.Stabile M.Ochsenkuehn-Petropoulou L.Areti Tsakanika T.Lymperopoulou S.Goddard M.Fiebig F.Gaie-Levrel Y.Kayser B.Beckhoff manual BrunaRomeroPLHFCBAZZG2021 1907 2021 2 17 16ENG08: MICEV: Metrology for inductive charging of electric vehicles Dosimetry, Guidelines, Magnetic field measurements, Magnetic field calculation, Numerical models, Uncertainty, Wireless Power Transfer, Electric Vehicle https://www.micev.eu/theme/inrim/assets/doc/BPG_Micev_2021.pdf EMPIR 2016: Energy INRIM 30 NA ISBN: 978-88-945324-1-8 J.Bruna Romero L.Pichon E.Laporta S.Harmon F.Freschi B.Clarke O.Bottauscio P.Ankarson L.Zilberti M.Zucca R.Guilizzoni article HorenderAQSNDSWAKGV2021 1901 Atmospheric Measurement Techniques 2021 2 16 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality ambient-like aerosols, particulate matter, calibration , PM monitors https://amt.copernicus.org/articles/14/1225/2021/amt-14-1225-2021.html EMPIR 2016: Environment 30 10.5194/amt-14-1225-2021 NA S.Horender K.Auderset P.Quincey S.Seeger S.Nielsen Skov K.Dirscherl T.O.M.Smith K.Williams C.C. Aegerter D.M. Kalbermatter F.Gaie-Levrel K.Vasilatou article FernandezScarioniBCSHALRCKS2021 2055 Physical Review Letters 2021 2 16 126 7 17FUN08: TOPS: Metrology for topological spin structures 1-6/077202 Magnetism, Nernst effect, Skyrmions, Thermomagnetic effects EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.126.077202 NA A.Fernández Scarioni C.Barton H.Corte-León S.Sievers X.Hu F.Ajejas W.Legrand N.Reyren V.Cros O.Kazakova H.W.Schumacher article GarciaAsenjoBAG2021 1924 Sensors 2021 2 21 4 18SIB01: GeoMetre: Large-scale dimensional measurements for geodesy 1145 Global Navigation Satellite Systems (GNSS), length; metrology, multipath https://www.mdpi.com/1424-8220/21/4/1145 EMPIR 2018: SI Broader Scope MDPI AG 30 1424-8220 10.3390/s21041145 NA L.García-Asenjo S.Baselga C.Atkins P.Garrigues article AsconeKWKK2021 2540 Scientific Reports 2021 2 11 1 15HLT03: Ears II: Metrology for modern hearing assessment and protecting public health from emerging noise sources 3190 - 3199 infrasound, long-time study, functional magnetic resonance imaging EMPIR 2015: Health Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-021-82203-6 NA L.Ascone C.Kling J.Wieczorek C.Koch S.Kühn article ShalmZBSSMAAMAFOMNK2021 2736 Nature Physics 2021 1 28 17 4 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 452-456 Bell inequality test, Entangled photons EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 1745-2473, 1745-2481 NA https://arxiv.org/abs/1912.11158 L.K.Shalm Y.Zhang J.C.Bienfang C.Schlager M.J.Stevens M.D.Mazurek C.Abellán W.Amaya M.W.Mitchell M.A.Alhejji H.Fu J.Ornstein R.P.Mirin S.W.Nam E.Knill article ArduinoZHZBCB2021 1867 Magnetic Resonance in Medicine 2021 1 22 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations gradient coil heating, hip prosthesis, MRI safety, numerical simulation, radiofrequency heating EMPIR 2017: Industry Wiley 30 0740-3194, 1522-2594 10.1002/mrm.28666 NA A.Arduino U.Zanovello J.Hand L.Zilberti R.Brühl M.Chiampi O.Bottauscio proceedings PhungA2021 2286 2021 96th ARFTG Microwave Measurement Conference (ARFTG) 2021 1 18 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 1-4 calibration, coplanar waveguides, on-wafer, probes https://oar.ptb.de/files/download/6189062f8e2a000011003f89 EMPIR 2018: SI Broader Scope IEEE San Diego, CA, USA 2021 96th ARFTG Microwave Measurement Conference (ARFTG) 18-01-2021 to 22-01-2021 30 10.1109/ARFTG49670.2021.9425345 NA G.N.Phung U.Arz article JenningerABBDGISJKRSSSTTW2021 1775 Vacuum 2021 1 183 16NRM05: Ion Gauge: Towards a documentary standard for an ionisation vacuum gauge 109884 Ionisation gauge, Hot cathode, Sensitivity, Simulation, Reference standard EMPIR 2016: Pre-Co-Normative Elsevier BV 30 0042-207X 10.1016/j.vacuum.2020.109884 NA B.Jenninger J.Anderson M.Bernien N.Bundaleski H.Dimitrova M.Granovskij C.Illgen J.Šetina K.Jousten P.Kucharski C.Reinhardt F.Scuderi R.A.S.Silva A.Stöltzel O.M.N.D.Teodoro B.Trzpil-Jurgielewicz M.Wüest inbook BELLGAABSIDPSVRIWPNKSD2021 2552 2021 1 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation radiation protection, metrology, national regulation, European regulation, supportBSS, ENM for Radiation Protection https://vinar.vin.bg.ac.rs/bitstream/handle/123456789/10125/309-314.pdf EMPIR 2019: Support for Networks RADIATION PROTECTION SOCIETY OF SERBIA AND MONTENEGRO, PROCEEDINGS, XXXI SYMPOSIUM RPSSM, 2021 30 78-86-7306-161-0 NA S.Bell D.Glavič-Cindro J.ALVES C.Adam-Guillermin R.Bernat A.Sabeta M-R.Ioan M.DERLACINSKI M.Pinto V.Sochor A.Veres .A.RÖTTGER M.Živanović B.Wens L.Persson R.Nylund N.Kržanović S.STANKOVIĆ S.DIMOVIĆ proceedings KhanbabaeeRBRFHZTLdBGGCA2021 2377 RAD Conference Proceedings 2021 19NET03: supportBSS: Support for a European Metrology Network on reliable radiation protection regulation Activity standards, new operational quantities in radiation protection, type testing, calibration, radon,reference field, pulsed radiation, dosimetry, standards, radiological emergency response EMPIR 2019: Support for Networks RAD Centre Herceg Novi, Montenegro 9th international conference on Radiation in various fields of research 14-06-2021 to 18-06-2021 30 10.21175/RadProc.2021.04 NA B.Khanbabaee A.Röttger R.Behrens S.Röttger S.Feige O.Hupe H.Zutz P.Toroi P.Leonard L.de la Fuente Rosales P.Burgess V.Gressier J–L.Gutiérrez Villanueva R.Cruz Suárez D.Arnold article AgustoniF2021 2321 IEEE Transactions on Instrumentation and Measurement 2021 70 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 1-10 Digital-to-analog converter (DAC) phase offset,discrete Fourier transform (DFT) interpolation, IEC 61850, phasereference signal (PRS), sampled values (SVs) EMPIR 2017: Industry Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2021.3084294 NA M.Agustoni G.Frigo proceedings FrigoA2021_2 2385 Proceedings of 2021 IEEE AMPS 2021 1 1 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 1-6 Instrument transformers, Electric potential, Power measurement, Substations, Instruments, Merging, Prototypes https://zenodo.org/record/5703145 EMPIR 2017: Industry IEEE

Austin

Cagliari 2021 IEEE 11th International Workshop on Applied Measurements for Power Systems (AMPS) 29-09-2021 to 01-10-2021 30 978-1-7281-6923-1 2475-2304 10.5281/zenodo.5703144 NA G.Frigo M.Agustoni article HaveAHPMSL2021 2088 IEEE Transactions on Electromagnetic Compatibility 2021 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters 1-8 Electromagnetic interference (EMI), metering errors, nonlinear, static energy meters, time-domain, waveformmodel EMPIR 2017: Pre-Co-Normative Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9375, 1558-187X 10.1109/TEMC.2021.3062948 NA B.t.Have M.A.Azpurua T.Hartman M.Pous N.Moonen F.Silva F.Leferink proceedings FordRA2021 2705 6th Underwater Acoustics Conference and Exhibition 2021 Volume 44 1 19ENV03: Infra-AUV: Metrology for low-frequency sound and vibration 070024 stability exhibited by hydrophones, variations in temperature, hydrostatic pressure https://asa.scitation.org/doi/abs/10.1121/2.0001491 EMPIR 2019: Environment ASA Teddington, Surrey Meetings on Acoustics 03-09-2021 to 04-09-2021 30 1939-800X 10.1121/2.0001491 NA B.Ford S.Robinson J.Ablitt article VentonHSSA2021 2249 Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences 2021 379 2212 18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management - electrocardiogram, physiological noise, robustness, deep learning, convolutional neural network, symmetric projection attractor reconstruction https://royalsocietypublishing.org/doi/10.1098/rsta.2020.0262 EMPIR 2018: Health Royal Society Publishing 30 - NA https://doi.org/10.1098/rsta.2020.0262 J.Venton P.M.Harris A.Sundar N.A.S.Smith P.J. Aston article SilanderFZZA2020_2 1785 ACTA IMEKO 2020 12 31 9 5 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 293-298 Refractometry, Fabry-Perot cavity, Temperature, Gallium, Gas Modulation https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09%20%282020%29-05-60 EMPIR 2018: SI Broader Scope IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i5.987 NA I.Silander C.Forssén J.Zakrisson M.Zelan O.Axner article ZelanSFZA2020 1784 ACTA IMEKO 2020 12 31 9 5 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 299-304 Refractometry, Gas Modulation, GAMOR, Pressure https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09%20%282020%29-05-61 EMPIR 2018: SI Broader Scope IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i5.988 NA M.Zelan I.Silander C.Forssén J.Zakrisson O.Axner article ForssenSSJBHAZ2020 1786 ACTA IMEKO 2020 12 31 9 5 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 287-292 Refractometry; Pressure; Gas Modulation, GAMOR; Transportable https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09%20%282020%29-05-59 EMPIR 2018: SI Broader Scope IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i5.986 NA C.Forssén I.Silander D.Szabo G.Jönsson M.Bjerling T.Hausmaninger O.Axner M.Zelan article ZakrissonSFSMPKARA2020 1787 ACTA IMEKO 2020 12 31 9 5 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 281-286 EMPIR; QuantumPascal; FEM; Pressure; Refractometry; Deformation. https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-09%20%282020%29-05-58 EMPIR 2018: SI Broader Scope IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i5.985 NA J.Zakrisson I.Silander C.Forssén Z.Silvestri D.Mari S.Pasqualin A.Kussicke P.Asbahr T.Rubin O.Axner proceedings FurtadoPQSLMAARLBCLA2020 1898 ACTA IMEKO 2020 12 31 9 5 17RPT02: rhoLiq: Establishing traceability for liquid density measurements 79 EMPIR rhoLiq Project; oscillation-type density meter; viscoelasticity; comparison EMPIR 2017: Research Potential IMEKO International Measurement Confederation - IMEKO TC3, TC5, TC16 and TC2 16-11-2020 to 18-11-2020 30 2221-870X 10.21014/acta_imeko.v9i5.943 NA A.Furtado J.Pereira R.Quendera M.Schiebl E.Lenard E.Malejczyk A.Alic S.Alisic J.Rauch F.Lorenz A.Bescupschii A.Ciubara B.Laky R.Amsüss article ZelenkaASHKPPDZCM2020 2108 ACTA IMEKO 2020 12 31 9 5 19RPT02: RealMass: Improvement of the realisation of the mass scale 4 Mass realisation, kilogram, multiplies and sub-multiplies, subdivision and multiplication, OIML R111 https://acta.imeko.org/index.php/acta-imeko/index EMPIR 2019: Research Potential IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v9i5.928 NA Z.Zelenka S.Alisic B.Stoilkovska R.Hanrahan I.Kolozinsky G.Popa D.Pantic V.Dikov J.Zůda M.Coenegrachts A.Malengo article NaccaratoTMMMZPAPNMWSMMSBPSW2020 2035 Atmospheric Measurement Techniques 2020 12 29 16ENV01: MercOx: Metrology for oxidised mercury atmnospheric gaseous mercury, passive samplers, intercomparison EMPIR 2016: Environment Copernicus GmbH 30 10.5194/amt-2020-455 NA A.Naccarato A.Tassone M.Martino S.Moretti A.Macagnano E.Zampetti P.Papa J.Avossa N.Pirrone M.Nerentorp J.Munthe I.Wängberg G.W.Stupple C.P.J.Mitchell A.R.Martin A.Steffen D.Babi E.M.Prestbo F.Sprovieri F.Wania proceedings ElgGAMMHHLMPMSV2020 2062 VDE High Voltage Technology 2020; ETG-Symposium 2020 12 N/A N/A 19ENG02: FutureEnergy: Metrology for future energy transmission N/A UHVDC, traceability, Lightning Impulse, linearity, voltage dependence, HVAC, DC partial discharge, GIS Partial discharge SEG https://ieeexplore.ieee.org/servlet/opac?punumber=9275417 EMPIR 2019: Energy VDE Berlin, Germany VDE High Voltage Technology 2020; ETG-Symposium 09-11-2020 to 11-11-2020 30 978-3-8007-5353-6 NA https://zenodo.org/record/4769653 A-P.Elg F.Garnacho M.Agazar J.Meisner A.Merev E.Houtzager J.Hällström K.Lahti C.Mier Escurra C.Platinero T.Micand T.Steiner A.Voss article DitaliaTchernijLCSPTBCPPDMAOSMGF2020 1730 Scientific Reports 2020 12 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 21537 Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-78436-6 NA S.Ditalia Tchernij T.Lühmann E.Corte F.Sardi F.Picollo P.Traina M.Brajković A.Crnjac S.Pezzagna Ž.Pastuović I.P.Degiovanni E.Moreva P.Aprà P.Olivero Z.Siketić J.Meijer M.Genovese J.Forneris article DitaliaTchernijLCSPTBCPPDMAOSMGF2020_2 1806 Scientific Reports 2020 12 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Confocal microscopyOptical properties of diamondQuantum opticsSingle photons and quantum effects EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-78436-6 NA S.Ditalia Tchernij T.Lühmann E.Corte F.Sardi F.Picollo P.Traina M.Brajković A.Crnjac S.Pezzagna Ž.Pastuović I.P.Degiovanni E.Moreva P.Aprà P.Olivero Z.Siketić J.Meijer M.Genovese J.Forneris article SchullerHFSDRPTFKCSBSMGSBLJPBKKBOKPASRV2020 1841 Physica Medica 2020 12 80 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 134-150 Dosimetry, FLASH beams, Absorbed dose, Traceability, High dose rates, European metrology project EMPIR 2018: Health Elsevier BV 30 1120-1797 10.1016/j.ejmp.2020.09.020 NA A.Schüller S.Heinrich C.Fouillade A.Subiel L.De Marzi F.Romano P.Peier M.Trachsel C.Fleta R.Kranzer M.Caresana S.Salvador S.Busold A.Schönfeld M. McEwen F.Gomez J.Solc C.Bailat V.Linhart J.Jakubek J.Pawelke M.Borghesi R-P.Kapsch A.Knyziak A.Boso V.Olsovcova C.Kottler D.Poppinga I.Ambrozova C-S.Schmitzer S.Rossomme M-C.Vozenin article BarreQSDBTESdA2020 2036 Frontiers in Environmental Chemistry 2020 11 23 1 16ENV01: MercOx: Metrology for oxidised mercury isotopic composition, mercury, biomonitoring EMPIR 2016: Environment Frontiers Media SA 30 2673-4486 10.3389/fenvc.2020.582001 NA J.P.G.Barre S.Queipo-Abad C.Sola-Larrañaga G.Deletraz S.Bérail E.Tessier D.Elustondo Valencia J.M.Santamaría A.de Diego D.Amouroux article AqeelSTMMBBGPB2020 2388 Physical Review Letters 2020 11 17 126 1 17FUN08: TOPS: Metrology for topological spin structures 017202-1 - 017202-7 Lattice dynamics, Magnetic order, Magnetism, Magnetization dynamics, Skyrmions, Spin waves https://arxiv.org/abs/2011.07826 EMPIR 2017: Fundamental American Physical Society 30 1079-7114 10.1103/PhysRevLett.126.017202 NA A.Aqeel J. Sahliger T.Taniguchi S.Mändl D.Mettus H.Berger A.Bauer M.Garst C.Pfleiderer C.H.Back article IstrateATRG2020 1755 Journal of Sensors and Sensor Systems 2020 11 10 9 2 18NRM05: SupraEMI: Grid measurements of 2 kHz - 150 kHz harmonics to support normative emission limits for mass-market electrical goods 375-381 Supraharmonics, Measurement, Uncertainty, Smart Grids https://jsss.copernicus.org/articles/9/375/2020/ EMPIR 2018: Pre-Co-Normative Copernicus GmbH 30 2194-878X 10.5194/jsss-9-375-2020 NA D.Istrate D.Amaripadath E.Toutain R.Roche F.Gao miscellaneous ArduinoPZKC 1667 2020 11 6 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Electric Properties Tomography; Magnetic Resonance Imaging; Variance-covariance matrix; Shrinkage estimation; Law of propagation of uncertainty EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.4248879 NA A.Arduino F.Pennecchi LZilberti U.Katscher M.G.Cox miscellaneous PennecchiRAE 1659 2020 11 3 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Conformity assessment; Producer’s and consumer’s risk; Total suspended particulates in air; Mass Concentration; Measurement uncertainty; Log-normal prior distribution EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.4242988 NA F.Pennecchi F.Rolle A.Allard S.L.R.Ellison article BlakesleyKDHTMSA2020 1949 37th European Photovoltaic Solar Energy Conference and Exhibition 2020 11 16ENG02: PV-Enerate: Advanced PV energy rating 1292 - 1297 Albedo, Bificial PV Module https://zenodo.org/record/4055920 EMPIR 2016: Energy 30 NA 3-936338-73-6 J.C.Blakesley G. Koutsourakis S.Douglas J.K.L.Holder J.Torry F.Mukadam A.Schmid R.S.J.Abrams article AlveseSousaGFFMMBA2020 1674 International Journal of Biomedical and Biological Engineering 2020 10 23 14 10 18HLT08: MEDDII: Metrology for drug delivery 10011517 Calibration, interferometry, syringe pump, optical method, uncertainty https://publications.waset.org/10011517/pdf EMPIR 2018: Health WASET 30 ISNI:0000000091950263 NA ISNI:0000000091950263 J.Alves e Sousa I.Godinho M. do C.Ferreira A.Furtado R.Mendes R.Martins E.Batista M.Alvares article DorscherABSHSL2020 1719 Communications Physics 2020 10 20 3 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 1-8 optical atomic clocks,dynamic decoupling,coherence time,decoherence EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2399-3650 10.1038/s42005-020-00452-9 NA S.Dörscher A.Al-Masoudi M.Bober R.Schwarz R.Hobson U.Sterr C.Lisdat article AlajiAGOLGDG2020 1703 Microwave and Optical Technology Letters 2020 10 - - 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications - 5G and IoT sensors, 55-nm BiCMOS, tunablepower detector, Millimeterwave, PN diode https://zenodo.org/record/4300488 EMPIR 2016: Energy Wiley 30 0895-2477, 1098-2760 10.1002/mop.32685 NA I.Alaji W.Aouimeur H.Ghanem E.Okada S.Lépilliet D.Gloria G.Ducournau C.Gaquiere article RomanoSMLPTMMBMAFGS2020 1839 Journal of Physics: Conference Series 2020 10 1662 18HLT04: UHDpulse: Metrology for advanced radiotherapy using particle beams with ultra-high pulse dose rates 012028 ultra-high pulse dose rates, dosimetry, metrology, electrons EMPIR 2018: Health IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/1662/1/012028 NA F.Romano A.Subiel M.McManus N. D.Lee H.Palmans R.Thomas S.McCallum G.Milluzzo M.Borghesi A.McIlvenny H.Ahmed W.Farabolini A.Gilardi A.Schüller article JandaGOPUHRSMRNCHWEACDMORONJKZ2020 1683 Physical Review Materials 2020 9 28 4 9 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 094413-1 to 094413-9 - https://arxiv.org/abs/2004.05460 EMPIR 2016: Energy American Physical Society (APS)

1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States

30 2475-9953 10.1103/PhysRevMaterials.4.094413 NA T.Janda J.Godinho T.Ostatnicky E.Pfitzner G.Ulrich A.Hoehl S.Reimers Z.Šobáň T.Metzger H.Reichlová V.Novák R. P.Campion J.Heberle P.Wadley K. W.Edmonds O. J.Amin J. S.Chauhan S. S.Dhesi F.Maccherozzi R. M.Otxoa P. E.Roy K.Olejník P.Němec T.Jungwirth B.Kaestner FrancoisZiade proceedings tenHaveAPSL2020 2085 2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE 2020 9 23 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters Conducted electromagnetic interference, Distribution network, Non-linear, Photovoltaic installation, Static energy meter https://research.utwente.nl/en/publications/on-site-waveform-survey-in-lv-distribution-network-using-a-photov EMPIR 2017: Pre-Co-Normative IEEE Barcelona 2020 International Symposium on Electromagnetic Compatibility - EMC EUROPE 23-09-2020 to 25-09-2020 30 10.1109/EMCEUROPE48519.2020.9245831 NA B.ten Have M.A.Azpurua M.Pous F.Silva F.Leferink article ZilbertiZABZ2020 1668 Magnetic Resonance in Medicine 2020 9 16 85 2 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 583-586 MR safetyMedical implantsRF-induced heatingMagnetic Resonance ImagingSpecific Absorption Rate https://onlinelibrary.wiley.com/doi/full/10.1002/mrm.28512 EMPIR 2017: Industry Wiley 30 0740-3194, 1522-2594 10.1002/mrm.28512 NA L.Zilberti U.Zanovello A.Arduino O.Bottauscio L.Zilberti article ZakrissonSFZA2020 1678 Journal of Vacuum Science & Technology B 2020 9 38 5 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 054202 Cavity Deformation, Fabry-Perot, refractomtery, Gas Modulation refractomtery (GAMOR) EMPIR 2018: SI Broader Scope American Vacuum Society 30 2166-2746, 2166-2754 10.1116/6.0000375 NA J.Zakrisson I.Silander C.Forssén M.Zelan O.Axner article CrottivMTLSACMMA2020 2130 Conference on Precision Electromagnetic Measurements CPEM 2020 Proceedings 2020 8 24 19NRM05: IT4PQ: Measurement methods and test procedures for assessing accuracy of instrument transformers for power quality measurements Instrument transformers, calibration, measurement standards, measurement techniques, measurementuncertainty, precision measurements SEG EMPIR 2019: Pre-Co-Normative 30 10.5281/zenodo.5136547 NA G.Crotti H.E.van den Brom E.Mohns R.Tinarelli M.Luiso R.Styblikova M.Agazar H.Çaycı P.Mazza J.Meyer M. Almutairi article ClivatiABBDDMMMNLPRRSSSTC2020 1773 Optica 2020 8 20 7 8 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 1031 fiber links, coherent phase transfer, frequency dissemination with fibers, VLBI EMPIR 2018: SI Broader Scope The Optical Society 30 2334-2536 10.1364/OPTICA.393356 NA C.Clivati R.Aiello G.Bianco C.Bortolotti P.De Natale V.Di Sarno P.Maddaloni G.Maccaferri A.Mura M.Negusini F.Levi F.Perini R.Ricci M.Roma L.Santamaria Amato M.Siciliani de Cumis M.Stagni A.Tuozzi C.Clivati article SchwarzDABLSWRLL2020 1570 Physical Review Research 2020 8 11 2 3 18SIB05: ROCIT: Robust Optical Clocks for International Timescales 033242 Atomic spectra, optical clocks, gravitation EMPIR 2018: SI Broader Scope American Physical Society (APS)

Ricklinger Stadtweg 4c

30 10.1103/PhysRevResearch.2.033242 NA RSchwarz SDörscher AAl-Masoud EBenkler TLegero USterr SWeyers JRahm BLipphardt CLisdat proceedings KazemipourHWAHRSZ2020 1663 2020 Conference on Precision Electromagnetic Measurements (CPEM) 2020 8 N/A N/A 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies 1-2 Material characterization, parameter extraction, VNA time-gating, RF metrology, measurement uncertainty https://doi.org/10.5281/zenodo.4243044 EMPIR 2018: SI Broader Scope IEEE Denver, CO, USA 2020 Conference on Precision Electromagnetic Measurements (CPEM) 24-08-2020 to 28-08-2020 30 978-1-7281-5898-3 2160-0171 10.1109/CPEM49742.2020.9191818 NA A.Kazemipour J.Hoffmann M.Wollensack D.Allal M.Hudlicka J.Ruefenacht D.Stalder M.Zeier article MauryADdBM2020 1818 Flow Measurement and Instrumentation 2020 8 74 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 101743 Refuelling station; Hydrogen; Primary standard; Uncertainties; High pressure EnG EMPIR 2016: Energy Elsevier BV 30 0955-5986 10.1016/j.flowmeasinst.2020.101743 NA R.Maury C.Auclercq C.Devilliers M.de Huu O.Büker M.MacDonald article LiuACA2020 1608 International Journal of Environmental Research and Public Health 2020 7 24 17 15 16NRM07: Vector SAR: SAR measurement using vector probes 5355 specific absorption rate; fast SAR measurement; field reconstruction; plane-wave expansion; traditional SAR measurement; measurement discrepancy EMPIR 2016: Pre-Co-Normative MDPI AG 30 1660-4601 10.3390/ijerph17155355 NA Z.Liu D.Allal M.Cox D.Allal article ShuVZAF2020 1544 Frontiers in Mechanical Engineering 2020 7 24 6 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel liquefied natural gas, liquefied biogas, rapid compression machine, auto-ignition delays, chemical kinetics, modeling, shock tube EnG EMPIR 2016: Energy Frontiers Media SA 30 2297-3079 10.3389/fmech.2020.00047 NA B.Shu S.K.Vallabhuni J.Zheng S.Agarwal R.X.Fernandes article MayerBTOPAGMIMSK2020 1600 Physics in Medicine & Biology 2020 7 21 65 14 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers 145003 PET-MR,motion correction,simulation,image registration,open source EMPIR 2018: Health IOP Publishing 30 1361-6560 10.1088/1361-6560/ab7eee NA J.Mayer R.Brown K.Thielemans E.Ovtchinnikov E.Pasca D.Atkinson A.Gillman P.Marsden M.Ippoliti M.Makowski T.Schaeffter C.Kolbitsch article AlKhafajiGWBV2020 1714 Materials 2020 7 11 13 14 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses 3101 silica nanoparticle; size distribution; light scattering; small-angle X-ray scattering; microfluidic resistive pulse sensing EMPIR 2018: Health MDPI AG 30 1996-1944 10.3390/ma13143101 NA M.A.Al-Khafaji A.Gaál A.Wacha A.Bóta Z.Varga article HeeringSCANNQRBBNSLLURVSDRKL2020 1554 Symmetry 2020 7 12 7 17FUN09: UnipHied: Realisation of a Unified pH Scale 1150 unified pH scale, pHabs, all solvents, differential potentiometry, liquid junction, ionic liquid EMPIR 2017: Fundamental MDPI AG 30 2073-8994 10.3390/sym12071150 NA AgnesHeering DanielaStoica FilomenaCamões BárbaraAnes DánielNagy ZsófiaNagyné Szilágyi RaquelQuendera LuisRibeiro FrankBastkowski RasmusBorn JaakNerut JaanSaame SilvieLainela LokmanLiv EmrahUysal MatildaRoziková MartinaVičarová AlanSnedden LisaDeleebeeck ValentinRadtke IngoKrossing IvoLeito article SeuntjensDPPOOMMHFDBBAVMKBASTTVZ2020 1522 Physics in Medicine and Biology 2020 6 22 65 9 16NRM03: RTNORM: kQ factors in modern external beam radiotherapy applications to update IAEA TRS-398 095011 TRS-398, MV photon beams, dosimetry, ionization chambers, Monte Carlo EMPIR 2016: Pre-Co-Normative Institute of Physics

London

30 10.5281/zenodo.3903294 NA J.Seuntjens L.A.de Prez M.Pinto M.Pimpinella C.P.Oliver J.Ojala B.Muir L.Mirzakhanian M.D.Hanlon P.Francescon F.Delaunay J.Borbinha F.Ballester C.E.Andersen S.Vatnitsky M. McEwen R.P.Kapsch D.T.Burns P.Andreo L.Sommier P.Teles J.Tikkanen J.Vijande K.Zink article HarmonFBAGBLZ2020 1514 Sustainability 2020 6 12 11 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 4573 basic restrictions; electric vehicle; exposure; guidelines; inductive power transfer (IPT); magnetic field measurements; numerical dosimetry EMPIR 2016: Energy MDPI AG 30 2071-1050 10.3390/su12114573 NA I.Liorni O.Bottauscio R.Guilizzoni P.Ankarson J.Bruna A.Fallahi S.Harmon M.Zucca article PradyumnaLRTZJADGG2020 1574 Communications Physics 2020 6 3 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 104 Optical physicsQuantum metrologyQuantum optics https://www.nature.com/articles/s42005-020-0368-5#Bib1 EMPIR 2017: Fundamental Nature Research

233 Spring St. New York NY 10013 United States

30 2399-3650 10.1038/s42005-020-0368-5 NA S. T.Pradyumna E.Losero I.Ruo-Berchera P.Traina M.Zucco C. S.Jacobsen U. L.Andersen I. P.Degiovanni M.Genovese T.Gehring article LucasCTDABLYSMPF2020 1611 Applied Physics Letters 2020 6 116 22 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 222903 - https://livrepository.liverpool.ac.uk/3091334/ EMPIR 2016: Energy AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0007820 NA C.A.Lucas M.G.Cain P.B.J.Thompson D.Damjanovic L.Antonelli F.Blackmon S.E.Lofland S.Young M.Staruch B.R.Matis E.A.Patterson P.Finkel article RuoBercheraMLASG2020 1576 Applied Physics Letters 2020 5 26 116 21 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 214001 Optical metrology, Quantum correlations, Signal processing, Quantum efficiency, Quantum limit, Charge coupled devices EMPIR 2017: Fundamental AIP Publishing 30 0003-6951, 1077-3118 10.1063/5.0009538 NA I.Ruo-Berchera A.Meda E.Losero A.Avella N.Samantaray M.Genovese article QueleverGAJ2020 1530 Sensors 2020 5 23 20 10 16NRM07: Vector SAR: SAR measurement using vector probes 2956 dielectric measurement; process monitoring; open-ended coaxial probe; specificabsorption rate (SAR); tissue-equivalent materials EMPIR 2016: Pre-Co-Normative MDPI AG 30 1424-8220 10.3390/s20102956 NA Andrew P.Gregory KristellQuéléver DjamelAllal Ourouk Jawad article YamakawaBATBSNKYD2020 2039 Analytical and Bioanalytical Chemistry 2020 5 18 412 19 16ENV01: MercOx: Metrology for oxidised mercury 4483-4493 Hg isotopic composition, Certified Reference Material, Urban Aerosols EMPIR 2016: Environment Springer Science and Business Media LLC 30 1618-2642, 1618-2650 10.1007/s00216-020-02691-9 NA A.Yamakawa S.Bérail D.Amouroux E.Tessier J.Barre T.Sano K.Nagano S.Kanwal J.Yoshinaga O.F.X.Donard article MoranMezaDAP2020 1613 Measurement Science and Technology 2020 5 31 7 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 074009 - EMPIR 2016: Energy IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab82c1 NA J.A.Morán-Meza A.Delvallée D.Allal F.Piquemal proceedings PhungA2020 1646 2020 IEEE 24th Workshop on Signal and Power Integrity (SPI) 2020 5 18SIB09: TEMMT: Traceability for electrical measurements at millimetre-wave and terahertz frequencies for communications and electronics technologies calibration, coplanar waveguides, multiline Thru-Reflect Line (mTRL), probes https://oar.ptb.de/files/download/5f92a12a4c93902ba0000843 EMPIR 2018: SI Broader Scope IEEE Cologne 2020 IEEE 24th Workshop on Signal and Power Integrity 17-05-2020 to 20-05-2020 30 10.1109/SPI48784.2020.9218166 NA G.N.Phung U.Arz article ArrheniusBFPM2020 1821 Measurement Science and Technology 2020 5 31 7 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 075010 hydrogen, hydrogen purity, analyser, OFCEAS, gas chromatography EnG EMPIR 2016: Energy IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab7cf3 NA K.Arrhenius O.Büker A.Fischer S.Persijn A.Murugan proceedings SilvaPA2020 1612 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 2020 5 2020 - 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 1-6 - https://ieeexplore.ieee.org/document/9129552 EMPIR 2016: Energy IEEE Dubrovnik, Croatia 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 25-05-2020 to 28-05-2020 30 Electronic ISBN: 978-1-7281-44 Electronic ISSN: 2642-2077 NA http://hdl.handle.net/2117/328678 F.Silva M.Pous M.A.Azpurua article SilanderFZZA2020 1679 Optics Letters 2020 4 30 45 9 18SIB04: QuantumPascal: Towards quantum-based realisations of the pascal 2652 Gas Modulation Refractometry (GAMOR), Fabry-Perot, Invar EMPIR 2018: SI Broader Scope The Optical Society 30 0146-9592, 1539-4794 10.1364/OL.391708 NA I.Silander C.Forssén J.Zakrisson M.Zelan O.Axner article MartinezABNVJHKVKL2020 1488 Measurement Science and Technology 2020 4 23 15SIB09: 3DNano: Traceable three-dimensional nanometrology nanometrology, transfer standard, calibration, CSI, SWLI, AFM, traceability EMPIR 2015: SI Broader Scope IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab8c6a NA V.Heikkinen I.Kassamakov T.Viitala M.Järvinen T.Vainikka A.Nolvi C.Bermudez R.Artigas P.Martinez V.Korpelainen A.Lassila miscellaneous SilvaALSCRMBS_2 1486 2020 4 18 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Calibration; Mobile optical measurement system EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3756658 NA M.A.Silva M.C.Almeida D.Loureiro J.A.Sousa M.G.Cox A.S.Ribeiro L.L.Martins R.Brito A.C.Soares miscellaneous SilvaALSCRMBS 1484 2020 4 1 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Measurement model; SBI – Single Burning Item; Reaction to fire test EMPIR 2017: Pre-Co-Normative 30 10.5281/zenodo.3736602 NA M.A.Silva M.C.Almeida D.Loureiro J.A.Sousa M.G.Cox A.S.Ribeiro L.L.Martins R.Brito A.C.Soares article WiartCAL2020 1529 International Journal of Environmental Research and Public Health 2020 3 22 17 6 16NRM07: Vector SAR: SAR measurement using vector probes 2111 specific absorption rate; fast SARmeasurement; field reconstruction; plane-wave expansion;traditional SAR measurement; measurement discrepancy; uncertainty analysis EMPIR 2016: Pre-Co-Normative MDPI AG 30 1660-4601 10.3390/ijerph17062111 NA Z.Liu D.Allal M.Cox J.Wiart article GaudinoCASCPC2020 1537 Optics Express 2020 3 10 28 6 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 8494 Frequency dissemination, optical fiber, polarization EMPIR 2018: SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.378602 NA C.Clivati P.Savio S.Abrate V.Curri R.Gaudino M.Pizzocaro D.Calonico article LanevskiMVHKMAKI2020 1876 Measurement Science and Technology 2020 3 31 5 16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials 054010 reflectance, Monte-Carlo, reflective insulators, foil, curved surface, reference sample,additive manufacturing EMPIR 2016: Pre-Co-Normative IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/ab68bf NA D.Lanevski F.Manoocheri A.Vaskuri J.Hameury R.Kersting C.Monte A.Adibekyan E.Kononogova E.Ikonen proceedings TeniouJPA2020 1617 2020 14th European Conference on Antennas and Propagation (EuCAP) 2020 3 2020 14th 16NRM07: Vector SAR: SAR measurement using vector probes 1-5 SAR, RF Exposure, MIMO, Planar near field measurement, Vector field measurements, Active- Antenna Measurement https://hal.archives-ouvertes.fr/hal-02954816 EMPIR 2016: Pre-Co-Normative IEEE Copenhagen 2020 14th European Conference on Antennas and Propagation (EuCAP) 15-03-2020 to 20-03-2020 30 10.23919/EuCAP48036.2020.9135506 NA M.Teniou O.Jawad S.Pannetrat L.Aberbour article LerouxHHJA2020 1483 SciPost Physics 2020 3 8 3 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems optical tweezers, atomic imaging EMPIR 2017: Fundamental Stichting SciPost 30 2542-4653 10.21468/SciPostPhys.8.3.038 NA N.Jackson R.Hanley M.Hill F.Leroux C.Adams article TxoperenaRLFERAPCCCCHMZK2020 1505 Scientific Reports 2020 2 21 10 1 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics 3223 Characterization and analytical techniques,Electronic properties and devices,Imaging techniques,Materials science,Nanoscience and technology,Physics,Graphene https://www.nature.com/articles/s41598-020-59851-1 EMPIR 2016: Pre-Co-Normative Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-020-59851-1 NA C.Melios N.Huang L.Callegaro A.Centeno A.Cultrera A.Cordon V.Panchal I.Arnedo A.Redo-Sanchez D.Etayo M.Fernandez A.Lopez S.Rozhko O.Txoperena A.Zurutuza O.Kazakova article HuynhMOKABKI2020 1432 Optical Review 2020 2 12 16ENG02: PV-Enerate: Advanced PV energy rating Radiometry, Solar cell, Spectral responsivity, Efficacy, Electricity, Bifacial https://link.springer.com/article/10.1007%2Fs10043-020-00584-x EMPIR 2016: Energy Springer Science and Business Media LLC 30 1340-6000, 1349-9432 10.1007/s10043-020-00584-x NA P.Kärhä H.Baumgartner J.Askola K.Kylmänen B.Oksanen K.Maham V.Huynh E.Ikonen manual PearceABEdIKS2020 1766 2020 2 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 Thermocouples, calibration, thermoelectric, thermometry, ITS-90, EMPRESS 2 https://www.euramet.org/publications-media-centre/calibration-guidelines/ EMPIR 2017: Industry EURAMET

Braunschweig

30 ISBN 978-3-942992-57-2 N/A NA ISBN 978-3-942992-57-2 J.Pearce N.Arifovic J.Bojkovski F.Edler M.de Groot G.G.Izquierdo M.Kalemci R.Strnad proceedings ObatonKRMBACD2020 1759 Proceedings of the 10th Conference on Industrial Computed Tomography (iCT) 2020 2020 2 17IND08: AdvanCT: Advanced Computed Tomography for dimensional and surface measurements in industry 152 X-ray computed tomography (XCT), dimensional metrology, reference standards, additive manufacturing https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf EMPIR 2017: Industry Wels, Austria 10th Conference on Industrial Computed Tomography (iCT 2020) 04-02-2020 to 07-02-2020 30 NA https://www.ndt.net/article/ctc2020/papers/ICT2020_paper_id152.pdf A.Obaton C. Klingaa C.Rivet K.Mohaghegh S.Baier J.Andreasen L.Carli L.De Chiffre article BiaekVGAGFU2020 1904 Journal of Atmospheric and Oceanic Technology 2020 2 37 2 16ENV03: MetEOC-3: Further metrology for earth observation and climate 177-196 Monte Carlo, Ocean colour, Uncertainty evaluation, Radiometry EMPIR 2016: Environment American Meteorological Society 30 0739-0572, 1520-0426 10.1175/JTECH-D-19-0049.1 NA A.Białek V.Vellucci B.Gentil D.Antoine J.Gorroño N.Fox C.Underwood article SantosCMGPAMI2020 1338 X-Ray Spectrometry 2020 1 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters X-ray K-shell transition yields EMPIR 2017: Fundamental Wiley 30 0049-8246, 1097-4539 10.1002/xrs.3123 NA L.Martins P.Amaro S.Pessanha M.Guerra J.Machado M. L.Carvalho J. P.Santos P.Indelicato article MinkMFMZSBSMNAAL2020 1399 Physical Review Letters 2020 1 124 1 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems quantum randomness EMPIR 2017: Fundamental American Physical Society (APS)

1 Research Rd Attn: Mark Doyle Ridge 11961-9000 United States

30 0031-9007, 1079-7114 10.1103/PhysRevLett.124.010505 NA https://arxiv.org/abs/1812.07786 Y.Zhang L.K.Shalm J.C.Bienfang M.J.Stevens M.D.Mazurek S.W.Nam C.Abellán W.Amaya M.W.Mitchell H.Fu C.A.Miller A.Mink E.Knill article AkoWHS2020 1673 Advances in Production Engineering & Management 2020 15 Number 1 17IND02: SmartCom: Communication and validation of smart data in IoT-networks pp 107–117 Metrology; Measurement metadata; Information and communication technology (ICT); Smart Data; Data communication; IoT-communication; IoT-networking; Digital calibration certificate http://apem-journal.org/Archives/2020/Abstract-APEM15-1_107-117.html EMPIR 2017: Industry Advances in Production Engineering & Management 30 10.14743/apem2020.1.353 NA B.Acko H.Weber D.Hutzschenreuter I.Smith article ZilbertiKLGCBAZ2020 1334 IEEE Transactions on Electromagnetic Compatibility 2020 ea ea 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 1-12 Basic restrictions, electric vehicles, electro-magnetic fields, inductive charging, numerical dosimetry, safety EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9375, 1558-187X 10.1109/TEMC.2019.2954111 NA A.Arduino O.Bottauscio M.Chiampi L.Giaccone I.Liorni N.Kuster L.Zilberti M.Zucca article KendigVUMZ2020 1438 IEEE Transactions on Power Electronics 2020 Not yet pr Not yet pr 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications 1-1 Thermoreflectance measurement , boost converter , gallium nitride, power transistor http://epubs.surrey.ac.uk/853825/ EMPIR 2016: Energy Institute of Electrical and Electronics Engineers (IEEE) 30 0885-8993, 1941-0107 10.1109/TPEL.2020.2964996 NA C.Matei J.Urbonas H.Votsi D.Kendig P.H.Aaen article ArrheniusFBAELR2020 1602 RSC Advances 2020 10 20 16ENG05: Biomethane: Metrology for biomethane 11907-11917 Biomethane oilcarryoveranaytical method EnG EMPIR 2016: Energy Royal Society of Chemistry (RSC) 30 2046-2069 10.1039/D0RA01399D NA K.Arrhenius A.Fischer O.Büker H.Adrien A.El Masri F.Lestremau T.Robinson article TummonLKCCCAZSV2020 1472 Atmospheric Measurement Techniques 2020 13 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 1539–1550 pollen monitoring, digital holography, https://www.atmos-meas-tech.net/13/1539/2020/ EMPIR 2016: Environment Copernicus Publications 30 10.5194/amt-13-1539-2020 NA E.Sauvageat Y.Zeder K.Auderset B.Calpini B.Clot B.Crouzy T.Konzelmann G. Lieberherr F.Tummon K.Vasilatou article GoenagaInfantePRdBAC2020 1417 Journal of Analytical Atomic Spectrometry 2020 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements nanoparticles, nanoparticle number concentration, spICP-MS, inorganic nanoparticles, Au nanoparticles, TiO2 nanoparticles https://pubs.rsc.org/en/content/articlepdf/2020/ja/c9ja00415g EMPIR 2017: Pre-Co-Normative Royal Society of Chemistry (RSC) 30 10.1039/c9ja00415g NA S.Cuello-Nuñez I.Abad-Álvaro D.Bartczak M.E. del Castillo Busto D.A.Ramsay F.Pellegrino H.Goenaga-Infante article CuelloNunezABdRPG2020 1848 Journal of Analytical Atomic Spectrometry 2020 35 9 18SIP01: ISOCONCur: An ISO Technical Report on Nanoparticle Concentration 1832-1839 number concentration, spICP-MS, nanoparticle EMPIR 2018: Support for Impact Royal Society of Chemistry (RSC) 30 0267-9477, 1364-5544 10.1039/C9JA00415G NA S.Cuello-Nuñez I.Abad-Álvaro D.Bartczak M.E.Del Castillo Busto D.A.Ramsay F.Pellegrino H.Goenaga-Infante article HorenzTBNAGV2020 1716 Microscopy and Microanalysis 2020 26 S2 17NRM04: nPSize: Improved traceability chain of nanoparticle size measurements 2282 nanoparticles, size traceability, bi-modal distribution, silica, gold, electron microscoopy https://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/study-on-the-analysis-of-particle-size-distribution-for-bimodal-model-nanoparticles-by-electron-microscopy/B9157A370AC198219A734770694340F3 EMPIR 2017: Pre-Co-Normative Cambridge University Press

Cambridge

30 1435-8115 10.1017/S1431927620021054 NA C.Hörenz O.Tache D.Bartczak S.Nunez I.Abad Alvaro H.Goenaga-Infante V-D.Vasile-Dan Hodoroaba proceedings NedialkovSA2020 1890 Metrology and Metrology Assurance 2020 - Proceedings 2020 30th Inter 130 Issues 18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance 15-18 metrology, thermocouple, traceable measurement, MetForTC http://metrology-bg.org/fulltextpapers/Proceedings_MMO_2020.pdf EMPIR 2018: Research Potential Sasho Nedialkov; Snezhana Spasova; Kostadin Aldev Sozopol, Bulgaria Metrology and Metrology Assurance 2020 07-09-2020 to 11-09-2020 30 ISSN 2603-3194 NA ISSN: 2603-3194 S.Nedialkov S.Spasova K.Aldev proceedings ZhangHLBAJN2019 1422 2019 Computing in Cardiology Conference (CinC) 2019 12 30 46 18HLT07: MedalCare: Metrology of automated data analysis for cardiac arrhythmia management 097 Symmetric Projection Attractor Reconstruction, ECG signals, transfer learning http://www.cinc.org/archives/2019/pdf/CinC2019-097.pdf EMPIR 2018: Health Computing in Cardiology Singapore Computing in Cardiology 08-09-2019 to 11-09-2019 30 2325-887X 10.22489/CinC.2019.097 NA P.Aston J.Lyle E.Bonet-Luz C.Huang Y.Zhang K.Jeevaratnam M.Nandi article ArrheniusBBdHM2019 1820 Applied Sciences 2019 12 23 10 1 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 120 hydrogen; fuel cells; hydrogen vehicle; sorbent; thermal desorption; hydrogen quality EnG EMPIR 2016: Energy MDPI AG 30 2076-3417 10.3390/app10010120 NA KarineArrhenius HalehBohlen OliverBüker Irisde Krom DitaHeikens ArulMurugan article CalinALSSR2019 1770 Romanian Reports in Physics 2019 12 20 71 4 16ENV10: MetroRADON: Metrology for radon monitoring 906 Radon measurement, 222Rn standard system, Radon chamber, Indoor and outdoor radon, education and training, ANNETTE, EU project EMPIR 2016: Environment Editura Academiei Romane 30 NA http://www.rrp.infim.ro/2019/AN71906.pdf M.R.Calin A.Antohe A.Luca G.Stanescu M.Sahagia I.Radulescu article PottieAQCLRWKKG2019 1393 New Journal of Physics 2019 12 13 21 . 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 123017 optical frequency dissemination https://iopscience.iop.org/article/10.1088/1367-2630/ab5d95 EMPIR 2018: SI Broader Scope IOPscience 30 1367-2630 10.1088/1367-2630/ab5d95 NA S.Koke A.Kuhl T.Waterholter S.M.F.Raupach O.Lopez E.Cantin N.Quintin A.Amy-Klein P.-E.Pottie G.Grosche article ZilbertiCBBA2019 1328 Physics in Medicine & Biology 2019 12 13 64 24 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations 245006 dosimetry, magnetic resonance imaging (MRI), MR safety, gradient coils, medical implants, prostheses, numerical simulation EMPIR 2017: Industry IOP Publishing 30 1361-6560 10.1088/1361-6560/ab5428 NA A.Arduino O.Bottauscio R.Brühl M.Chiampi L.Zilberti article LoseroRMASG2019 1573 Physical Review A 2019 12 10 100 6 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 063818 Quantum Optics, Ghost Imaging, Quantum Correlations EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.100.063818 NA E.Losero I.Ruo-Berchera A.Meda A.Avella O.Sambataro M.Genovese article RanitzschABBBEKKLMNPRW2019 1729 Journal of Low Temperature Physics 2019 12 199 1-2 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters 441-450 Electron-capture decay, Metallic magnetic calorimeter, Radionuclide metrology EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 0022-2291, 1573-7357 10.1007/s10909-019-02278-4 NA P.C-O.Ranitzsch D.Arnold J.Beyer L.Bockhorn J.J.Bonaparte C.Enss K.Kossert S.Kempf M.Loidl R.Mariam O. J.Nähle M.Paulsen M.Rodrigues M.Wegner article GomezFGLDBMFMMGARPABCDH2019 1260 Journal of Power Sources 2019 12 444 15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications 227170 Fuel cell electrical vehicles, ISO14687, Gas analysis, Hydrogen production, Hydrogen quality https://www.sciencedirect.com/science/article/pii/S0378775319311632 EMPIR 2015: Pre-Co-Normative Elsevier BV 30 0378-7753 10.1016/j.jpowsour.2019.227170 NA T.Bacquart K.Arrhenius S.Persijn A.Rojo F.Auprêtre B.Gozlan N.Moore A.Morris A.Fischer A.Murugan S.Bartlett G.Doucet F.Laridant E.Gernot T. E.Fernández C.Gómez M.Carré G.De Reals F.Haloua article TrusheimFGBA2019 1315 Nature Communications 2019 12 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 5625 diamond, photonics, quantum optics, color centers, quantum technologies https://www.nature.com/articles/s41467-019-13332-w EMPIR 2017: Fundamental Springer Science and Business Media LLC 30 2041-1723 10.1038/s41467-019-13332-w NA C.Bradac W.Gao J.Forneris M. E.Trusheim I.Aharonovich article HorenderSIDVA2019 1333 Metrologia 2019 11 27 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality aerosol, optical particle counter, calibration, clean room, counting efficiency EMPIR 2016: Environment IOP Publishing Calibration of optical particle counters: First comprehensive inter-comparison for particle sizes up to 5 μm and number concentrations up to 2 cm⁻³ 30 0026-1394, 1681-7575 10.1088/1681-7575/ab5c84 NA KonstantinaVasilatou KaiDirscherl KenjiroIida HiromuSakurai StefanHorender KevinAuderset article BeckACCFGHJKKLLMMOQRSSTTTTVVVWW2019 2340 International Journal of Environmental Research and Public Health 2019 11 21 16ENV10: MetroRADON: Metrology for radon monitoring radon; interlaboratory comparison; radon activity concentration; calibration; metrological traceability EMPIR 2016: Environment 30 10.3390/ijerph182212150 NA T.R.Beck A.Antohe F.Cardellini A.Cucoş E.Fialova C.Grossi K.Hening J.Jensen D.Kastratović M.Krivošík P.Lobner A.Luca F.J.Maringer N.Michielsen P.P.S.Otahal L.Quindos D.Rabago C.Sainz L.Szücs T.Teodorescu C.Tolinsson C.L.Tugulan T.Turtiainen A.Vargas J.Vosahlik G.Vukoslavovic H.Wiedner K.Wołoszczuk manual EloKnKALSZSFRBSHWHHHNHMMHP2019 1433 2019 11 17IND02: SmartCom: Communication and validation of smart data in IoT-networks Digital-SI (D-SI) metrology data digital exchange format SmartCom data communication IoT-networking IoT-communication https://zenodo.org/record/3522631#.XlTbaTFKhaQ EMPIR 2017: Industry Zenodo 30 10.5281/zenodo.3522631 NA T.Elo P.Kuosmanen T. Mustapää R.Klobucar B.Acko I.Linkeová J.Sýkora V.Zelený I.Smith A.Forbes S.Rhodes C.Brown A.Scheibner S.G.Hackel T.Wiedenhöfer W.Heeren F.Haertig D.Hutschenreuter P.Nikander K.Hovhannisyan O.Maennel B.Muller L.Heindorf V.Paciello article KlenovskyBMASS2019 1361 Physical Review B 2019 11 100 19 17FUN06: SIQUST: Single-photon sources as new quantum standards electronic structure, quantum dot https://arxiv.org/abs/1906.09842 EMPIR 2017: Fundamental American Physical Society (APS) 30 2469-9950, 2469-9969 10.1103/PhysRevB.100.195407 NA P.Steindl E.M.Sala B.Alén D.F.Marrón D.Bimberg P.Klenovský article SantosCMGPAM2019 1337 X-Ray Spectrometry 2019 10 29 49 1 17FUN02: MetroMMC: Measurement of fundamental nuclear decay data using metallic magnetic calorimeters 192-199 Dirac–Fock method, Zn K‐shell EMPIR 2017: Fundamental Wiley 30 0049-8246, 1097-4539 10.1002/xrs.3089 NA L.Martins P.Amaro S.Pessanha M.Guerra J.Machado M. L.Carvalho J. P.Santos article PfleidererRRLBAPWB2019 1313 Physical Review Letters 2019 10 14 123 16 17FUN08: TOPS: Metrology for topological spin structures Skyrmions, X-ray scattering, Ferromagnetic resonance https://arxiv.org/abs/1909.08293 EMPIR 2017: Fundamental American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.123.167201 NA S.Pöllath A.Aqeel A.Bauer C.Luo H.Ryll F.Radu C.Pfleiderer G.Woltersdorf C. H.Back article AlvesBLLPB2019 1401 Optics Express 2019 10 11 27 21 17FUN03: USOQS: Ultra-stable optical oscillators from quantum coherent and entangled systems 31042 Sub-Pissonian statistics, photon anti bounching EMPIR 2017: Fundamental The Optical Society

2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States

30 1094-4087 10.1364/OE.27.031042 NA NataliaBruno Lorena C.Bianchet VindhiyaPrakash NanLi NatáliaAlves M.W.Mitchell proceedings FortuneCRSPA2019 1198 Proceedings of CIM 2019 2019 9 24 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients Pulsed X-ray tube, KVp meters, Metrology, Dose. https://www.cim2019.com EMPIR 2015: Pre-Co-Normative Paris, France The 19st Congrès Internationla de Métrologie 24-09-2019 to 26-09-2019 30 10.1051/metrology/201902002 NA 10.5281/zenodo.3335340 M.Agazar D.Perrillat H.Saadeddine C.Robert L.Casteignau D.Fortune proceedings Allal2019 1230 19th International Congress of Metrology (CIM2019) 2019 9 23 2019 19th 16NRM07: Vector SAR: SAR measurement using vector probes 3/02003 Specific Absorption Rate, Vector Probe Array, MIMO https://cfmetrologie.edpsciences.org/articles/metrology/abs/2019/01/metrology_cim2019_02003/metrology_cim2019_02003.html EMPIR 2016: Pre-Co-Normative EDP Sciences LNE 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201902003 NA DjamelAllal proceedings BagciHYTAGD2019 1325 19th International Congress of Metrology (CIM2019) 2019 9 23 2019 17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures dynamic pressure, measurement, calibration, drop mass, dynamic calibration machine EMPIR 2017: Industry EDP Sciences

17 av. du Hoggar PA de Courtaboeuf BP 112 PA de Courtaboeuf BP 112 Les Ulis cedex A 91944 France

Paris 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201927009 NA Y.Durgut O.Ganioglu B.Aydemir A.Turk R.Yilmaz A.Hamarat E.Bağcı proceedings CucciaSBLvAMCVSBPCT2019 1781 19th International Congress of Metrology (CIM2019) 2019 9 23 16ENG05: Biomethane: Metrology for biomethane biomethane, terpenes, amines, ammonia EnG EMPIR 2016: Energy EDP Sciences Paris 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201906001 NA L.Cuccia B.Sanz D.Ballestas Castro J.Li A.M.H.van der Veen E.Amico di Meane S.Moreno L.P.Culleton D.Vorin C.Senné F.Bougueroua L.Pyrée Y.Courtois C.Tastard article LeferinkSAPH2019 1381 2019 International Symposium on Electromagnetic Compatibility - EMC EUROPE 2019 9 Not Applic Not Applic 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters 6 IEEE Keywords Current measurement, Meters, Time measurement, Electromagnetic interference, Time-domain analysis, Probes, Battery charge measurement INSPEC: Controlled Indexing battery storage plants, charge measurement, electric vehicle charging, electromagnetic interference, statistical distributions, time-domain analysis INSPEC: Non-Controlled Indexing electrical vehicle chargers, static meter misreadings, noisy waveforms, electric vehicle charging stations, on-site waveform characterization, EV charging stations, TEMPS software, time domain electromagnetic interference measurement and post-processing system, amplitude probability distribution, APD, EMI measurements, baseband digitizer SEG https://research.utwente.nl/en/publications/on-site-waveform-characterization-at-static-meters-loaded-with-el EMPIR 2017: Pre-Co-Normative IEEE 30 2325-0364 10.1109/EMCEurope.2019.8871469 NA T.Hartman M.Pous M.A.Azpurua F.Silva F.Leferink proceedings ChiampiBAZ2019 1271 2019 International Conference on Electromagnetics in Advanced Applications (ICEAA) 2019 9 18HLT05: QUIERO: Quantitative MR-based imaging of physical biomarkers magnetic resonance imaging (MRI), phaseless contrast source inversion (CSI), electric properties tomography (EPT), uncertainty propagation, Monte Carlo method https://arxiv.org/abs/1911.02809 EMPIR 2018: Health IEEE Granada 2019 International Conference on Electromagnetics in Advanced Applications 09-09-2019 to 13-09-2019 30 10.1109/ICEAA.2019.8879147 NA AlessandroArduino O.Bottauscio M.Chiampi L.Zilberti article KorpelainenGKAS2019 1298 tm - Technisches Messen 2019 9 86 s1 15SIB09: 3DNano: Traceable three-dimensional nanometrology 12-16 Rasterkraftmikroskopie; piezoresistive Cantilever; Nanomessmaschine EMPIR 2015: SI Broader Scope Walter de Gruyter GmbH 30 2196-7113, 0171-8096 10.1515/teme-2019-0035 NA J.Schaude J.Albrecht U.Klöpzig A.C.Gröschl TinoHausotte proceedings RoviraGSFA2019 1197 Proceedings of IHS2019 2019 8 26 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients High Voltage, Pulsed X-ray tube , Divider, Metrology EMPIR 2015: Pre-Co-Normative Budapest, Hungary, The 21st International Symposium on High Voltage Engineering (ISH2019) 26-08-2019 to 30-08-2019 30 NA https://doi.org/10.5281/zenodo.3243494 J.Rovira F.Garnacho H.Saadeddine D.Fortune M.Agazar proceedings VentreMDBCFPPRSTBASSGHBZFDKL2019 1200 2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE) 2019 8 19 Electrical 2019 AEIT 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 6 pages Dosimetry, Energy efficiency, Inductive charging, Magnetic fields, Metrology, Safety SEG http://arxiv.org/abs/1908.11108 EMPIR 2016: Energy IEEE Turin (Italy) 2019 AEIT International Conference of Electrical and Electronic Technologies for Automotive (AEIT AUTOMOTIVE) 02-07-2019 to 04-07-2019 30 978-8-8872-3743-6 0018-9219 10.23919/EETA.2019.8804498 NA M.Zucca O.Bottauscio S.Harmon R.Guilizzoni F.Schilling M.Schmidt P.Ankarson T.Bergsten K.Tammi P.Sainio J.B.Romero E.L.Puyal L.Pichon F.Freschi V.Cirimele P.Bauer J.Dong A.Maffucci S.Ventre N.Femia G.Di Capua N.Kuster I.Liorni article WendischPMWIBABOKK2019 1057 IEEE Transactions on Applied Superconductivity 2019 8 29 5 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 1200205 Optical pulses, Optical fibers, Optical distortion, High-speed optical techniques, Optical attenuators, Optical crosstalk https://ieeexplore.ieee.org/document/8643521 EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 1051-8223, 1558-2515, 2378-707 10.1109/TASC.2019.2899851 NA O.Kieler B.Karlsen P.A.Ohlckers E.Bardalen M.N.Akram R.Behr J.Ireland J.Williams H.Malmbekk L.Palafox R.Wendisch article AslanDSWZOY2019 Applied Radiation and Isotopes 2019 8 150 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 120-126 Emergency preparedness, airborne radioactivity, radiochemical analysis, extraction chromatography https://www.sciencedirect.com/science/article/pii/S0969804317308229?dgcid=raven_sd_via_email EMRP A169: Call 2013 Environment II Elsevier BV

230 Park Avenue Suite 800 Shantae McGee New York NY 10169-0935 United States

30 0969-8043 10.1016/j.apradiso.2019.04.031 NA N.Aslan A.Dirican M.Seferinoğlu H.Wershofen D.Zapata-García G.Özçayan Ü.Yücel article OrtolanoARCETCZSCC2019 1227 Scientific Reports 2019 7 23 9 1 16NRM01: GRACE: Developing electrical characterisation methods for future graphene electronics graphene, electrical resistance tomography, conductivity, terahertz spectroscopy https://doi.org/10.1038/s41598-019-46713-8 EMPIR 2016: Pre-Co-Normative Springer Science and Business Media LLC 30 2045-2322 10.1038/s41598-019-46713-8 NA A.Cultrera D.Serazio A.Zurutuza A.Centeno O.Txoperena D.Etayo A.Cordon A.Redo-Sanchez I.Arnedo M.Ortolano L.Callegaro article MurugandBvAtH2019 1816 International Journal of Hydrogen Energy 2019 7 44 35 16ENG01: MetroHyVe: Metrology for hydrogen vehicles 19326-19333 Hydrogen; Fuel cell; Vehicles; ISO 14687; Metrology; Measurement; Flow metering; Quality control EnG EMPIR 2016: Energy Elsevier BV 30 0360-3199 10.1016/j.ijhydene.2019.03.190 NA A.Murugan M.de Huu T.Bacquart J.van Wijk K.Arrhenius I.te Ronde D.Hemfrey article SilanderHFZA2019 1542 Journal of Vacuum Science & Technology B 2019 7 37 4 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range 042901 Gas equilibration gas modulation refractometry for assessment of pressure with sub-ppm precision EMPIR 2014: Industry American Vacuum Society 30 2166-2746, 2166-2754 10.1116/1.5090860 NA I.Silander T.Hausmaninger C.Forssén M.Zelan O.Axner article VasilatouAH2019_2 1220 Review of Scientific Instruments 2019 7 90 7 16ENV07: AEROMET: Aerosol metrology for atmospheric science and air quality 075111 optical particle counters, aerosol instrumentation, aerosol generation setup, turbulent flow tube, particle homogenization, isokinetic sampling ports, particle counter, Stable and reproducible aerosols, polystyrene latex particles https://aip.scitation.org/doi/10.1063/1.5095853 EMPIR 2016: Environment AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.5095853 NA S.Horender K.Auderset K.Vasilatou article AdibekyanKMH2019 1287 Journal of Sensors and Sensor Systems 2019 6 27 8 1 16NRM06: EMIRIM: Improvement of emissivity measurements on reflective insulation materials 233-242 emissivity, TIR 100-2 emissometer, characterization, calibration, reflective foils https://www.j-sens-sens-syst.net/8/233/2019/ EMPIR 2016: Pre-Co-Normative Copernicus GmbH 30 2194-878X 10.5194/jsss-8-233-2019 NA ElenaKononogova AlbertAdibekyan ChristianMonte JörgHollandt article PottieLATMQFCX2019 1117 IEEE Transactions on Instrumentation and Measurement 2019 6 68 6 15SIB05: OFTEN: Optical frequency transfer - a European network 2195-2200 Optical fiber links, phase lock loop, phase measurement, two-way noise compensation, ultrastable frequencytransfer EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2018.2886865 NA D.Xu E.Cantin F.Frank N.Quintin F.Meynadier P.Tuckey A.Amy-Klein O.Lopez P.E.Pottie article HeinrichPSDKFA2019 1067 IEEE Transactions on Microwave Theory and Techniques 2019 5 67 5 14IND02: PlanarCal: Microwave measurements for planar circuits and components 1892-1900 Calibration, coplanar waveguide, electromagnetic field simulation, multiline-thru-reflect-line, on-wafer probing, probes https://www.fbh-berlin.de/fileadmin/downloads/Publications/2019/FINAL_VERSION_repository.pdf EMPIR 2014: Industry Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9480, 1557-9670 10.1109/TMTT.2019.2903400 NA G.N.Phung F.J.Schmuckle R. Doerner B.Kahne T.Fritzsch U.Arz W.Heinrich manual SchmucklePASHL2019 1084 2019 4 24 14IND02: PlanarCal: Microwave measurements for planar circuits and components Calibration, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), on-wafer probing, probes https://oar.ptb.de/resources/show/10.7795/530.20190424A EMPIR 2014: Industry Physikalisch-Technische Bundesanstalt (PTB) 30 10.7795/530.20190424A NA F.J.Schmuckle G.N.Phung U.Arz M.Spirito W.Heinrich R.Lozar manual HaddadiDLHGLHPZWHMSRKPASC2019 1085 2019 4 24 14IND02: PlanarCal: Microwave measurements for planar circuits and components Calibration, on-wafer, S-parameters, traceability, uncertainty budget, coplanar waveguide (CPW), electromagnetic field simulation, parasitic modes, substrate modes, multiline-thru-reflect-line (mTRL), microwave probes, extreme impedance measurement, impedance mismatch, microwave interferometry, nanoelectronics, nanostructures, noise, vector network analyzer (VNA) https://oar.ptb.de/resources/show/10.7795/530.20190424B EMPIR 2014: Industry Physikalisch-Technische Bundesanstalt (PTB) 30 10.7795/530.20190424B NA K.Haddadi G.Dambrine R.Lozar K.Helmreich G.Gold K.Lomakin W.Heinrich G.N.Phung M.Zeier M.Wollensack J.Hoffmann F.Mubarak X.Shang N.Ridler K.Kuhlmann T.Probst U.Arz M.Spirito R.Clarke article XuLLALAGMWTLATSPDA2019 1116 Optica 2019 4 6 4 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 411 Diode lasers; Laser beams; Laser sources; Optical components; Saturation spectroscopy; Tunable lasers; EMPIR 2015: SI Broader Scope The Optical Society 30 2334-2536 10.1364/OPTICA.6.000411 NA R.Santagata D.B.A.Tran B.Argence O.Lopez S.K.Tokunaga F.Wiotte H.Mouhamad A.Goncharov M.Abgrall Y.Le Coq H.Alvarez-Martinez R.Le Targat W.K.Lee D.Xu P.E.Pottie B.Darquié A.Amy-Klein article DarquieSPXATAWTLMAGLLAL2019 1116 Optica 2019 4 6 4 15SIB05: OFTEN: Optical frequency transfer - a European network 411 optical Fiber, optical frequency transfer EMPIR 2015: SI Broader Scope The Optical Society 30 2334-2536 10.1364/OPTICA.6.000411 NA R.Santagata D.B.A.Tran B.Argence O.Lopez S.K.Tokunaga F.Wiotte H.Mouhamad A.Goncharov M.Abgrall Y.Le Coq H.Alvarez-Martinez R.Le Targat W.K.Lee D.Xu P.E.Pottie B.Darquié A.Amy-Klein article HanselaerAL2019 1223 Journal of Coatings Technology and Research 2019 4 16 4 16NRM08: BiRD: Bidirectional reflectance definitions 913-921 specular gloss meterimage-based gloss measurementcontrast glossorange peel https://rdcu.be/bTtmT EMPIR 2016: Pre-Co-Normative Springer Science and Business Media LLC 30 1547-0091, 1935-3804 10.1007/s11998-019-00184-8 NA F.B.Leloup J.Audenaert P.Hanselaer article BuechelerTSALWCW2019 1241 Science and Technology of Advanced Materials 2019 4 20 1 16ENG03: HyMet: Hybrid metrology for thin films in energy applications 313-323 time-resolved photoluminescence EMPIR 2016: Energy Informa UK Limited 30 1468-6996, 1878-5514 10.1080/14686996.2019.1586583 NA T.P.Weiss R.Carron M.H.Wolter J.Löckinger E.Avancini S.Siebentritt S.Buecheler A.N.Tiwari article MarquesTUWdLLLGHA2019 1369 Physical Review Applied 2019 4 11 4 17FUN06: SIQUST: Single-photon sources as new quantum standards 044011 quantum dots, optoelectronics, spin-orbit coupling, Aharonov-Bohm effect https://arxiv.org/abs/1710.08828 EMPIR 2017: Fundamental American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.11.044011 NA J.M.Llorens V.Lopes-Oliveira V.López-Richard E.R. Cardozode Oliveira L.Wewiór J.M.Ulloa M.D.Teodoro G.E.Marques A.García-Cristóbal G.-Q.Hai B.Alén article KiselevDMFVPABBLXBHD2019 1024 Sensors 2019 2019 3 22 19(6) 1410 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements cantilever microprobe; high-speed; contact resonance; tip wear; piezo-resistive; mechanical damping; tip-testing standard https://www.mdpi.com/1424-8220/19/6/1410 EMPIR 2017: Industry MDPI AG

Basel

30 10.3390/s19061410 NA U.Brand M.XU L.Doering J.Langfahl-Klabes H.Behle S.Bütefisch T.Ahbe E.Peiner S.Völlmeke T.Frank B.Mickan I.Kiselev M.Hauptmannl M.Drexel article KurlyandskayaSCMBACT2019 944 Journal of Magnetism and Magnetic Materials 2019 3 473 16NRM04: MagNaStand: Towards an ISO standard for magnetic nanoparticles 403-409 Magnetic hyperthermia, Fe-oxide, Magnetic nanoparticles EMPIR 2016: Pre-Co-Normative Elsevier BV 30 0304-8853 10.1016/j.jmmm.2018.10.107 NA M.Coïsson G.Barrera C.Appino F.Celegato L.Martino A.P.Safronov G.V.Kurlyandskaya P.Tiberto article GramegnaRPARVDG2019 1006 Scientific Reports 2019 2 28 9 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 1-9 quantum technologies EMPIR 2017: Fundamental Springer Nature 30 2045-2322 10.1038/s41598-019-39334-8 NA S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.Ruo Berchera I.P.Degiovanni M.Genovese article GramegnaRPARVDG20190 1006 Scientific Reports 2019 2 28 9 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1-9 quantum technologies EMPIR 2017: Fundamental Springer Nature 30 2045-2322 10.1038/s41598-019-39334-8 NA S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.Ruo Berchera I.P.Degiovanni M.Genovese article GramegnaRPARVDG20191 1006 Scientific Reports 2019 2 28 9 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 1-9 quantum technologies EMPIR 2014: Industry Springer Nature 30 2045-2322 10.1038/s41598-019-39334-8 NA S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.Ruo Berchera I.P.Degiovanni M.Genovese article PiacentiniGRAVVMDG2019 1005 Nature Communications 2019 1 14 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards 1-7 quantum entanglement, pseudo-density operators, https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/ EMPIR 2017: Fundamental Springer Nature 30 2041-1723 10.1038/s41467-018-08100-1 NA C.Marletto V.Vedral S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.P.Degiovanni M.Genovese article PiacentiniGRAVVMDG20190 1005 Nature Communications 2019 1 14 10 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits 1-7 quantum entanglement, pseudo-density operators, https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6331626/ EMPIR 2017: Fundamental Springer Nature 30 2041-1723 10.1038/s41467-018-08100-1 NA C.Marletto V.Vedral S.Virzì E.Rebufello A.Avella F.Piacentini M.Gramegna I.P.Degiovanni M.Genovese proceedings SavinA2019 977 2018 International Workshop on Computing, Electromagnetics, and Machine Intelligence (CEMi) 2019 1 14 14IND02: PlanarCal: Microwave measurements for planar circuits and components 79-80 uncertainty,calibration,standards,measurement uncertainty,coplanar waveguides,scattering, parameters,microwave measurement https://doi.org/10.1109/CEMI.2018.8610566 EMPIR 2014: Industry IEEE Stellenbosch, South Africa 2018 International Workshop on Computing, Electromagnetics, and Machine Intelligence (CEMi) 21-11-2018 to 24-11-2018 30 978-1-5386-7845-9 10.7795/EMPIR.14IND02.CA.20190403F NA A.Savin U.Arz article VavassoriASCGPRCC2019 1307 Nanoscale 2019 11 10 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 4478-4488 MFM https://pubs.rsc.org/en/content/articlelanding/2019/NR/C8NR07729K#!divAbstract EMPIR 2015: SI Broader Scope Royal Society of Chemistry (RSC) 30 2040-3364, 2040-3372 10.1039/C8NR07729K NA H.Corte-León H.Corte-León L A.Rodríguez M.Pancaldi C.Gatel D.Cox E.Snoeck V.Antonov P.Vavassori proceedings SpasovaBNOSCTHZSAV2019 1490 19th International Congress of Metrology (CIM2019) 2019 - 2019 18RPT03: MetForTC: Traceable measurement capabilities for monitoring thermocouple performance 5/18006 EMPIR Research Potential Project, ITS-90 Temperature Scale, Thermometry, Thermocouple EMPIR 2018: Research Potential EDP Sciences Paris, France 19th International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201918006 NA N.Arifovic D.Sestan D.Zvizdić N.Hozic E.Turzó-András S.Čohodarević R.Strnad K.Opel D.Neagu C.Bordianu S.Spasova T.Vukičević proceedings SmithFAHP2019 1515 19th International Congress of Metrology (CIM2019) 2019 17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty Conformity assessmentRiskCAsoftUncertainty MAT EMPIR 2017: Support for Impact EDP Sciences Paris International Congress of Metrology 24-09-2019 to 26-09-2019 30 10.1051/metrology/201916001 NA A.Allard N.Fischer I.Smith P.Harris L.Pendrill article AkramMNBKKO2019 1056 IEEE Transactions on Applied Superconductivity 2019 29 7 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 1200308 Photodiodes, Integrated circuits, Josephson junctions, Optical distortion, Junctions, Bit rate, Optical pulses EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 1051-8223, 1558-2515, 2378-707 10.1109/TASC.2019.2901573 NA B.Karlsen O.Kieler R.Behr T.A.Tuan Nguyen H.Malmbekk M.N.Akram P.A.Ohlckers proceedings FateevPDJAWSSHSLAS2018 1022 Journal of Physics: Conference Series 2018 12 1065 2018 17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures 162015 dynamic pressure, dynamic temperature, traceability, measurement standard, calibration method, calibration procedure, measurement uncertainty, validation, reliability, pressure measurement, temperature measurement EMPIR 2017: Industry IOP Publishing Belfast XXII World Congress of the International Measurement Confederation (IMEKO 2018) 03-09-2018 to 06-09-2018 30 10.1088/1742-6596/1065/16/162015 NA S.Saxholm S.Saxholm R.Högström C.Sarraf G.Sutton R.Wynands F.Arrhén G.Jönsson Y.Durgut A.Peruzzi A.Fateev M.Liverts C.Adolfse article SchioppoNMMLLIHCFBBBBAWSLWZZZ2018 958 Science Advances 2018 12 4 12 15SIB03: OC18: Optical clocks with 1E-18 uncertainty eaau4869 optical atomic clocks, sensor network, dark matter http://advances.sciencemag.org/content/4/12/eaau4869.full EMPIR 2015: SI Broader Scope American Association for the Advancement of Science (AAAS) 30 2375-2548 10.1126/sciadv.aau4869 NA P.Wcisło P.Ablewski K.Beloy S.Bilicki M.Bober R.Brown R.Fasano R.Ciuryło H.Hachisu T.Ido J.Lodewyck A.Ludlow W.McGrew P.Morzyński D.Nicolodi M.Schioppo M.Sekido R.Le Targat P.Wolf X.Zhang B.Zjawin M.Zawada proceedings nceABADU2018 1023 Journal of Physics: Conference Series 2018 12 1065 2018 17IND07: DynPT: Development of measurement and calibration techniques for dynamic pressures and temperatures 162013 dynamic pressure, dynamic calibration, pressure measurement, pressure calibration, pressure transducer, traceability, signal conditioning, drop mass https://doi.org/10.1088/1742-6596/1065/16/162013 EMPIR 2017: Industry IOP Publishing Belfast XXII World Congress of the International Measurement Confederation (IMEKO 2018) 03-09-2018 to 06-09-2018 30 1742-6588, 1742-6596 1742-6588, 1742-6596 10.1088/1742-6596/1065/16/162013 NA Y.Durgut B.Aydemir E.Bağcı E.Akşahin A.T.İnce U.Uslukılıç article DorscherASBSSPOHHSL2018 1054 Physical Review A 2018 11 29 98 5 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 053443 optical clocks, optical lattice clock, isotope shift, clock comparisons https://www.ptb.de/cms/fileadmin/internet/fachabteilungen/abteilung_4/4.3_quantenoptik_und_laengeneinheit/4.32/ori18.pdf EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 2469-9926, 2469-9934 10.1103/PhysRevA.98.053443 NA S.Origlia M.S.Pramod S.Schiller Y.Singh K.Bongs R.Schwarz A.Al-Masoudi S.Dörscher S.Herbers S.Häfner U.Sterr C.Lisdat article FarooqAMLPLVF2018 1028 Fuel 2018 11 232 16ENG09: LNG III: Metrological support for LNG and LBG as transport fuel 423-430 Alternative fuels, combustion, kinetics, LNG, Shock tube, RCM EnG https://www.sciencedirect.com/science/article/pii/S0016236118308238 EMPIR 2016: Energy Elsevier BV 30 0016-2361 10.1016/j.fuel.2018.04.168 NA S.K.Vallabhuni A.D.Lele V.Patel A.Lucassen K.Moshammer M.AlAbbad A.Farooq R.X.Fernandes article MehdiSouzaniANA2018 863 Measurement 2018 10 127 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 134-140 Trust region methods, Aspheric shapes, Minimax, Chebyshev fitting, Minimization, Form error, Dimensional metrology, Ultra-high precision engineering EMPIR 2015: SI Broader Scope Elsevier BV 30 0263-2241 10.1016/j.measurement.2018.05.071 NA Y.Arezki H.Nouira N.Anwer C.Mehdi-Souzani article HisamotoRHLASTYTLSK2018 595 Journal of the Physical Society of Japan 2018 9 15 87 9 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 094801 Si, CMOS, transistor, quantum dipole, Heisenberg model EMPIR 2015: SI Broader Scope Physical Society of Japan 30 0031-9015, 1347-4073 10.7566/jpsJ.87.094801 NA S.Saito Z.Li H,Yoshimoto I.Tomita Y.Tsuchiya Y.Sasago H.Arimoto F.Liu M.K.Husain D.Hisamoto H.N.Rutt S.Kurihara proceedings AllalARJG2018 1032 2018 IEEE Conference on Antenna Measurements & Applications (CAMA) 2018 9 16NRM07: Vector SAR: SAR measurement using vector probes 1-4 SAR, MIMO, Planar Near-Field Measurement System, Vector Field Measurement https://hal.archives-ouvertes.fr/hal-02376333 EMPIR 2016: Pre-Co-Normative IEEE Vasteras 2018 IEEE Conference on Antenna Measurements & Applications (CAMA) 03-09-2018 to 06-09-2018 30 10.1109/CAMA.2018.8530621 NA L.Aberbour O.Jawad M.Ramdani P.Giry T.Julien proceedings ProbstHDSPA2018_2 939 2018 48th European Microwave Conference (EuMC) 2018 9 14IND02: PlanarCal: Microwave measurements for planar circuits and components on-wafer probes, coplanar waveguides (CPW), substrate modes, calibration https://www.fbh-berlin.com/publications-patents/publications/title/impact-of-substrate-modes-on-mtrl-calibrated-cpw-measurements-in-g-band EMPIR 2014: Industry IEEE Madrid 2018 48th European Microwave Conference 23-09-2018 to 28-09-2018 30 10.23919/EuMC.2018.8541813 NA G.N.Phung F.J.Schmuckle R. Doerner W.Heinrich T.Probst U.Arz proceedings AzevedoGoncalvesAGLDGD2018 1701 2018 43rd International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz) 2018 9 - - 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications - - https://zenodo.org/record/4295560#.X8M60s1Kg2x EMPIR 2016: Energy IEEE Nagoya, Japan 43rd International Conference on Infrared, Millimeter, and Terahertz Waves (IRMMW-THz) 09-09-2018 to 14-09-2018 30 978-1-5386-3810-1 2162-2035 10.1109/IRMMW-THz.2018.8510217 NA J.C.Azevedo Goncalves I.Alaji D.Gloria S.Lépilliet F.Danneville C.Gaquiere G.Ducournau proceedings AzevedoGoncalvesAGGGLDDG2018 1702 2018 48th European Microwave Conference (EuMC) 2018 9 - - 16ENG06: ADVENT: Metrology for advanced energy-saving technology in next-generation electronics applications - - https://zenodo.org/record/4294934#.X8XOjs1Kg2z EMPIR 2016: Energy IEEE Madrid Spain On Wafer Millimetre Wave Power Detection Using a PN Junction Diode in BiCMOS 55 nm for In-Situ Large Signal Characterization 23-09-2018 to 27-09-2018 30 978-2-87487-051-4 - 10.23919/EuMC.2018.8541387 NA Joao CarlosAzevedo Goncalves IssaAlaji DanielGloria VincentGidel FredericGianesello SylvieLepilliet GuillaumeDucournau FrancoisDanneville C.Gaquiere article KoppmannHGRAMO2018 Atmospheric Measurement Techniques 2018 8 14 11 8 ENV53: MetEOC2: Metrology for earth observation and climate 4757-4762 GLORIA, Calibration EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-11-4757-2018 NA R.Koppmann J.Hollandt B.Gutschwager M.Reiniger A.Adibekyan C.Monte F.Olschewski article YooSWWIAKR2018 842 AAPS PharmSciTech 2018 8 10 19 11 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 3D printing; paracetamol; sustained release; immediate release; personalised medicine; geometry https://link.springer.com/article/10.1208/s12249-018-1107-z EMPIR 2015: Health American Association of Pharmaceutical Scientists (AAPS) 30 1530-9932 10.1208/s12249-018-1107-z NA S.A.Khaled M.R.Alexander D.J.Irvine R.D.Wildman M.J.Wallace S.Sharpe J.Yoo C.J.Roberts article KuuskABVF2018 2453 IEEE Journal of Selected Topics in Applied Earth Observations and Remote Sensing 2018 8 11 8 16ENV03: MetEOC-3: Further metrology for earth observation and climate 2925-2932 Optical fibre devices, Optical spectroscopy, stray light, laser measurement, Illumination beam geometry EMPIR 2016: Environment Institute of Electrical and Electronics Engineers (IEEE) 30 1939-1404, 2151-1535 10.1109/JSTARS.2018.2841772 NA J.Kuusk I.Ansko A.Bialek R.Vendt N.Fox article NeuvonenAALBBPMSPFWSBL2018 1062 Journal of Physics: Conference Series 2018 8 1065 8 17RPT02: rhoLiq: Establishing traceability for liquid density measurements 082013 density of liquids; hydrostatic weighing; oscillation-type density meters https://iopscience.iop.org/article/10.1088/1742-6596/1065/8/082013/pdf EMPIR 2017: Research Potential IOP Publishing

Temple Circus Temple Way Temple Way Bristol BS1 6BE United Kingdom

30 1742-6588, 1742-6596 10.1088/1742-6596/1065/8/082013 NA A.Furtado J.Pereira M.Schiebl G.Mares G.Popa P.Bartos J.Bebic E.Lenard A.Alic S.Alisic P.Neuvonen H.Wolf G.Sariyerli A.Bescupschii B.Laky article JelezkoDNAEBGJSMTFDGO2018 1010 Physical Review Applied 2018 7 25 10 1 17FUN06: SIQUST: Single-photon sources as new quantum standards Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance https://arxiv.org/abs/1706.07935 EMPIR 2017: Fundamental American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.014024 NA J.Forneris S.Ditalia Tchernij P.Traina E.Moreva N.Skukan M.Jakšić V.Grilj F.Bosia E.Enrico G.Amato I.P.Degiovanni B.Naydenov F.Jelezko M.Genovese P.Olivero article JelezkoDNAEBGJSMTFDGO20180 1010 Physical Review Applied 2018 7 25 10 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits Crystal defects, Quantum information with hybrid systems, Quantum sensing, Elemental semiconductors, Nitrogen vacancy centers in Diamond, Optically detected magnetic resonance EMPIR 2017: Fundamental American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.10.014024 NA https://arxiv.org/abs/1706.07935 J.Forneris S.Ditalia Tchernij P.Traina E.Moreva N.Skukan M.Jakšić V.Grilj F.Bosia E.Enrico G.Amato I.P.Degiovanni B.Naydenov F.Jelezko M.Genovese P.Olivero article MonteGAUKK2018 Atmospheric Measurement Techniques 2018 7 11 7 ENV53: MetEOC2: Metrology for earth observation and climate 3871-3882 GLORIA, EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1867-8548 10.5194/amt-11-3871-2018 NA C.Monte B.Gutschwager A.Adibekyan J.Ungermann I.Krisch A.Kleinert proceedings ArifovicDKM2018 855 Conference on Precision Electromagnetic Measurements (CPEM 2018) 2018 7 1 1 15NRM02: UHV: Techniques for ultra-high voltage and very fast transients 1-2 Calibration, charge measurement, partial discharge, PD measurement, uncertainty https://zenodo.org/record/1343872#.W9cMuNX7TIU
https://ieeexplore.ieee.org/document/8500956/metrics#metrics EMPIR 2015: Pre-Co-Normative 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) Paris, France 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 08-07-2018 to 13-07-2018 30 978-1-5386-0973-6 978-1-5386-0974-3 10.5281/zenodo.1343872 NA A.Merev I.Karaman S.Dedeoğlu M.Arifoviç article WeisbachKHDBALKHW2018 515 Spectrochimica Acta Part B: Atomic Spectroscopy 2018 7 145 14IND07: 3D Stack: Metrology for manufacturing 3D stacked integrated circuits 36-42 X-ray fluorescence, calibration samples https://arxiv.org/abs/1801.04246 EMPIR 2014: Industry Elsevier BV 30 0584-8547 10.1016/j.sab.2018.04.001 NA P.Honicke M.Krämer L.Lühl K.Andrianov B.Beckhoff R.Dietsch T.Holz B.Kanngießer D.Weißbach T.Wilhein proceedings GrajciarDACHP2018 887 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 2018 7 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 1-2 Harmonic effect, microwave measurements, microwave power, power sensor, uncertainty http://rfmw.cmi.cz/documents/papers/Celep_HarmonicEffect_cpem2018.pdf EMPIR 2015: Research Potential IEEE Paris, France 2018 Conference on Precision Electromagnetic Measurements 08-07-2018 to 13-07-2018 30 978-1-5386-0974-3 2160-0171 10.1109/CPEM.2018.8500788 NA MuratCELEP YaserAbdo KarelDražil JanGrajciar MartinHudlicka BorutPinter article SigrayLCBMBBAHRGCBD2018 904 ACTA IMEKO 2018 7 7 2 15RPT02: UNAC-LOW: Underwater acoustic calibration standards for frequencies below 1 kHz 32 low frequency hydrophone calibration; low frequency underwater noise recorders; underwater acoustics; calibration http://dx.doi.org/10.21014/acta_imeko.v7i2.542 EMPIR 2015: Research Potential IMEKO International Measurement Confederation 30 2221-870X 10.21014/acta_imeko.v7i2.542 NA A.Biber A.C.Çorakçı A.Golick S.Robinson G.Hayman J.Ablitt S.Barrera-Figueroa S.Buogo S.Mauro F.Borsani S.Curcuruto M.Linné P.Sigray P.Davidsson article EllingsbergBAVLRWPS2018 1376 2018 Conference on Precision Electromagnetic Measurements (CPEM 2018) 2018 7 17NRM02: MeterEMI: Electromagnetic Interference on Static Electricity Meters Electromagnetic Compatibility, EMC immunity testing, energy measurement, static meters, standards, watthour meters. SEG https://zenodo.org/record/3587786#.XiGxp3u7KUn EMPIR 2017: Pre-Co-Normative IEEE 30 10.1109/CPEM.2018.8500945 NA P.S.Wright G.Rietveld F.Leferink H.E.van den Brom F.R.IAlonso J.P.Braun K.Ellingsberg M.Pous M.Svoboda article DorscherSFASL2018 567 Physical Review A 2018 6 25 97 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 063419 Optical lattice clocks, light-matter interaction, electronic transitions, https://arxiv.org/abs/1802.02945 EMPIR 2015: SI Broader Scope 30 10.1103/PhysRevA.97.063419 NA SörenDörscher RomanSchwarz AliAl-Masoudi StephanFalke UweSterr ChristianLisdat article MalhiARNDBOCL2018 959 Remote Sensing 2018 6 13 10 6 16ENV03: MetEOC-3: Further metrology for earth observation and climate 933 tree reconstruction, radiative transfer, terrestrial LiDAR, forestry, 3D modelling, calibration and validation, end-to-end traceability https://www.mdpi.com/2072-4292/10/6/933 EMPIR 2016: Environment MDPI AG 30 2072-4292 10.3390/rs10060933 NA K.Calders N.Origo A.Burt M.Disney J.Nightingale P.Raumonen M.Åkerblom Y.Malhi P.Lewis proceedings ProbstHDSPA2018 752 2018 IEEE/MTT-S International Microwave Symposium - IMS 2018 6 14IND02: PlanarCal: Microwave measurements for planar circuits and components 1296-1299 Calibration, measurement accuracy, on-wafer measurement, probe https://www.fbh-berlin.com/publications-patents/publications/title/effects-degrading-accuracy-of-cpw-mtrl-calibration-at-w-band EMPIR 2014: Industry IEEE

445 Hoes Lane Piscataway NJ 08855-1331 United States

Philadelphia 2018 IEEE/MTT-S International Microwave Symposium - IMS 10-06-2018 to 15-06-2018 30 10.1109/MWSYM.2018.8439837 NA G.N.Phung F.J.Schmuckle R. Doerner W.Heinrich T.Probst U.Arz proceedings ZinalADP2018 753 2018 91st ARFTG Microwave Measurement Conference (ARFTG) 2018 6 14IND02: PlanarCal: Microwave measurements for planar circuits and components Calibration, Substrates, Standards, Probes, Aluminum oxide, Frequency measurement, https://doi.org/10.1109/ARFTG.2018.8423829 EMPIR 2014: Industry IEEE Philadelphia, PA, USA 2018 91st ARFTG Microwave Measurement Conference (ARFTG) 15-06-2018 to 15-06-2018 30 10.7795/EMPIR.14IND02.CA.20190403C NA S.Zinal U.Arz R. Doerner T.Probst article deClercqZGRPCAB2018 Physical Review Applied 2018 6 9 6 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications Resonance raman transition, dual-frequency laser, long-term stability, rubidium, standard; compensation, performance, shifts, EMRP A169: Call 2012 Metrology for Industry (II) American Physical Society (APS) 30 2331-7019 10.1103/PhysRevApplied.9.064002 NA E.de Clercq T.Zanon-Willette S.Guérandel C.Rocher M.Petersen G.Coget M.Abdel Hafiz R.Boudot article DebogovicISAPdM2018 Electronics Letters 2018 5 31 54 11 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 691-693 three-dimensional printing, rapid prototyping (industrial), atomic clocks, microwave resonators, polymers, coatings, 3D printed microwave cavity, additively manufactured microwave resonator cavity, AM microwave resonator cavity, double-resonance vapour-cell atomic clock application, DR vapour-cell atomic clock application, loop-gap resonator approach, conventionally-machined aluminium component, metal-coated polymer, clock short-term stability EMRP A169: Call 2012 Metrology for Industry (II) Institution of Engineering and Technology (IET) 30 0013-5194, 1350-911X 10.1049/el.2017.4176 NA T.Debogovic A.E.Ivanov A.K.Skrivervik C.Affolderbach M.Pellaton E.de Rijk G.Mileti proceedings PousASTOC2018 765 2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility (EMC/APEMC) 2018 5 14 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 177-182 Aerospace, CS101, EMC, Immunity, Military, Time Domain http://rfmw.cmi.cz/documents/papers/Cakir_FFT_TDS_CS101.pdf EMPIR 2015: Research Potential IEEE Singapore 2018 IEEE International Symposium on Electromagnetic Compatibility and 2018 IEEE Asia-Pacific Symposium on Electromagnetic Compatibility 14-05-2018 to 18-05-2018 30 978-1-5090-5997-3 10.1109/ISEMC.2018.8393762 NA S.Çakır M.Ozturk B.Tektas O.Şen S.Acak M.Pous article GenoveseDBTVLGAP2018 532 Scientific Reports 2018 5 8 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies EMPIR 2014: Industry Springer Nature 30 2045-2322 10.1038/s41598-018-25156-7 NA F.Piacentini A.Avella M.Gramegna R.Lussana F.Villa A.Tosi G.Brida I.P.Degiovanni M.Genovese article GenoveseDBTVLGAP20180 532 Scientific Reports 2018 5 8 1 17FUN01: BeCOMe: Light-matter interplay for optical metrology beyond the classical spatial resolution limits Quantum Measurements, Weak Mesurements, Metrology for Quantum Technologies EMPIR 2017: Fundamental Springer Nature 30 2045-2322 10.1038/s41598-018-25156-7 NA F.Piacentini A.Avella M.Gramegna R.Lussana F.Villa A.Tosi G.Brida I.P.Degiovanni M.Genovese article VandervorstvAZFMMC2018 482 Journal of Vacuum Science & Technology B, Nanotechnology and Microelectronics: Materials, Processing, Measurement, and Phenomena 2018 5 36 3 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 03F130 accuracy, composition, Atom probe, GaN https://avs.scitation.org/doi/10.1116/1.5019693 EMPIR 2014: Industry American Vacuum Society 30 2166-2746, 2166-2754 10.1116/1.5019693 NA R.J.H.Morris R.Cuduvally D.Melkonyan C.Fleischmann M.Zhao L.Arnoldi P.van der Heide W.Vandervorst article BelenguerJKLA2018 796 EuCAP 2018 5 14IND10: MET5G: Metrology for 5G communications 5G, antennas, millimetre-wave, Empty Substrate Integrated Waveguide. http://www.eucap.org/ EMPIR 2014: Industry 30 NA https://arxiv.org/abs/1809.07817 A.Belenguer S.F.Jilani Z.U.Khan T. H.Loh A.Alomainy article AxnerZHS2018 804 Journal of Vacuum Science & Technology A: Vacuum, Surfaces, and Films 2018 5 36 3 14IND06: pres2vac: Industrial standards in the intermediate pressure-to-vacuum range 03E105 GAs modulation refractometry, Fabry Perot cavity refractometry EMPIR 2014: Industry American Vacuum Society 30 0734-2101, 1520-8559 10.1116/1.5022244 NA I.Silander T.Hausmaninger M.Zelan O.Axner article KimBBWLAM2018 843 Analytical Chemistry 2018 4 27 90 10 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 6001-6005 liquid extraction surface analysis (LESA); Droplet Microarray (DMA); extraction solvent; mass spectrometry https://pubs.acs.org/doi/pdf/10.1021/acs.analchem.8b00973 EMPIR 2015: Health American Chemical Society (ACS) 30 0003-2700, 1520-6882 10.1021/acs.analchem.8b00973 NA J.Meurs M.R.Alexander P.A.Levkin S.Widmaier J.Bunch D.A.Barrett D.H.Kim article HeinrichSPHDKA2018 1053 IEEE TRANSACTIONS ON MICROWAVE THEORY AND TECHNIQUES 2018 4 19 t.b.d. 14IND02: PlanarCal: Microwave measurements for planar circuits and components 1-10 Calibration, on-wafer, S-parameters, traceability, uncertainty budget https://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=8693763 EMPIR 2014: Industry IEEE 30 10.1109/TMTT.2019.2908857 NA U.Arz K.Kuhlmann T.Dziomba G.Hechtfischer G.Phung F.Schmückle W.Heinrich article LopezASLXP2018 1099 Optics Express 2018 4 26 8 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 9515 Fiber optics links and subsystems; Metrological instrumentation; Metrology; Phase measurement EMRP A169: Call 2011 SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.26.009515 NA O.Lopez A.Amy-Klein F.Stefani W.K.Lee D.Xu P.E.Pottie article LopezASLXP20180 837 Optics Express 2018 4 26 8 15SIB05: OFTEN: Optical frequency transfer - a European network 9515 Fiber optics links and subsystems; Metrological instrumentation; Metrology; Phase measurement EMRP A169: Call 2011 SI Broader Scope The Optical Society 30 1094-4087 10.1364/OE.26.009515 NA D.Xu W.K.Lee F.Stefani O.Lopez A.Amy-Klein P.E.Pottie article NouiraAMZA2018 862 Precision Engineering 2018 4 52 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 300-307 Aspheric shape, Chebyshev fitting, Exponential Penalty Function, Primal-Dual Interior Point Method, Form errors EMPIR 2015: SI Broader Scope Elsevier BV 30 0141-6359 10.1016/j.precisioneng.2018.01.008 NA Y.Arezki X.Zhang C.Mehdi-Souzani N.Anwer H.Nouira article LewisAWNDOC2018 Agricultural and Forest Meteorology 2018 4 252 ENV53: MetEOC2: Metrology for earth observation and climate 231-240 Sensor comparison, Leaf area index, Terrestrial LiDAR, Hemispherical photography, LAI-2200, Validation. http://discovery.ucl.ac.uk/1542932/1/Origo_1-s2.0-S0168192317300369-main.pdf EMRP A169: Call 2013 Environment II Elsevier BV 30 0168-1923 10.1016/j.agrformet.2018.01.029 NA P.Lewis J.Armston W.Woodgate J.Nightingale M.Disney N.Origo K.Calders article AarhaugHAGCMB2018 502 International Journal of Hydrogen Energy 2018 4 15NRM03: Hydrogen: Metrology for sustainable hydrogen energy applications ISO14687-2, Hydrogen quality, Fuel cell electrical vehicle, Probability of occurrence, Hydrogen production process, ISO 19880-8 https://www.sciencedirect.com/science/article/pii/S0360319918308450 EMPIR 2015: Pre-Co-Normative Elsevier BV 30 0360-3199 10.1016/j.ijhydene.2018.03.084 NA TBacquart AMurugan MCarré BGozlan FAuprêtre FHaloua T.A.Aarhaug article RawsonHAS2018 841 Bioelectronic Medicine 2018 3 15 4 1 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance Bioelectronic interfaces, Bioelectrochemistry, Nanobioelectronics, Cellular signalling https://link.springer.com/content/pdf/10.1186%2Fs42234-018-0001-z.pdf EMPIR 2015: Health Springer Nature 30 2332-8886 10.1186/s42234-018-0001-z NA P.Sanjuan-Alberte M.R.Alexander R.J.M.Hague F.J.Rawson article deRijkSPDIMAM2018 Applied Physics Letters 2018 3 12 112 11 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 113502 gap resonator, frequency stability, frequency standard EMRP A169: Call 2012 Metrology for Industry (II) AIP Publishing 30 0003-6951, 1077-3118 10.1063/1.5019444 NA E.de Rijk A.K.Skrivervik M.Pellaton T.Debogovic A.E.Ivanov W.Moreno C.Affolderbach G.Mileti article BarlowKGAWIOS2018 830 Metrologia 2018 2 55 2 15SIB02: InK 2: Implementing the new kelvin 2 S43-S51 large-area high-temperature fixed point, blackbody, rhenium–carbon,tungsten carbide–carbon, photometry EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 NA https://link.springer.com/article/10.1007%2Fs10765-017-2273-z C.Barlow B.Khlevnoy I.Grigoryeva K.Anhalt M. Waehmer E. Ivashin D. Otryaskin M.Solodilov article OhlckersAMKB2018 455 Microelectronics Reliability 2018 2 81 February 2 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 362-367 Optoelectronic packaging, Cryogenics, Voltage standards EMPIR 2015: SI Broader Scope Elsevier BV 30 0026-2714 10.1016/j.microrel.2017.10.034 NA E.Bardalen B.Karlsen H.Malmbekk M.N.Akram P.Ohlckers article HudlickaPOPAS2018 597 IEEE Transactions on Instrumentation and Measurement 2018 2 67 5 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 1187-1198 Receivers, Electromagnetic interference, Calibration, Current measurement, Standards, Real-time systems, Frequency measurement EMPIR 2015: Research Potential Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2018.2794941 NA https://upcommons.upc.edu/handle/2117/116447 M.A.Azpurua M.Pous J.A.Oliva B.Pinter M.Hudlicka F.Silva article ArzLDOP2018 525 ARFTG Microwave Measurement Symposium (ARFTG), 2017 Nov 28th - Dec 1st 2018 1 15 14IND02: PlanarCal: Microwave measurements for planar circuits and components Calibration, Ceramics, Probes, Metals, Substrates, Frequency measurement, Geometry, alumina, measurement standards, microwave measurement, network analysers, S-parameters devices under tests, measurement configurations, alumina calibration substrate, calibrations, probe geometry, measurement system, highly accurate multiline TRL calibration, vector network analyzer measurement, frequency 110.0 GHz, Al2O3, on-wafer, substrate https://doi.org/10.1109/ARFTG.2017.8255867 EMPIR 2014: Industry IEEE 30 10.7795/EMPIR.14IND02.CA.20190403A NA U.Arz R. Lazar R. Doerner M. Ohlrogge T.Probst article AnwerMAN2018 860 Procedia CIRP 2018 75 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 331-336 computational metrology fitting reference data EMPIR 2015: SI Broader Scope Elsevier BV 30 2212-8271 10.1016/j.procir.2018.04.051 NA Y.Arezki C.Mehdi-Souzani N.Anwer H.Nouira article AlexanderWWNRPHH2018 844 RSC Advances 2018 8 28 15HLT01: MetVBadBugs: Quantitative measurement and imaging of drug-uptake by bacteria with antimicrobial resistance 15352-15357 nanoparticles, polymer microparticles, polymerizable monomer https://pubs.rsc.org/en/content/articlepdf/2018/ra/c8ra01491d EMPIR 2015: Health Royal Society of Chemistry (RSC) 30 2046-2069 10.1039/C8RA01491D NA A.Hüsler S.Haas L.Parry M.Romero T.Nisisako P.Williams R.D.Wildman M.R.Alexander article OhlckersAMKB2018_2 1183 International Journal of Metrology and Quality Engineering 2018 9 15SIB04: QuADC: Waveform metrology based on spectrally pure Josephson voltages 13 optoelectronics / cryogenics / voltage standards EMPIR 2015: SI Broader Scope EDP Sciences 30 2107-6847 10.1051/ijmqe/2018015 NA E.Bardalen B.Karlsen H.Malmbekk M.N.Akram P.Ohlckers article RockstuhlRLZGAAP2018 869 Phys. Rev. B 2018 98 7 14IND13: Photind: Metrology for the photonics industry - optical fibres, waveguides and applications 075141 Geometrical & wave optics, Interference & diffraction of light, Light propagation, transmission & absorption, Light-matter interaction, Luminescence, Nanophotonics, ,Optoelectronics, Spontaneous emission https://arxiv.org/abs/1804.02230 EMPIR 2014: Industry American Physical Society 30 10.1103/PhysRevB.98.075141 NA M.G.Abebe A.Abass G. Gomard L.Zschiedrich U.Lemmer B.S. Richards C.Rockstuhl U.W. Paetzold proceedings KummeSAFW2018 882 Conference Proceedings 22. IMEKO World Congress 2018 2018 14IND14: MNm Torque: Torque measurement in the MN•m range torque transducers, traceable measurement, extrapolation, partial full range measurement, 20kN EMPIR 2014: Industry Belfast, Northern Ireland 22. IMEKO World Congress 03-09-2018 to 06-09-2018 30 10.1088/1742-6596/1065/4/042057 NA P.Weidinger G.Foyer J.Ala-Hiiro C.Schlegel R.Kumme article BurnsRMNBFLADYHR2017 499 Nature Communications 2017 12 22 8 1 15HLT07: AntiMicroResist: Novel materials and methods for the detection, traceable monitoring and evaluation of antimicrobial resistance 2263 Antimicrobials, Protein design, Self-assembly, Biometrology EMPIR 2015: Health Springer Nature 30 2041-1723 10.1038/s41467-017-02475-3 NA E.De Santis H.Alkassem B.Lamarre N.Faruqui A.Bella J.E.Noble N.Micale S.Ray J.R.Burns A.R.Yon B.W.Hoogenboom M.G.Ryadnov article NielsenAKKIIHGFCCBHOOSS2017 International Journal of Thermophysics 2017 12 39 1 SIB64: METefnet: Metrology for moisture in materials Karl Fischer, Loss-on-drying, Moisture, Oven drying, Traceability EMRP A169: Call 2012 SI Broader scope (II) Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-017-2340-5 NA J.Nielsen R.Aro M.Krasheninina T.Keawprasert N.Ismail G.V.Ionescu D.Hudoklin E.Georgin V.Fernicola G.Cortellessa B.I.Choi S.Bell M.Heinonen S.Oguz Aytekin P.Österberg J.Skabar R.Strnad proceedings SchmuckleHPAZH2017 521 2017 90th ARFTG Microwave Measurement Symposium (ARFTG) 2017 11 30 14IND02: PlanarCal: Microwave measurements for planar circuits and components on-wafer, calibration, S-parameters, traceability,uncertainty budget https://doi.org/10.1109/ARFTG.2017.8255874 EMPIR 2014: Industry IEEE Boulder, Colorado ARFTG Microwave Measurement Symposium 28-11-2017 to 01-12-2017 30 978-1-5386-4356-3 10.7795/EMPIR.14IND02.CA.20190403 NA Franz-JosefSchmuckle WolfgangHeinrich ThorstenProbst UweArz SherkoZinal GerdHechtfischer article BaeHCGHAK2017 414 Journal of Applied Physics 2017 11 21 122 19 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 194502 single electron pump, quantum dot, single electron tunneling http://aip.scitation.org/doi/abs/10.1063/1.5000319 EMPIR 2015: SI Broader Scope AIP Publishing 30 0021-8979, 1089-7550 10.1063/1.5000319 NA Y.H.Ahn Y.P.Hong C.Hong Y.S.Ghee Y.Chung M.H.Bae N.Kim article LestremauLKvBMBCBRYAB2017 Biomass and Bioenergy 2017 10 105 ENG54: Biogas: Metrology for biogas 127-135 BiogasCompositionImpuritiesVesselsSampling EnG http://www.sciencedirect.com/science/article/pii/S0961953417302118 EMRP A169: Call 2013 Energy II Elsevier BV 30 10.1016/j.biombioe.2017.06.025 NA F.Lestremau J.Li I.Krom A.M.H.van der Veen B.Brewer A.Murugan S.Bartlett L.Culleton O.Büker L.Rosell H.Yaghooby K.Arrhenius J.Beranek proceedings HoogenboomAHR2017 391 CIRED - Open Access Proceedings Journal 2017 10 2017 1 14IND08: ElPow: Metrology for the electrical power industry 329-332 power transformer testing power factor; error sources; Ecodesign Directive; sustainable energy policies; high-quality TLM systems; efficiency requirements; power transformer loss test; TLM system calibration; transformer loss measurement systems; EU; calibration accuracies; advanced digital signal processing technique; ecodesign efficiency requirement SEG http://digital-library.theiet.org/content/journals/10.1049/oap-cired.2017.0475 EMPIR 2014: Industry Institution of Engineering and Technology (IET) Scottish Event Campus (SEC), Glasgow, Scotland CIRED 2017 12-06-2017 to 15-06-2017 30 2515-0855 10.1049/oap-cired.2017.0475 NA G.Rietveld E.Houtzager M.Acanski D.Hoogenboom article WehmannLSTVASFNLZSHW2017 Journal of Crystal Growth 2017 10 476 ENG62: MESaIL: Metrology for efficient and safe innovative lighting 90-98 Crystal morphology, Metalorganic vapor phase epitaxy, Gallium compounds, Nitrides, Light emitting diodes http://www.sciencedirect.com/science/article/pii/S0022024817305146 EMRP A169: Call 2013 Energy II Elsevier BV 30 0022-0248 10.1016/j.jcrysgro.2017.08.021 NA H-HWehmann H-JLugauer M.Straßburg A.Trampert T.Varghese A.Avramescu T.Schimpke S.Fündling L.Nicolai J.Ledig H.Zhou F.Steib J.Hartmann AWaag proceedings GrandidierEBXFMDAHD2017 421 2017 47th European Microwave Conference (EuMC) 2017 10 14IND02: PlanarCal: Microwave measurements for planar circuits and components MEMS GSG Probe, nano-prober, Nanowire, on-wafer, microwave https://hal.archives-ouvertes.fr/hal-01726555 EMPIR 2014: Industry IEEE Nuremberg EuMC 08-10-2017 to 12-10-2017 30 10.23919/EuMC.2017.8230973 NA K.Daffé J.Marzouk A. ElFellahi T.Xu C.Boyaval S.Eliet B.Grandidier S.Arscott G.Dambrine K.Haddadi article FailleauHHPSRBZARGVSSKSPLG2017 Applied Radiation and Isotopes 2017 9 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities Decommissioning, Sample preparation, Metrology EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.08.032 NA G.Failleau B.Hay P.Holm K.Peräjärvi J.Sand B.Rogiers S.Boden D.Zapata-García D.Arnold B.Russell M.Garcia Miranda R.Van Ammel J.Solc J.Smoldasova P.Kovář J.Šuráň S.Plumeri Y.Laurent Beck T.Grisa article BogucarskaPdJASSSKSTv2017 Applied Radiation and Isotopes 2017 9 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities nuclear decommissioning, radioactive waste, free release, clearance level EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2017.09.043 NA T.Bogucarska B.Pedersen P.De Felice S.Jerome D.Arnold L.Skala J.Solc J.Smoldasova P.Kovář J.Šuráň F.Tzika R.Van Ammel article AgustoniFHCMMA2017 2017 IEEE International Workshop on Applied Measurements for Power Systems (AMPS) 2017 9 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids 19-24 Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measurement standards SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/AMPS.2017.8078324 NA M.Agustoni S.Fricke E.Houtzager H.Çaycı A.Mortara E.Mohns B.Ayhan proceedings PousOAS2017 434 2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE 2017 9 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 1-6 Statistical signal processing, Extreme value estimation, Electromagnetic interference, Electromagneticmeasurements, Time-domain analysis https://upcommons.upc.edu/handle/2117/116880 EMPIR 2015: Research Potential IEEE

445 Hoes Lane Piscataway NJ 08855-1331 United States

Angers, France 2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE 04-09-2017 to 07-09-2017 30 978-1-5386-0689-6 2325-0364 10.1109/EMCEurope.2017.8094729 NA Marco A.Azpúrua Jose A.Oliva MarcPous FerranSilva article AntonanzasTorresGPLRTHKGU2017 Remote Sensing of Environment 2017 9 199 ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification 171-186 Satellite-based models, Global horizontal irradiance, CM SAF, Solar radiation data, Pyranometer EMRP A169: Call 2013 Energy II Elsevier BV 30 0034-4257 10.1016/j.rse.2017.07.013 NA F.Antonanzas-Torres R.Gottschalg D.Palmer A.Lindfors A.Riihelä J.Trentmann T.Huld E.Koubli A.M.Gracia-Amillo R.Urraca proceedings PousAS2017 433 2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE 2017 9 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 1-6 Amplitude Probability Distribution, Impulsive noise, In-situ measurements, Electromagnetic interference, Electromagnetic measurements, Time-domain analysis https://upcommons.upc.edu/handle/2117/116885 EMPIR 2015: Research Potential IEEE Angers, France 2017 International Symposium on Electromagnetic Compatibility - EMC EUROPE 04-09-2017 to 07-09-2017 30 978-1-5386-0689-6 2325-0364 10.1109/EMCEurope.2017.8094786 NA M.Pous M.A.Azpurua F.Silva article NiederhauserLAGP2017 Measurement Science and Technology 2017 8 18 ENV56: KEY-VOCs: Metrology for VOC indicators in air pollution and climate change reference gas mixture, permeation, dynamic dilution, matrix gas, metrological traceability, uncertainty http://iopscience.iop.org/article/10.1088/1361-6501/aa870c EMRP A169: Call 2013 Environment II IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa870c NA B.C.Niederhauser D.Leuenberger A.Ackermann M.Guillevic C.Pascale article GrigoryevaGUTTKHAWKS2017 1175 International Journal of Thermophysics 2017 8 16 38 10 15SIB02: InK 2: Implementing the new kelvin 2 Absolute radiometry, Blackbody radiation, Cryogenic substitution radiometer, Filter radiometer, High-temperature fixed points, Irradiance mode, Primary radiation standards, Ratio radiometry, Synchrotron radiation, Thermodynamic temperature EMPIR 2015: SI Broader Scope Springer Nature 30 0195-928X, 1572-9567 10.1007/s10765-017-2273-z NA M.Wähmer K.Anhalt J.Hollandt R.Klein R. D.Taubert R.Thornagel G.Ulm V.Gavrilov I.Grigoryeva B.Khlevnoy V.Sapritsky article DegiovanniAPRLVTGBCVG2017 334 Nature Physics 2017 8 14 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 4 Protective Measurements, Weak Measurements https://arxiv.org/pdf/1706.08918.pdf; https://www.nature.com/nphys/journal/vaop/ncurrent/pdf/nphys4223.pdf; EMPIR 2014: Industry Springer Nature 30 1745-2473, 1745-2481 10.1038/nphys4223 NA F.Piacentini A.Avella E.Rebufello R.Lussana F.Villa A.Tosi M.Gramegna G.Brida E.Cohen L.Vaidman I.P.Degiovanni M.Genovese article SuterSSPOMKHGFBAKLWS2017 Metrologia 2017 8 10 54 5 ENV53: MetEOC2: Metrology for earth observation and climate 674-682 solar irradiance, satellite measurements, electrical substitution radiometer, cavity detector, sun EMRP A169: Call 2013 Environment II IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa7a63 NA M.Suter M.Spescha R.Soder D,Pfiffner A.R.Oliva N.Mingard S.Koller K.Heuerman M.Gyo W.Finsterle I.Beck B.Andersen G.Kopp P.L.Levesque B.Walter W.Schmutz article VandervorstMAFDKBV2017 565 Ultramicroscopy 2017 8 179 14IND01: 3DMetChemIT: Advanced 3D chemical metrology for innovative technologies 100-107 Atom probe tomography, Tip shape, FinFET, Local magnification, Trajectory overlaps https://lirias2repo.kuleuven.be/rest/bitstreams/515063/retrieve EMPIR 2014: Industry Elsevier BV 30 0304-3991 10.1016/j.ultramic.2017.04.006 NA D.Melkonyan C.Fleischmann L.Arnoldi J.Demeulemeester A.Kumar J.Bogdanowicz F.Vurpillot W.Vandervorst article BoudotdYTCBA2017 New Journal of Physics 2017 7 25 19 7 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 073028 Counterpropagating light waves, saturation spectroscopy, dark resonances, diode-lasers; d-1 line, d1 line, d2 line EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing 30 1367-2630 10.1088/1367-2630/aa7258 NA R.Boudot E.de Clercq V.Yudin A.Taichenachev G.Coget D.Brazhnikov M.Abdel Hafiz article AntonovSMKCK2017 583 Scientific Reports 2017 7 24 7 1 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 6295 domain wall, magnetoresistance, permalloy https://www.nature.com/articles/s41598-017-06292-y.pdf EMPIR 2015: SI Broader Scope Springer Nature 30 2045-2322 10.1038/s41598-017-06292-y NA H.Corte-León P.Krzysteczko A.Manzin H.W.Schumacher V.Antonov O.Kazakova article IkonenAPPK2017 416 Metrologia 2017 7 24 54 4 15SIB07: PhotoLED: Future photometry based on solid-state lighting products 577-583 fisheye camera, integrating sphere, luminous flux, spatial correction, angular intensity distribution, photometry, measurement uncertainty EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa7cb7 NA A.Kokka T.Pulli T.Poikonen J.Askola E.Ikonen proceedings AcakCS2017 201 2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC) 2017 7 13 2017 2017 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 124-126 CDN, Conducted Immunity, EMC, Loop Impedance, Support http://rfmw.cmi.cz/documents/papers/Sen_APEMC2017_OA.pdf EMPIR 2015: Research Potential IEEE Seoul 2017 Asia-Pacific International Symposium on Electromagnetic Compatibility (APEMC) 20-06-2017 to 23-06-2017 30 10.1109/APEMC.2017.7975442 NA O.Şen S.Çakır S.Acak proceedings CamisardPLACWQCS2017 445 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fiber, optical frequency transfer https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf https://www.eftf.org/previous-meetings/ EMPIR 2015: SI Broader Scope IEEE Besançon, France 2017 European Frequency and Time Forum & International Frequency Control Symposium 10-07-2017 to 13-07-2017 30 10.1109/FCS.2017.8088897 NA E.Cantin N.Quintin F.Wiotte C.Chardonnet A.Amy-Klein O.Lopez P.E.Pottie G.Santarelli E.Camisard article LopezLSPXA2017 440 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fiber, optical frequency transfer https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE 30 10.1109/FCS.2017.8088833 NA D.Xu W.K.Lee F.Stefani P.E.Pottie A.Amy-Klein O.Lopez proceedings LeCoqANDTAALTSLXLP2017 446 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFCS) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fiber, optical frequency transfer https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE Besançon, France 2017 European Frequency and Time Forum & International Frequency Control Symposium 10-07-2017 to 13-07-2017 30 10.1109/FCS.2017.8088928 NA R.Santagata D.B.A.Tran O.Lopez B.Argence S.K.Tokunaga B.Darquié A.Amy-Klein D.Nicolodi M.Abgrall Y.Le Coq R.Le Targat D.Xu W.K.Lee P.E.Pottie article SchnatzGTBBUNSSJTTPWKELDCLHRCLCCCVVSRDSKCQDGRGSYA2017 477 2017 Joint Conference of the European Frequency and Time Forum and IEEE International Frequency Control Symposium (EFTF/IFC) 2017 7 15SIB05: OFTEN: Optical frequency transfer - a European network optical fibre, network, clock, time, dissemination, service https://www.eftf.org/fileadmin/conferences/eftf/documents/Proceedings/proceedingsEFTF2017.pdf EMPIR 2015: SI Broader Scope IEEE 30 10.1109/FCS.2017.8089004 NA P.Krehlik L.Śliwczyński J.Dostal J.Radil V.Smotlacha R.Velc J.Vojtech M.Campanella D.Calonico C.Clivati F.Levi O.Číp S.Rerucha R.Holzwarth M.Lessing F.Camargo B.Desruelle J.Lautier-Gaud E.L.English J.Kronjäger P.Whibberley P.E.Pottie R.Tavares P.Tuckey F.John M.Snajder J.Stefl P.Nogaś R.Urbaniak A.Binczewski W.Bogacki K.Turza G.Grosche H.Schnatz E.Camisard N.Quintin J.Diaz T.Garcia E.Ros A.Galardini A.Seeds Z.Yang A.Amy-Klein article MasowskiLCCBAPMNNlLKBKMZCPBT2017 402 Astronomy & Astrophysics 2017 7 603 15SIB03: OC18: Optical clocks with 1E-18 uncertainty A48 high angular resolution instrumentation, interferometers EMPIR 2015: SI Broader Scope EDP Sciences 30 0004-6361, 1432-0746 10.1051/0004-6361/201730615 NA P.Krehlik L.Buczek J.Kołodziej M.Lipiński Ł.Śliwczyński J.Nawrocki P.Nogaś A.Marecki E.Pazderski P.Ablewski M.Bober R.Ciuryło A.Cygan D.Lisak P.Masłowski P.Morzyński M.Zawada R. M.Campbell J.Pieczerak A.Binczewski K.Turza proceedings PousOAS2017_2 599 2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 2017 7 15RPT01: RFMicrowave: Development of RF and microwave metrology capability 1-7 electromagnetic compatibility, electromagnetic interference, just-before-test, quality management, standards https://upcommons.upc.edu/handle/2117/116687 EMPIR 2015: Research Potential IEEE Turin, Italy 2017 IEEE International Instrumentation and Measurement Technology Conference (I2MTC) 22-05-2017 to 25-05-2017 30 978-1-5090-3596-0 10.1109/I2MTC.2017.7969789 NA M.A.Azpurua J.A.Oliva M.Pous F.Silva article MasowskiCZDBCAMWBL2017 387 Journal of Quantitative Spectroscopy and Radiative Transfer 2017 6 11 201 15SIB03: OC18: Optical clocks with 1E-18 uncertainty 156-160 Transition frequency, Absolute frequency measurement, Optical atomic clock, Oxygen B band, Cavity ring-down spectroscopy EMPIR 2015: SI Broader Scope Elsevier BV 30 0022-4073 10.1016/j.jqsrt.2017.07.010 NA https://arxiv.org/pdf/1705.06639.pdf K.Bielska S.Wójtewicz P.Morzyński P.Ablewski A.Cygan M.Bober J.Domysławska M.Zawada R.Ciuryło P.Masłowski D.Lisak article HillRSKGGDALLQALLMGPLVBBLDHBKMRBMG2017 141 Physical Review Letters 2017 6 118 22 15SIB05: OFTEN: Optical frequency transfer - a European network https://arxiv.org/abs/1703.04426 EMPIR 2015: SI Broader Scope American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.118.221102 NA P.Delva J.Lodewyck S.Bilicki E.Bookjans G.Vallet R.Le Targat P.-E.Pottie C.Guerlin F.Meynadier C.Le Poncin-Lafitte O.Lopez A.Amy-Klein W.-K.Lee N.Quintin C.Lisdat A.Al-Masoudi S.Dörscher C.Grebing G.Grosche A.Kuhl S.Raupach U.Sterr I. R.Hill R.Hobson W.Bowden J.Kronjäger G.Marra A.Rolland F. N.Baynes H. S.Margolis P.Gill article MonteALBGRRKMAG2017 Quantitative InfraRed Thermography Journal 2017 6 ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-20 Defect characterisation CFRP and GFRP laminates energy applications infrared thermography EMRP A169: Call 2013 Energy II Informa UK Limited 30 1768-6733, 2116-7176 10.1080/17686733.2017.1334312 NA C.Monte A.Aktas M.Lodeiro G.Baker M.Gower B.Rehmer M.Röllig R.Krankenhagen C.Maierhofer A.Adibekyan B.Gutschwager article MortaraA2017 IEEE Transactions on Instrumentation and Measurement 2017 6 66 6 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids 1124-1130 IEC 61850-9-2, IEEE 1588, merging unit, sample values, test set SEG EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9456, 1557-9662 10.1109/TIM.2017.2665938 NA A.Mortara M.Agustoni article HeinrichSPAPD2017 516 2017 89th ARFTG Microwave Measurement Conference (ARFTG) 2017 6 14IND02: PlanarCal: Microwave measurements for planar circuits and components Coupling, em simulation, measurements, parasitic modes, probes https://www.fbh-berlin.com/publications-patents/publications/title/mutual-interference-in-calibration-line-configurations EMPIR 2014: Industry IEEE 30 10.1109/ARFTG.2017.8000823 NA F.J.Schmuckle T.Probst U.Arz G.N.Phung R. Doerner W.Heinrich article LopezAPBSL2017 139 Applied Physics B 2017 5 123 5 15SIB05: OFTEN: Optical frequency transfer - a European network Hybrid fiber links, accurate optical frequency comparison, https://link.springer.com/article/10.1007/s00340-017-6736-5 EMPIR 2015: SI Broader Scope Springer Nature

New York

30 0946-2171, 1432-0649 10.1007/s00340-017-6736-5 NA W.K.Lee F.Stefani A.Bercy O.Lopez A.Amy-Klein P.E.Pottie article SantarelliLLCCMWKKCSNRQDLBRGGAWGALLPG2017 138 Metrologia 2017 5 54 3 15SIB05: OFTEN: Optical frequency transfer - a European network 348-354 optical fiber frequency transfer, atomic fountain clocks, international fountain, clock comparison http://iopscience.iop.org/article/10.1088/1681-7575/aa65fe EMPIR 2015: SI Broader Scope IOP Publishing

Bristol

30 0026-1394, 1681-7575 10.1088/1681-7575/aa65fe NA JGuena SWeyers MAbgrall CGrebing VGerginov PRosenbusch SBize BLipphardt HDenker NQuintin S M FRaupach DNicolodi FStefani NChiodo SKoke AKuhl FWiotte FMeynadier ECamisard CChardonnet YLe Coq MLours GSantarelli AAmy-Klein RLe Targat OLopez P EPottie GGrosche article CaldersBADNMOB2017 IEEE Transactions on Geoscience and Remote Sensing 2017 5 55 5 ENV53: MetEOC2: Metrology for earth observation and climate 2716-2724 Data interoperability, radiometric calibration, RIEGL VZ-400, terrestrial light detection and ranging (LiDAR). EMRP A169: Call 2013 Environment II Institute of Electrical and Electronics Engineers (IEEE)

New York, USA

30 0196-2892, 1558-0644 10.1109/TGRS.2017.2652721 NA KimCalders AndrewBurt JohnArmston Mathias I.Disney JoanneNightingale JasmineMuir NiallOrigo BenjaminBrede article KataokaAKBG2017 313 Metrologia 2017 4 54 3 15SIB08: e-SI-Amp: Quantum realisation of the SI ampere 299-306 single-electron pumps, primary electrical metrology, current standards http://iopscience.iop.org/article/10.1088/1681-7575/54/1/S1/meta;jsessionid=4918445C3978B8F392DE6A658FA21463.ip-10-40-1-105 http://www.e-si-amp.eu/outputs/ EMPIR 2015: SI Broader Scope IOP Publishing 30 0026-1394, 1681-7575 10.1088/1681-7575/aa634c NA S PGiblin M-HBae NKim Ye-HwanAhn MKataoka article deClercqGYCAB2017 Journal of Applied Physics 2017 3 14 121 10 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 104903 Frequency standard, laser, resonances, stability, shift EMRP A169: Call 2012 Metrology for Industry (II) AIP Publishing 30 0021-8979, 1089-7550 10.1063/1.4977955 NA E.de Clercq S.Guérandel P.Yun G.Coget M.Abdel Hafiz R.Boudot article SchumacherACMMCKMSCK2017 252 AIP Advances 2017 3 7 5 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 056808 AbstractDevices comprised of CoFeB nanostructures with perpendicular magnetic anisotropy and non-magnetic Ta channel were operated in thermal lateral spin valve (LSV) mode and studied by magnetotransport measurements and magnetic scanning gate microscopy (SGM). Due to the short spin diffusion length of Ta, the spin diffusion signal was suppressed, allowing the study of the contribution from the anomalous Nernst (ANE) and anomalous Hall effects (AHE). The magnetotransport measurements identified the switching fields of the CoFeB nanostructures and demonstrated a combination of AHE and ANE when the devices were operated in thermally-driven spin-injection mode. Modified scanning probe microscopy probes were fabricated by placing a NdFeB magnetic bead (MB) on the apex of a commercial Si probe. The dipole magnetic field distribution around the MB was characterized by using differential phase contrast technique and direct measurement of the switching field induced by the bead in the CoFeB nanodevices. Using SGM we demonstrate the influence of localized magnetic field on the CoFeB nanostructures near the non-magnetic channel. This approach provides a promising route towards the study of thermal and spin diffusion effects using local magnetic fields. EMPIR 2015: SI Broader Scope AIP Publishing 30 2158-3226 10.1063/1.4977891 NA H.Corte-León A.F.Scarioni R.Mansell P.Krzysteczko D.Cox D.McGrouther S.McVitie R.Cowburn H.W.Schumacher V.Antonov O.Kazakova article MartinezVerduLAKOGKJFSPSC2017 Applied Optics 2017 3 56 7 IND52: XD Reflect: Multidimensional reflectometry for industry 1996 BSDF, BRDF, BTDF, Densitometers, reflectometers, Reflection. EMRP A169: Call 2012 Metrology for Industry (II) The Optical Society

2010 Massachusetts Ave, NW NW Washington DC 20036-1023 United States

30 0003-6935, 1539-4522 10.1364/AO.56.001996 NA F. M.Martínez-Verdú F. B.Leloup J.Audenaert S.Källberg G.Obein G.Ged A.Koo P.Jaanson A.Ferrero C.Strothkämper E.Perales A.Schirmacher J.Campos article Measurement Science and Technology 2017 2 16 28 4 SIB58: Angles: Angle metrology 1-10 angle metrology, angle encoder, absolute encoder, nanoradians, autocollimators http://iopscience.iop.org/article/10.1088/1361-6501/aa5af6 EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing Ltd.

Bristol BS1 6HG, United Kingdom

30 Online ISSN: 1361-6501, Print ISSN: 0957-0233 10.1088/1361-6501/aa5af6 1 59,80 No, EURAMET is never allowed to make the publication publicly available. MPisani MAstrua article StagniRPNNMMLFBBAACZC2017 134 Scientific Reports 2017 2 7 15SIB05: OFTEN: Optical frequency transfer - a European network 40992 VLBI experiment, remote atomic clock https://www.nature.com/articles/srep40992 EMPIR 2015: SI Broader Scope Springer Nature

New York

30 2045-2322 10.1038/srep40992 NA C.Clivati R.Ambrosini T.Artz A.Bertarini C.Bortolotti M.Frittelli F.Levi A.Mura G.Maccaferri M.Nanni M.Negusini F.Perini M.Roma M.Stagni M.Zucco D.Calonico article PavsiDBFVJSeHRKMAAM2017 2144 Analytical and Bioanalytical Chemistry 2017 1 26 409 10 HLT08: INFECT-MET: Metrology for monitoring infectious diseases, antimicrobial resistance, and harmful micro-organisms 2601-2614 Digital PCR, DNAquantification, Inter-laboratory assessment, Human cytomegalovirus, Virus reference materials EMRP A169: Call 2011 Metrology for Health Springer Science and Business Media LLC 30 1618-2642, 1618-2650 10.1007/s00216-017-0206-0 NA J.Pavšič A.Devonshire A.Blejec C.A.Foy F.Van Heuverswyn G.M.Jones H.Schimmel J.Zel J.F.Huggett N.Redshaw M.Karczmarczyk E.Mozioglu S.Akyürek M.Akgöz M.Milavec article DucourtieuxCBAFF2017 Measurement Science and Technology 2017 1 23 28 3 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 034007 atomic force microscope, metrology, virtual instrument, measurement uncertainty, Monte Carlo method, Morris design, Sobol indices EMRP A169: Call 2012 Metrology for Industry (II) IOP Publishing

Temple Circus, Temple, Bristol, BS1 6BE, United Kingdom

30 0957-0233, 1361-6501 10.1088/1361-6501/28/3/034007 NA SebastienDucourtieux PaulCeria YounesBoukellal AlexandreAllard NicolasFischer NicolasFeltin article JennettAH2017 381 Measurement Science and Technology 2017 1 13 28 2 14IND03: Strength-ABLE: Metrology for length-scale engineering of materials 025016 nano-indentation, elevated temperature, thermal equilibrium, isothermal contact https://pure.coventry.ac.uk/ws/portalfiles/portal/8188288/Establishing_isothermal_contact_accepted_MST_104245_corrected_postprint.pdf EMPIR 2014: Industry IOP Publishing 30 0957-0233, 1361-6501 10.1088/1361-6501/aa533d NA X.D.Hou C.L.M.Alvarez N.M.Jennett article VavassoriAMCNCPK2017 255 IEEE Transactions on Magnetics 2017 15SIB06: NanoMag: Nano-scale traceable magnetic field measurements 1-1 Probes, Magnetic domains, Magnetic resonance imaging, Magnetic field measurement, Perpendicular magnetic anisotropy, Saturation magnetization https://pure.royalholloway.ac.uk/portal/en/publications/vshaped-domain-wall-probes-for-calibrated-magnetic-force-microscopy(9c2d50b1-9b1a-4aae-9b39-ca8c1864daf3).html EMPIR 2015: SI Broader Scope Institute of Electrical and Electronics Engineers (IEEE) 30 0018-9464, 1941-0069 10.1109/TMAG.2017.2694324 NA R.Puttock H.Corte-León V.Neu D.Cox A.Manzin V.Antonov P.Vavassori O.Kazakova article IEEE Electromagnetic Compatibility Magazine 2016 12 15 5 3 IND60: EMC: Improved EMC test methods in industrial environments 45-51 Alternative, Current Probe, CDN, Conducted Immunity, EMC, High Current, Industry, Mains Impedance http://ieeexplore.ieee.org/document/7764249/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

30 2162-2272 10.1109/MEMC.0.7764249 1 59 No, EURAMET is never allowed to make the publication publicly available. SoydanÇakır OsmanŞen SavaşACAK MarcoAZPURUA FerranSILVA MustafaÇetintaş techreport HultMSMLAVP2016 JRC Technical report 2016 12 ENV54: MetroDecom: Metrology for decommissioning nuclear facilities Reference materials, Radiochemical analysis, standard sources http://publications.jrc.ec.europa.eu/repository/handle/JRC103355 EMRP A169: Call 2013 Environment II European commission Publication office

Luxemburg

30 978-92-79-63506-9 1831-9424 10.2789/949534 NA M.Hult G.Marissens H.Stroh M.Marouli G.Lutter T.Altzitzoglou R.Van Ammel S.Pommé article Journal of Luminescence 2016 11 1 179 November 2016 EXL02: SIQUTE: Single-photon sources for quantum technologies 59-63 Diamond; Color center; Defect; Ion implantation; Photoluminescence http://www.journals.elsevier.com/journal-of-luminescence EMRP A169: Call 2012 Open excellence call Elsevier

Amsterdam

30 0022-2313 10.1016/j.jlumin.2016.06.039 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-1 J.J. Forneris A.A. Tengattini S.S. Ditalia Tchernij F.F. Picollo A.A. Battiato P.P. Traina I.P.I.P. Degiovanni E.E. Moreva G.G. Brida V.V. Grilj N.N. Skukan M.M. Jakšić M.M. Genovese P.P. Olivero article PlagFHPFFMAEAFH2016 IEEE Journal of Photovoltaics 2016 11 6 4 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 1004-1011 Intercomparison, irradiance, calibration, solar simulator http://ieeexplore.ieee.org/document/7576644/ EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 2156-3381, 2156-3403 10.1109/JPHOTOV.2016.2606698 NA F.Plag M.Friederichs M.Halwachs M.Pravettoni R.Fucci N.Ferretti A.Minuto D.Alonso-Alvarez N.Ekins-Daukes D.Alonso-Alvarez D.Friedrich E.Haverkamp article GorenBTZSMPRFAF2016 Talanta 2016 11 160 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 499-511 ICP-MS, Isotope Dilution, Limit of quantification, Metrological traceability, Tributyltin, Water Framework Directive EMRP A169: Call 2010 Environment Elsevier BV 30 0039-9140 10.1016/j.talanta.2016.07.056 NA A.C.Goren M.Bílsel M.Tunç T.Zuliani J.Sčančar R.Milačič R.Philipp J.Richter I.Fettig E.Alasonati P.Fisicaro article YangWWWWWVTTSSSPNLLKKGFEDCCCBBAMCBC2016 321 The Journal of Physical Chemistry C 2016 10 27 120 42 14IND12: Innanopart: Metrology for innovative nanoparticles 24070-24079 VAMAS, XPS, LEIS, nanoparticle, core-shell, thickness, interlaboratory https://spiral.imperial.ac.uk/handle/10044/1/40824 EMPIR 2014: Industry American Chemical Society (ACS)

CAS, a division of the American Chemical Society2540 Olentangy River Road Columbus Ohio 43210 United States

30 1932-7447, 1932-7455 10.1021/acs.jpcc.6b06713 NA N.A.Belsey D.Cant D.J.H.Cant C.Minelli J.R.Araujo B.Bock P.Brüner D.G.Castner G.Ceccone J.D.P.Counsell P.M.Dietrich M.H.Engelhard S.Fearn C.E.Galhardo H.Kalbe J.W.Kim L.Lartundo-Rojas H.S.Luftman T.S.Nunney J.Pseiner E.F.Smith V.Spampinato J.M.Sturm A.G.Thomas J.P.W.Treacy L.Veith M.Wagstaffe H.Wang M.Wang Y.C.Wang W.Werner L.Yang article VilllaLCDBGLAPTZG2016 231 Physical Review Letters 2016 10 20 117 17 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 170402 Weak Measurements, Optical tests of quantum theory, Weak Values https://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.170402 EMPIR 2014: Industry American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.117.170402 NA F.Piacentini A.Avella M. P.Levi M.Gramegna G.Brida I. P.Degiovanni E.Cohen R.Lussana F.Villa A.Tosi F.Zappa M.Genovese article RantosonNAM2016 1551 Precision Engineering 2016 10 46 15SIB01: FreeFORM: Reference algorithms and metrology on aspherical and freeform lenses 232-242 Improved curvature-based registration methods for high-precision dimensional metrology https://hal.archives-ouvertes.fr/hal-01363750/document EMPIR 2015: SI Broader Scope Elsevier BV 30 0141-6359 10.1016/j.precisioneng.2016.05.002 NA R.Rantoson H.Nouira N.Anwer C.Mehdi-Souzani article RietveldvJJNCAC2016 2016 17th International Conference on Harmonics and Quality of Power (ICHQP) 2016 10 ENG63: GridSens: Sensor network metrology for the determination of electrical grid characteristics Phasor measurement units, Power Quality, Power system harmonics, Impedance measurement, Harmonic impedance, Load modeling SEG EMRP A169: Call 2013 Energy II IEEE 30 10.1109/ICHQP.2016.7783374 NA G.Rietveld H.E.van den Brom A.Jongepier W.Jin F.Ni V.Cuk M.Acanski J.F.G.Cobben article ReganCBABS2016 Journal of Physics: Conference Series 2016 10 763 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 012010 gamma detector, airborne radiation monitoring, radiation monitoring EMRP A169: Call 2013 Environment II IOP Publishing 30 1742-6588, 1742-6596 10.1088/1742-6596/763/1/012010 NA P HRegan S MCollins SBeeke PAitken-Smith S JBell RShearman thesis AlMasoudi2016 2016 9 30 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors optical lattice clock, black body radiation shift, frequency accuracy EMRP A169: Call 2012 Open excellence call Leibnitz university Leibnitz university 30 NA https://www.tib.eu/en/search/id/TIBKAT%3A870652028/A-strontium-lattice-clock-with-reduced-blackbody/?tx_tibsearch_search%5Bsearchspace%5D=tn A.Al-Masoudi article Physical Review Letters 2016 9 28 117 14 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 143004 clock, spin squeezing, squeezed vacuum http://journals.aps.org/prl/abstract/10.1103/PhysRevLett.117.143004 EMRP A169: Call 2012 Open excellence call American Physical Society

Washington, DC, USA

30 0031-9007 10.1103/PhysRevLett.117.143004 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. IKruse KLange JPeise BLücke LPezzè JArlt WErtmer CLisdat LSantos ASmerzi CKlempt article XanthosLCA2016 Radiation Protection Dosimetry 2016 9 24 175 1 ENV57: MetroERM: Metrology for radiological early warning networks in Europe radon in soil, radon migration in soil, long term measurements EMRP A169: Call 2013 Environment II Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncw277 NA S.Xanthos F.Leontaris A.Clouvas D.Alifragis article RamachandranFZFWOMSGNRKHSMADGDBCBBMAWMMLBWELMCCDBPSCKMNF2016 Atmospheric Chemistry and Physics 2016 9 23 16 18 ENV51: MeTra: Traceability for mercury measurements 11915-11935 Atmospheric mercury concentrations observed at ground-based monitoring sites globally distributed in the framework of the GMOS network EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1680-7324 10.5194/acp-16-11915-2016 NA R.Ramachandran X.Fu H.Zhang X.B.Feng D.Wip V.Obolkin N.Mashyanov F.Sena B.M.Gawlik L.M.Neves K.A.Read J.Kotnik M.Horvat H.Skov O.Magand H.Angot A.Dommergue P.E.Garcia M.D.CDiéguez C.Barbante W.Cairns J.Brito H.D.M.JBarbosa F.Morais P.Artaxo I.Wängberg J.Munthe L.Martin C.Labuschagne E.G.Brunke A.Weigelt R.Ebinghaus M.Landis V.Mannarino S.Cinnirella F.Carbone F.D'Amore M.Bencardino N.Pirrone F.Sprovieri D.Cossa J.Knoery NicolasMarusczak M.Nerentorp P.Fisicaro proceedings Proceedings of the 4th CIE Expert Symposium on Colour and Visual Appearance 2016 9 CIE x043:2016 - IND52: XD Reflect: Multidimensional reflectometry for industry 427-431 Bidirectional Scatter Distribution Function, Convolution, Deconvolution http://div2.cie.co.at/?i_ca_id=985 EMRP A169: Call 2012 Metrology for Industry (II) CIE

Vienna

Prague 4th CIE Expert Symposium on Colour and Visual Appearance 06-09-2016 to 07-11-2016 30 978-3-902842-59-6 1 59 No, EURAMET is never allowed to make the publication publicly available. J.Audenaert P.Hanselaer F. B.Leloup article International Journal of Simulation Modelling 2016 9 15 3 IND62: TIM: Traceable in-process dimensional measurement 511-521 Traceability, Co-Ordinate Measurement, Measurement Standard, Thermal Expansion http://www.ijsimm.com/Full_Papers/Fulltext2016/text15-3_511-521.pdf EMRP A169: Call 2012 Metrology for Industry (II) DAAAM Internbational

Vienna

30 1726-4529 10.2507/IJSIMM15(3)10.356 1 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.ijsimm.com/ R.Klobucar B.Acko article Measurement 2016 8 31 94 December 2016 14IND10: MET5G: Metrology for 5G communications 847–851 measurement uncertainty, GUM, GUM supplements, microwave scattering parameters, standard uncertainty http://www.sciencedirect.com/science/article/pii/S0263224116304766 EMPIR 2014: Industry Elsevier

Amsterdam, Netherlands

30 10.1016/j.measurement.2016.08.015 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-8-31 L.T.Stant P.H.Aaen N. M.Ridler article InterNoise 2016 2016 8 29 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound sound power level, transfer standard source, sound power measurement standards , Traceability I-INCE Classifacation of Subjects Number(s): 72.4 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. I.Arendt P.Kurtz article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, Free Field, Directivity http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) German Acoustical Society (Deutsche Gesellschaft für Akustik, DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. R.Arina K.Völkel article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound Power, Primary Standard I-INCE Classification of Subjects Number(s): 72.4 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. C.Guglielmone V.Wittstock C.Kirbas H.Andersson article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, traceability; Calibration; Free-field over a reflecting plane (hemi-anechoic rooms)I-INCE Classification of Subjects Number(s): 72.4, 71.9 and 73.2 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. P.Cellard H.Andersson S.Brezas V.Wittstock article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound Power, Primary Sound Power Source, Rayleigh’s Integral http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. C.Kirbas H.Andersson C.Guglielmone E.Bilgiç article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, traceability I-INCE Classification of Subjects Number(s): 72.4 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. H.Andersson V.Wittstock article InterNoise 2016 2016 8 26 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound Sound power, dissemination, directivity, correction, substitution I-INCE Classification of Subjects Number(s): 72.4 http://www.internoise2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S.Brezas P.Cellard H.Andersson C.Guglielmone C.Kirbas article TsaidPA2016 Nature Communications 2016 8 22 7 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 12588 Microwave photonics, Quantum information, Single photons and quantum effects http://www.nature.com/articles/ncomms12588 EMRP A169: Call 2012 Open excellence call Springer Nature 30 2041-1723 10.1038/ncomms12588 NA J. S.Tsai S. E.de Graaf Z. H.Peng O. V.Astafiev article QuinonesANSBM2016 Radiation Protection Dosimetry 2016 8 13 174 3 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 1-8 radon, radon progeny, ambient dose equivalent rate, dosimetry EMRP A169: Call 2013 Environment II Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncw219 NA J.Quiñones A.Alvarez N.Navarro J. C.Saez G.Benito J. L.Márquez proceedings Proceedings of the Conference on Precision Electromagnetic Measurements 2016 2016 8 11 2016 1 ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1-2 aperture delay, calibration, phasor measurement unit, phase measurement, PMU, synchrophasor. http://ieeexplore.ieee.org/document/7540461/ EMRP A169: Call 2013 Energy II IEEE

Piscataway

Ottawa, Canada Conference on Precision Electromagnetic Measurements (CPEM) 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540461 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MAcanski GRietveld DHoogenboom proceedings Digest on Conference on Precision Electromagnetic Measurements (CPEM2016) 2016 8 11 SIB51: GraphOhm: Quantum resistance metrology based on graphene graphene, quantum Hall effect, coaxial bridge circuit, magnetocapacitance, dissipation factor http://ieeexplore.ieee.org/document/7540651/?denied EMRP A169: Call 2012 SI Broader scope (II) IEEE Ottawa, Canada CPEM 2016 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540651 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Schurr C.C.Kalmbach M.Kruskopf A.Müller K.Pierz F.Ahlers proceedings Proceedings of the Conference on Precision Electromagnetic Measurements 2016 8 11 n/a n/a SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1-2 high frequency circuits, metrology, http://ieeexplore.ieee.org/document/7540504/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

Melville

Ottawa, Canada Conference on Precision Electromagnetic Measurements 10-07-2016 to 15-07-2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540504 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CEi⊘ DAllal PHuerlimann JRuefenacht SZinal proceedings CPEM 2016, Conference on Precision Electromagnetic Measurements: conference digest: (2016) 2016 8 11 14IND02: PlanarCal: Microwave measurements for planar circuits and components high-frequency devices, vector network analyzer, electro-optic sampling http://dx.doi.org/10.1109/CPEM.2016.7540727 https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E EMPIR 2014: Industry IEEE Ottawa, Canada CPEM 2016, Conference on Precision Electromagnetic Measurements 10-15 July 2016 30 2160-0171 10.1109/CPEM.2016.7540727 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 https://oar.ptb.de/resources/show/10.7795/EMPIR.14IND02.CA.20190403E M.Bieler U.Arz proceedings 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016), Conference Digest 2016 8 11 CPEM 2016 Conference Digest 1 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 1-2 ac voltage measurement, signal synthesis, digital-to-analog converter, analog-to-digital converter, comparison, sampling, ac-dc transfer. http://ieeexplore.ieee.org/document/7540454/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

New York, USA

Ottawa, Canada 2016 Conference on Precision Electromagnetic Measurements (CPEM 2016) July 10-15, 2016 30 978-1-4673-9134-4 2160-0171 10.1109/CPEM.2016.7540454 1 No, EURAMET is never allowed to make the publication publicly available. J.Nissila J.Lee M.Sira T.Öztürk M.Arifovic J.Diaz de Aguilar R.Lapuh R.Behr article Precision Electromagnetic Measurements (CPEM 2016), 2016 Conference on 2016 8 11 ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids Instrument transformers, Non-conventional instrument transformers, Calibration, Measurement, Measure-ment standards, High-Voltage techniques SEG http://ieeexplore.ieee.org/document/7540488/ EMRP A169: Call 2013 Energy II IEEE 30 978-1-4673-9134-4 10.1109/CPEM.2016.7540488 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. EHoutzager EMohns SFricke BAyhan HCayci article Metrologia 2016 8 1 53 (2016) 4 NEW05: MechProNO: Traceable measurement of mechanical properties of nano-objects 1031-1044 Nanonewton force facility Spring constant Soft cantilever Contact potential SI-traceable determination http://www.ingentaconnect.com/content/iop/met/2016/00000053/00000004/art01031 EMRP A169: Call 2011 Metrology for New Technologies IOP Publishing Ltd.

Bristol

30 0026-1394 (print) ; 1681-7575 (online) 10.1088/0026-1394/53/4/1031 1 59 No, EURAMET is never allowed to make the publication publicly available. V.Nesterov O.Belai D.Nies S.Buetefisch M.Muelelr T.Ahbe D.Neparty R.Popadic H.Wolff article SantarelliLCDSLSLACMWKKKBBCRHDASGNRSQGLALLLP2016 135 Nature Communications 2016 8 7 15SIB05: OFTEN: Optical frequency transfer - a European network 12443 Clock network; geodesy; https://www.nature.com/articles/ncomms12443 EMPIR 2015: SI Broader Scope Springer Nature

New York

30 2041-1723 10.1038/ncomms12443 NA C.Lisdat G.Grosche N.Quintin C.Shi S.M.F.Raupach C.Grebing D.Nicolodi F.Stefani A.Al-Masoudi S.Doerscher S.Haefner J.-L.Robyr N.Chiodo S.Bilicki E.Bookjans A.Koczwara S.Koke A.Kuhl F.Wiotte F.Meynadier E.Camisard M.Abgrall M.Lours T.Legero H.Schnatz U.Sterr H.Denker C.Chardonnet Y.Le Coq G.Santarelli A.Amy-Klein R.Le Targat J.Lodewyck OLopez P.-E.Pottie article SvecSSRPNMLKJGFFDMAHBTTVW2016_2 Applied Radiation and Isotopes 2016 8 114 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry 167-172 Metrology; Ionising radiation; Intercomparison exercise; Gamma-ray spectrometry; Cast steel, metallurgy; EURAMET EMRP A169: Call 2010 Industry Elsevier BV 30 0969-8043 10.1016/j.apradiso.2016.05.014 NA A.Svec J.Solc L.Silva M.Reis V.Peyres M.Nečemer H.Moser A.Luca S.Klemola A.Javornik E.García-Toraño L..Ferreux A.Fazio P.Dryák B.C.Marroyo D.Arnold M.Hult O.Burda F.Tzika Z.Tyminski B.Vodenik U.Wätjen proceedings 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 2016 8 SIB51: GraphOhm: Quantum resistance metrology based on graphene 38--39 AC analysis technique,AC loss elimination,AC measurement,C,Electrical resistance measurement,Gallium arsenide,Graphene,Hall effect,Impedance,Noise,Resistance,electric current measurement,epitaxial graphene-based impedance standard,graphene,impedance,quantized Hall resistance,quantum Hall effect,spectral noise density http://ieeexplore.ieee.org/articleDetails.jsp?arnumber=6898247 EMRP A169: Call 2012 SI Broader scope (II) IEEE 30 978-1-4799-2479-0 0589-1485 10.1109/CPEM.2014.6898247 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. C.Kalmbach J.Schurr F.J.Ahlers A.Müller S.Novikov N.Lebedeva A.Satrapinsky article Energy Procedia 2016 8 92 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 341-346 Black silicon, Nano-texturing, Surface passivation, Lifetime, Atomic layer deposition, Al2O3, Solar cells http://www.sciencedirect.com/science/article/pii/S1876610216305203 EMRP A169: Call 2013 Energy II Elsevier 30 10.1016/j.egypro.2016.07.093 1 No, EURAMET is never allowed to make the publication publicly available. E.Calle P.Ortega G. .von Gastrow IMartin H.Savin R.Alcubilla article FisicaroPJPFRA2016 Journal of Chromatography A 2016 8 1459 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 112-119 Environmental quality standard (EQS), Humic acid, Isotope dilution, Surface water, Suspended particulate matter, Tributyltin (TBT) EMRP A169: Call 2010 Environment Elsevier BV 30 0021-9673 10.1016/j.chroma.2016.06.068 NA P.Fisicaro U.Panne N.Jakubowski R.Philipp I.Fettig J.Richter E.Alasonati article Nature: Scientific Reports 2016 7 26 6 SIB51: GraphOhm: Quantum resistance metrology based on graphene 30296 graphene, measurement, QHE, http://www.nature.com/articles/srep30296?WT.feed_name=subjects_physical-sciences EMRP A169: Call 2012 SI Broader scope (II) Scientific reports 30 10.1038/srep30296 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.A.Alexander-Webber J.Huang D.K.Maude T.J.B.M.Janssen A.Tzalenchuk V.Antonov T.Yager S.Lara-Avila S.Kubatkin R.Yakimova R.J.Nicholas article WangbergWVSSSIOMMMMMLKHHHGGFFEDDCCABBADBPSWYF2016 Atmospheric Chemistry and Physics Discussions 2016 7 20 ENV51: MeTra: Traceability for mercury measurements 1-33 mercury, wet deposition flux, EMRP A169: Call 2013 Environment II Copernicus GmbH 30 1680-7375 10.5194/acp-2016-517 NA I.Wängberg C.Walters M.Vardè P.Spandow V.Somerset F.Sena M.R.Islas V.Obolkin J.Munthe T.Mkololo N.Mashyanov L.Martin O.Magand C.Labuschagne J.Kotnik M.Horvat K.Hansson U.Hageström B.Gawlik P.E.Garcia X.Fu X.B.Feng R.Ebinghaus A.Dommergue M.D.C.Diéguez S.Comero W.Cairns F.Arcega-Cabrera E.G.Brunke C.Barbante H.Angot F.D'Amore M.Bencardino N.Pirrone F.Sprovieri A.Weigelt X.Yang P.Fisicaro article Review of Scientific Instruments 2016 7 12 87 2016 SIB60: Surveying: Metrology for long distance surveying 075101 telemeter, ADM, laser tracker http://scitation.aip.org/content/aip/journal/rsi/87/7/10.1063/1.4954180 EMRP A169: Call 2012 SI Broader scope (II) AIP Publishing 30 10.1063/1.4954180 1 59 No option selected J.Guillory R.Šmíd J.Garcia-Márquez D.Truong C.Alexandre J.-P.Wallerand proceedings Conference on Precision Electromagnetic Measurements, Ottawa, Canada, 10 – 15 July 2016 (CPEM 2016) 2016 7 10 N/A N/A SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits N/A VNA characterization, multiport measurements, calibration methods, error correction models http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=7540728 EMRP A169: Call 2012 SI Broader scope (II) Institute of Electrical and Electronics Engineers (IEEE)

New York, USA

Ottawa, Canada Conference on Precision Electromagnetic Measurements 2016 (CPEM 2016) 10-07-2016 to 15-07-2016 30 N/A N/A 10.1109/CPEM.2016.7540728 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. S.Zinal D.Allal M.Salter proceedings Conference on Precision Electromagnetic Measurements, Ottawa, Canada, 10 – 15 July 2016 2016 7 10 N/A N/A SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits N/A Balanced devices, electromagnetic simulation, Monte Carlo method, scattering parameters, uncertainty analysis, signal integrity, vector network analyzer. http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7540616 EMRP A169: Call 2012 SI Broader scope (II) Institute of Electrical and Electronics Engineers (IEEE)

New York, USA

Ottawa, Canada Conference on Precision Electromagnetic Measurements 2016 (CPEM 2016) 10-07-2016 to 15-07-2016 30 N/A N/A 10.1109/CPEM.2016.7540616 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Ziade M.Hudlicka M.Salter T.Pavlicek D.Allal article Metrologia 2016 7 8 53 4 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 1123 atomic clocks, high precision spectrocopy, frequency ratios, optical lattice clocks http://iopscience.iop.org/article/10.1088/0026-1394/53/4/1123/meta EMRP A169: Call 2012 Open excellence call IOP Publishing

Bristol, UK

30 0026-1394 10.1088/0026-1394/53/4/1123 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. JLodewyck SBilicki EBookjans J-LRobyr CShi GVallet RLe Targat DNicolodi YLe Coq JGuéna MAbgrall PRosenbusch SBize proceedings Aerospace EMC (Aerospace EMC), 2016 ESA Workshop on 2016 7 7 1 1 IND60: EMC: Improved EMC test methods in industrial environments - Electromagnetic interference, Antenna measurements, Voltage measurement, Current measurement, Frequency measurement, Time-domain analysis, Lightning http://ieeexplore.ieee.org/document/7504579/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

-

Valencia (Spain) Aerospace EMC (Aerospace EMC), 2016 ESA Workshop on 23-05-2016 to 25-05-2016 30 978-9-2922-1303-9 10.1109/AeroEMC.2016.7504579 1 No, EURAMET is never allowed to make the publication publicly available. 16138551 MarcoAzpúrua MarcPous FerranSilva proceedings Not applicable 2016 7 1 Not applicable Not applicable ENG61: FutureGrid: Non-conventional voltage and current sensors for future power grids Not applicable IEC 61850-9-2, IEEE 1588, Sample Values, Test, Set, Merging Unit SEG http://cpem2016.com EMRP A169: Call 2013 Energy II IEEE

Piscataway

Ottawa 2016 Conference on Precision Electromagnetic Measurements 10-07-2016 to 15-07-2016 30 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-7-30 M.Agustoni A.Mortara proceedings 19th World Conference on Non-Destructive Testing 2016 2016 7 2016 Composite Materials ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-9 http://www.ndt.net/article/wcndt2016/papers/we2i4.pdf EMRP A169: Call 2010 Industry NDT.net

Bad Breisig, Germany

Internationales Congress Center München Messegelände, Munich, Germany 19th World Conference on Non-Destructive Testing 2016 13-06-2016 to 17-06-2016 30 978-3-940283-78-8 1435-4934 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CMMaierhofer RKKrankenhagen MRRöllig SRRiemer MGGower GBBaker MLLodeiro LKKnazovická ABBlahut CMMonte AAAdibekyan BGGutschwager proceedings 19th World Conference on Non-Destructive Testing 2016 2016 7 2016 Composite Materials ENG57: VITCEA: Validated inspection techniques for composites in energy applications 1-10 Infrared Testing (IRT), Ultrasonic Testing (UT), Visual and Optical Testing (VT/OT), Other Methods, delamination, validation, carbon fiber reinforced plastic (CFRP), Glass Fiber Reinforced Plastic (GFRP), tensile load, flat bottom hole http://www.ndt.net/article/wcndt2016/papers/we1e4.pdf EMRP A169: Call 2013 Energy II NDT.net

Bad Breisig, Germany

Internationales Congress Center München Messegelände, Munich, Germany 19th World Conference on Non-Destructive Testing 2016 13-06-2016 to 17-06-2016 30 978-3-940283-78-8 1435-4934 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MGGower MLLodeiro AAAktas RSShaw CMMaierhofer RKKrankenhagen SAAugustin MRRöllig LKKnazovická ABBlahut CMMonte RJJudaschke DSSegur article EkinsDaukesA2016 IEEE Journal of Photovoltaics 2016 7 6 4 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 1004-1011 III-V multijunction solar cell measurement, Photoluminescence, Characterization of PV http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=7452344 EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 2156-3381, 2156-3403 10.1109/JPHOTOV.2016.2547583 NA N.Ekins-Daukes D.Alonso-Alvarez article PottieALB2016 133 Applied Physics B 2016 6 25 122 7 15SIB05: OFTEN: Optical frequency transfer - a European network https://link.springer.com/article/10.1007/s00340-016-6463-3 EMPIR 2015: SI Broader Scope Springer Nature

New York

30 0946-2171, 1432-0649 10.1007/s00340-016-6463-3 NA A.Bercy O.Lopez P.E.Pottie A.Amy-Klein article Optica 2016 6 13 3 6 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 647 (300.1030) Absorption; (160.6000) Semiconductor materials; (230.1480) Bragg reflectors; (310.1620) Interference coatings; (310.1860) Deposition and fabrication; (140.4780) Optical resonators. EMRP A169: Call 2012 Open excellence call Optical Society of America

Washington, D.C. 20036-1012 USA

30 2334-2536 10.1364/OPTICA.3.000647 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. G DCOLE WZHANG B JBJORK DFOLLMAN PHEU CDEUTSCH LSONDERHOUSE JROBINSON CFRANZ AALEXANDROVSKI MNOTCUTT O HHECKL JYE MASPELMEYER proceedings Proceedings of the 16th International Conference of the European Society for Precision Engineering and Nanotechnology 2016 6 3 1 1 SIB58: Angles: Angle metrology 1-2 Angle metrology, angle encoder, nanoradians http://www.euspen.eu/events/16th-international-conference-exhibition/ EMRP A169: Call 2012 SI Broader scope (II) euspen

Cranfield, Bedfordshire, MK43 0AL, United Kingdom

Nottingham, UK Cranfield, Bedfordshire, MK43 0AL, United Kingdom 30 May – 3 June 2016 30 9780956679086 1 No, EURAMET is never allowed to make the publication publicly available. http://www.euspen.eu/events/16th-international-conference-exhibition/ MPisani MAstrua article Comptes Rendus Physique 2016 6 1 16 5 SIB55: ITOC: International timescales with optical clocks 461 - 470 Atomic fountain clocks, Optical lattice clocks, Optical frequency combs, Stability of natural constants, Timekeeping http://www.sciencedirect.com/science/article/pii/S1631070515000614 EMRP A169: Call 2012 SI Broader scope (II) Elsevier

Amsterdam

30 n/a 10.1016/j.crhy.2015.03.010 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-6-1 MAbgrall BChupin LDe Sarlo JGuena PLaurent YLe Coq RLe Targat JLodewyck MLours PRosenbuch G. D.Rovera SBize article Biointerphases 2016 6 1 11 2 HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices 029603 EMRP A169: Call 2011 Metrology for Health American Vacuum Society

New Yokk

30 1934-8630 10.1116/1.4948341 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-6-1 P.MDietrich CNietzold MWeise, W.E.SUnger, SAlnabulsi, JMoulder article SterrAKGHVL2016 Journal of Physics: Conference Series 2016 6 723 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 012020 time and frequency metrology, transportable optical lattice clock, chronometric geodesy http://iopscience.iop.org/article/10.1088/1742-6596/723/1/012020/meta EMRP A169: Call 2012 Open excellence call IOP Publishing

Bristol

30 1742-6588, 1742-6596 10.1088/1742-6596/723/1/012020 NA U.Sterr A.Al-Masoudi S.Koller J.Grotti S.Häfner S.Vogt C.Lisdat proceedings N/A 2016 5 27 N/A N/A SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1-4 Microwave measurements uncertainty, microwave transistors, nonlinear embedding, power amplifiers, vector-calibrated nonlinear measurements. http://www.arftg.org/ EMRP A169: Call 2012 SI Broader scope (II) IEEE

Piscataway

San Francisco, CA, USA 87th ARFTG Microwave Measurement Conference 27-05-2016 30 978-1-5090-1308-1 N/A 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-9-30 IEEE Catalog Number: CFP16ARF-ART G.Bosi A.Raffo G.Avolio D.Schreurs D. A.Humphreys proceedings Proceedings 87th ARFTG Microwave Measurement Conference 2016 5 27 n.a. n.a. SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1-4 S-parameters, uncertainty of measurement, uncertainty matrices, measurement covariance matrix, correlation EMRP A169: Call 2012 SI Broader scope (II) IEEE

Danvers

San Francisco 87th ARFTG Microwave Measurement Conference 27-05-2016 30 978-1-5090-1308-1 n.a. 10.1109/ARFTG.2016.7501951 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-1-1 U.Arz article Optica 2016 5 25 3 6 SIB55: ITOC: International timescales with optical clocks 563-569 optical clocks, SI units, caesium fountain clocks, metrology, atom optics, spectroscopy, high resolution http://arxiv.org/abs/1511.03888 EMRP A169: Call 2012 SI Broader scope (II) Optical Society of America

Washington DC

30 n/a 10.1364/OPTICA.3.000563 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-5-25 CGrebing AAl-Masoudi SDörscher SHäfner VGerginov SWeyers BLipphardt USterr CLisdat article REVIEW OF SCIENTIFIC INSTRUMENTS 2016 5 24 87 051906 (2016) SIB58: Angles: Angle metrology 1-9 Apertures, Calibration Charge coupled devices, Ray tracing, Optical aberrations http://aip.scitation.org/doi/10.1063/1.4950734 EMRP A169: Call 2012 SI Broader scope (II) American Institute of Physics

Melville, NY 11747-4300 USA

30 Print: 0034-6748, Online: 1089-7623 10.1063/1.4950734 1 55,59 No, EURAMET is never allowed to make the publication publicly available. R. D.Geckeler N. A.Artemiev S. K.Barber AJust I.Lacey OKranz B. V.Smith V. V.Yaschckuk article REVIEW OF SCIENTIFIC INSTRUMENTS 2016 5 24 87 051907 (2016) SIB58: Angles: Angle metrology 1-9 Spatial resolution, Modulation transfer functions, Topography, Calibration, Spatial dimensions http://aip.scitation.org/doi/10.1063/1.4950737 EMRP A169: Call 2012 SI Broader scope (II) American Institute of Physics

Melville, NY 11747-4300 USA

30 ISSN: Print: 0034-6748, Online: 1089-7623 10.1063/1.4950737 1 59,80 No, EURAMET is never allowed to make the publication publicly available. FSiewert TZeschke TArnold HPaetzelt VVYashchuk article REVIEW OF SCIENTIFIC INSTRUMENTS 2016 5 20 87 051904 (2016) SIB58: Angles: Angle metrology 1-12 Calibration, Mirrors, X-ray optics, Apertures, Comparators http://aip.scitation.org/doi/10.1063/1.4950729 EMRP A169: Call 2012 SI Broader scope (II) American Institute of Physics

Melville, NY 11747-4300 USA

30 Print: 0034-6748, Online: 1089-7623 10.1063/1.4950729 1 59 No, EURAMET is never allowed to make the publication publicly available. VVYashchuk NAArtemiev GCenters AChaubard RDGeckeler ILacey HMarth WRMcKinney TNoll FSiewert MWinter TZeschke article REVIEW OF SCIENTIFIC INSTRUMENTS 2016 5 20 87 051903 (2016) SIB58: Angles: Angle metrology 1-14 Calibration, Error analysis, Data sets, Data analysis, Time measurement http://aip.scitation.org/doi/10.1063/1.4950720 EMRP A169: Call 2012 SI Broader scope (II) American Institute of Physics

Melville, NY 11747-4300 USA

30 Print: 0034-6748, Online: 1089-7623 10.1063/1.4950720 1 59,80 No, EURAMET is never allowed to make the publication publicly available. TYandayan RDGeckeler MAksulu SAAkgoz BOzgur proceedings 2016 IEEE 20th Workshop on Signal and Power Integrity (SPI) Conference Proceedings 2016 5 12 N/A N/A 14IND02: PlanarCal: Microwave measurements for planar circuits and components 1-4 coplanar waveguides, frequency-domain analysis, microwave measurement, time-domain analysis http://dx.doi.org/10.1109/SaPIW.2016.7496271 EMPIR 2014: Industry IEEE Torino, Italy 2016 IEEE 20th Workshop on Signal and Power Integrity 08-05-2016 to 11-05-2016 30 978-1-5090-0349-5 10.7795/EMPIR.14IND02.CA.20190403D 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M.Bieler U.Arz proceedings Proc. of 21st International Conference on Microwave, Radar and Wireless Communications (MIKON) 2016 5 9 n/a n/a SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 1-4 Calibration, Measurement uncertainty, Microwave measurement, nonlinear modelling http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7492056&isnumber=7491934 EMRP A169: Call 2012 SI Broader scope (II) IEEE

Piscataway

Krakow, Poland 21st International Conference on Microwave, Radar and Wireless Communications (MIKON) 9-11 May 2016 30 n/a n/a 10.1109/MIKON.2016.7492056 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. D.Schreurs S.Liu G.Avolio I.Ocket article ZappaTVLLAPGBDG2016 232 Physical Review Letters 2016 5 116 18 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 180401 Quantum Foundations, Quantum Nonlocality, Weak Values, Weak Measurements EMPIR 2014: Industry American Physical Society (APS) 30 0031-9007, 1079-7114 10.1103/PhysRevLett.116.180401 NA F.Piacentini A.Avella M. P.Levi R.Lussana F.Villa A.Tosi F.Zappa M.Gramegna G.Brida I. P.Degiovanni M.Genovese article Quantum Measurements and Quantum Metrology 2016 4 21 3 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 27–31 Quantum Communication, Quantum Metrology, Calibration https://www.degruyter.com/view/j/qmetro EMPIR 2014: Industry DE GRUYTER OPEN

Warsaw (Poland)

30 2299-114X 10.1515/qmetro-2016-0005 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. https://www.degruyter.com/downloadpdf/j/qmetro.2016.3.issue-1/qmetro-2016-0005/qmetro-2016-0005.pdf F.Piacentini A.Avella P.Traina L.Lolli E.Taralli E.Monticone M.Rajteri D.Fukuda I. P.Degiovanni G.Brida article IEEE Antennas and Wireless Propagation Letters 2016 4 21 PP (pre pubblicaiton) 99 IND51: MORSE: Metrology for optical and RF communication systems 1-4 Embedded antenna, on-module antenna, near field measurement. http://ieeexplore.ieee.org/document/7457638/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway

30 Print ISSN: 1536-1225 Online ISSN: 1548-5757 10.1109/LAWP.2016.2557239 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 http://ieeexplore.ieee.org/document/7457638/ M.Alonso del Pino M.Di Rosa M.Simeoni M.Spella C.de Martino M.Spirito article Optics Letters 2016 4 14 41 8 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 1841-1844 CCD, charge-coupled device; Quantum detectors; Calibration. https://www.osapublishing.org/ol/abstract.cfm?uri=ol-41-8-1841 EMPIR 2014: Industry OSA Publishing

Washington, D.C. 20036-1012 USA

30 0146-9592/16/081841-04 10.1364/OL.41.001841 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-14 A.Avella I.Ruo-Berchera I. P.Degiovanni G.Brida M.Genovese proceedings Proceedings of the third Joint International Symposium on Deformation Monitoring 2016 4 SIB60: Surveying: Metrology for long distance surveying Length metrology, EDM, GNSS, traceability, EMRP JRP SIB60 Surveying http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_16.pdf EMRP A169: Call 2012 SI Broader scope (II) Vienna, Austria Joint International Symposium on Deformation Monitoring March 30-April 1, 2016 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Pollinger A.Bauch J.Leute K.Meiners-Hagen J.Mildner J.Guillory J.-P.Wallerand J.Jokela U.Kallio H.Koivula S.Lahtinen M.Poutanen M.Astrua C.Francese M.Zucco L.Eusebio F.Marques C.Pires F.Saraiva O.Pelligrino T.Tomberg T.Hieta T.Fordell M.Merimaa V.Kupko P.Neyezhmakov S.Bergstrand S.A.van den Berg T.Kersten T.Krawinkel proceedings Proceedings of the third Joint International Symposium on Deformation Monitoring 2016 4 SIB60: Surveying: Metrology for long distance surveying Submission 27 Kilometric distance, optical telemetry, two-wavelength telemetry, absolute distance meter. http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf EMRP A169: Call 2012 SI Broader scope (II) FIG Vienna, Austria Joint International Symposium on Deformation Monitoring 30-03-2016 to 01-04-2016 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.fig.net/resources/proceedings/2016/2016_03_jisdm_pdf/nonreviewed/JISDM_2016_submission_27.pdf J.Guillory J.-P.Wallerand D.Truong R.Šmíd C.Alexandre article Philosophical Transactions of the Royal Society A 2016 3 28 374 2064 SIB01: InK: Implementing the new kelvin 20150044 high-temperature fixed points, thermodynamic temperature, thermometry, temperature scale, kelvin, eutectics http://rsta.royalsocietypublishing.org/content/374/2064/20150044 EMRP A169: Call 2011 SI Broader Scope The Royal Society

London

30 10.1098/rsta.2015.0044 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. E.RWooliams KAnhalt MBallico PBloembergen FBourson SBriaudeau JCampos M.GCox Ddel Campo WDong M.RDury VGavrilov IGrigoryeva M.LHernanz FJahan BKhlevnoy VKhromchenko D.HLowe XLu GMachin J.MMantilla M.JMartin H.CMcEvoy BRougie MSaldi S.G.RSalim NSasajima D.RTaubert A.D.WTodd RVan den Bossche article Philosophical Transactions of the Royal Society A 2016 3 28 374 2064 SIB01: InK: Implementing the new kelvin 20150041 primary thermometry, radiation thermometry, radiometry http://rsta.royalsocietypublishing.org/content/374/2064/20150041 EMRP A169: Call 2011 SI Broader Scope Royal Society

London

30 10.1098/rsta.2015.0041 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. KAnhalt GMachin article Metrologia 2016 3 9 53 2 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 860 photothermal noise, AlGaAs, laser frequency stabilization, Fabry-Pérot cavities, gravitational waves http://iopscience.iop.org/article/10.1088/0026-1394/53/2/860/meta EMRP A169: Call 2012 Open excellence call IOP Publishing

Bristol, UK

30 0026-1394 10.1088/0026-1394/53/2/860 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. TChalermsongsak E DHall G DCole DFollman FSeifert KArai E KGustafson J RSmith MAspelmeyer R XAdhikari article Applied Radiation and Isotopes 2016 3 1 109 Special Issue: ICRM 2015 HLT11: MetroMRT: Metrology for molecular radiotherapy 226-230 90Y resin microspheres; Ionisation chambers; calibration factors; Capintec CRC-25R http://ac.els-cdn.com/S0969804315303134/1-s2.0-S0969804315303134-main.pdf?_tid=5a48db6c-1dc9-11e6-b9a5-00000aab0f6b&acdnat=1463666312_e589a503e7b566030018889dc6beaabd EMRP A169: Call 2011 Metrology for Health Elsevier

London

30 0969-8043 10.1016/j.apradiso.2015.11.074 1 59 No, EURAMET is never allowed to make the publication publicly available. KMFerreira AJFenwick AArinc LCJohansson article AltzitzoglouSM2016 Applied Radiation and Isotopes 2016 3 109 ENV57: MetroERM: Metrology for radiological early warning networks in Europe 36-40 Interlaboratory comparison Environmental radioactivity Spiked air filter 137Cs in air EMRP A169: Call 2013 Environment II Elsevier BV 30 0969-8043 10.1016/j.apradiso.2015.12.008 NA T.Altzitzoglou K.Sobiech-Matura B.Máté article Applied Radiation and Isotopes 2016 3 109 March 2016 HLT11: MetroMRT: Metrology for molecular radiotherapy 160-163 Radionuclide 177Lu, Activity Standardization, Photon Emission probability, Half-life http://www.sciencedirect.com/science/article/pii/S0969804315302906 EMRP A169: Call 2011 Metrology for Health Elsevier

Oxford

30 0969-8043 10.1016/j.apradiso.2015.11.059 1 59 No, EURAMET is never allowed to make the publication publicly available. P.Dryak J.Sochorova J.Solc P.Auerbach article Philosophical Transactions of the Royal Society A 2016 2 22 374 2064 SIB01: InK: Implementing the new kelvin 20150043 high-temperature fixed points, thermodynamic temperature, filter radiometer, radiation thermometer http://rsta.royalsocietypublishing.org/content/374/2064/20150043 EMRP A169: Call 2011 SI Broader Scope The Royal Society

London

30 10.1098/rsta.2015.0043 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MSadli GMachin KAnhalt FBourson SBiraudeau Ddel Campo ADiril OKozlova D.HLowe J.MMantilla Amor M.JMartin H.CMcEvoy MOjanen-Saloranta ÖPehlivan BRougié S.G.RSalim article PoletaeffBPOKZA2016 IEEE Transactions on Instrumentation and Measurement 2016 2 65 2 IND60: EMC: Improved EMC test methods in industrial environments 365-377 Improvement of LISN Measurement Accuracy Based on Calculable Adapters EMRP A169: Call 2012 Metrology for Industry (II) Institute of Electrical and Electronics Engineers (IEEE)

445 Hoes Lane, Piscataway, NJ 08855-1331, USA

30 0018-9456, 1557-9662 10.1109/TIM.2015.2479107 NA AndréPoletaeff DenisBélières BorutPinter MohamedOuameur MihaKokalj FrancoisZiade DjamelAllal article AstefanoaeiDQPPLG2016 Physics in Medicine and Biology 2016 2 61 4 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 1738-1764 graphite calorimetry, calorimetry, medium-energy x-rays, reference dosimetry, primary standard, x-ray dosimetry EMRP A169: Call 2011 Metrology for Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/0031-9155/61/4/1738 NA IAstefanoaei MD’Arienzo MQuini MPimpinella MPinto SLoreti A SGuerra article Applied Physics B 2016 1 30 122 February 2016 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 33 Entangled Photons Source, Quantum Hybrid Systems https://link.springer.com/article/10.1007/s00340-015-6275-x http://link.springer.com/journal/340 EMPIR 2014: Industry Springer-Verlag

Berlin Heidelberg

30 1432-0649 10.1007/s00340-015-6275-x 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. O.Dietz C.Müller T.Kreißl U.Herzog T.Kroh A.Ahlrichs O.Benson article SawalNPGZRBTGSGACFEERBP2016 Accreditation and Quality Assurance 2016 1 29 21 2 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 121-129 Water Framework Directive, Interlaboratory comparison, Whole water sample, Suspended particulate matter, Polycyclic aromatic hydrocarbons, Polybrominated diphenyl ethers, Tributlyltin EMRP A169: Call 2010 Environment Springer Nature 30 0949-1775, 1432-0517 10.1007/s00769-015-1190-8 NA G.Sawal M.Nousiainen D.Pröfrock A.G.Gago T.Zuliani A.Rodríguez-Cea B.Binici M.Tunç T.Gokcen C.Swart F.Gantois E.Alasonati J.Cabillic I.Fettig H.Emteborg S.Elordui-Zapatarietxe J.Richter M.Buzoianu R.Philipp article OzgurAHYaCCY2016 Measurement Science and Technology 2016 1 20 27 3 SIB58: Angles: Angle metrology 035201 Angle metrology, Differential Fabry–Perot interferometry, small angle generators, autocollimators, Synchrotron and X-FEL optics EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing 30 0957-0233, 1361-6501 10.1088/0957-0233/27/3/035201 NA B.Özgür A.Akgöz R.Hamid T.Yandayan E.Şahin M.Çelik M.Çetintaş T.Yandyan proceedings MonteBKALBGRRKMAG2016 Proceedings of the 2016 International Conference on Quantitative InfraRed Thermography 2016 1 16 ENG57: VITCEA: Validated inspection techniques for composites in energy applications Characterisation artificial defects CFRP and GFRP active thermography EMRP A169: Call 2013 Energy II QIRT Council

1065 ave. de la Medecine Quebec City Quebec G1V 0A6 Canada

Gdansk QIRT 16 04-07-2016 to 08-07-2016 30 10.21611/qirt.2016.076 NA C.Monte A.Blahut L.Knazovicka A.Aktas M.Lodeiro G.Baker M.Gower B.Rehmer M.Röllig R.Krankenhagen C.Maierhofer A.Adibekyan B.Gutschwager article vanderVeenBA2016 Analytica Chimica Acta 2016 1 902 ENG54: Biogas: Metrology for biogas 22-32 Sampling; Containers; Suitability; Biogas; Biomethane; Impurities; VOCs; Siloxanes EnG https://www.ncbi.nlm.nih.gov/pubmed/26703250 EMRP A169: Call 2013 Energy II Elsevier BV

New York

30 0003-2670 10.1016/j.aca.2015.10.039 NA A.M.H.van der Veen A.S.Brown K.Arrhenius techreport TerauchiKSBWWADGAAHUWSJKKFSBSS2016 415 Metrologia 2016 1 53 1A 14SIP05: TF-STANDARD: Developing a Standard for Valid Methodology for the Characterisation of Functional Alloy Thin Films 08011-08011 CIGS, Cu(In,Ga)Se2, mole fractions, key comparison CCQM-K129 http://iopscience.iop.org/article/10.1088/0026-1394/53/1A/08011
https://www.bipm.org/utils/common/pdf/final_reports/QM/K129/CCQM-K129.pdf EMPIR 2014: Support for Impact IOP Publishing 30 0026-1394, 1681-7575 10.1088/0026-1394/53/1A/08011 NA A.S.Kim K.J.Kim J.S.Jang J.K.Suh T.Wirth W.Unger V.D.Hodoroaba J.R.Araujo B.S.Archanjo C.E.Galhardo J.Damasceno C.A.Achete H.Wang M.Wang J.Bennett D.Simon A.Kurokawa S.Terauchi T.Fujimoto C.Streeck B.Beckhoff S.Spencer A.Shard article Quantum Matter 2016 4 3 IND06: MIQC: Metrology for Industrial Quantum Communications 1-13 Quantum Tomography, Quantum Information, Single Photon Detectors, POVM http://www.aspbs.com/qm.html EMRP A169: Call 2010 Industry 30 2164-7615 59 No, EURAMET is never allowed to make the publication publicly available. M. G.Mingolla F.Piacentini A.Avella M.Gramegna L.Lolli A.Meda I.Ruo Berchera E.Taralli P.Traina M.Rajteri G.Brida I. P.Degiovanni M.Genovese article AIP Conference Proceedings 2016 1552 728 SIB01: InK: Implementing the new kelvin 728-733 Comparison; Filter radiometer; Irradiance responsivity; Thermodynamic temperature measurement http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821404 EMRP A169: Call 2011 SI Broader Scope AIP Scitation

Melville

30 0094-243X 10.1063/1.4821404 1 59 No, EURAMET is never allowed to make the publication publicly available. XLu KAnhalt R DTaubert ZYuan article Semiconductor Science and Technology 2016 31 06LT01 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 1-5 tunnel junction, multi-junction solar cells, band-to-band tunneling, Flietner’s relation EMRP A169: Call 2013 Energy II IOP Publishing

UK

30 10.1088/0268-1242/31/6/06LT01 1 59 No, EURAMET is never allowed to make the publication publicly available. KLLouarn CFFontain AAArnoult FOOlivié GLLacoste FPPiquemal ABBounouh GAAlmuneau article IEEE Transactions on Electromagnetic Compatibility 2016 58 2 IND60: EMC: Improved EMC test methods in industrial environments 385-392 Digital signal processing, electromagnetic compatibility, electromagnetic interference, electromagnetic measurements, time-domain analysis. http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7390236&isnumber=7429977 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

New York

30 0018-9375 10.1109/TEMC.2016.2518302 1 59 No, EURAMET is never allowed to make the publication publicly available. 15837187 Marco A.Azpúrua MarcPous FerranSilva article Energy & Environmental Science 2016 9 5 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 1818-1827 Thin films, solar cells, Cu(In,Ga)Se2, XRD, XRF, in-situ, planar defects, TEM EMRP A169: Call 2013 Energy II The Royal Society of Chemistry

London

30 1754-5692 10.1039/c6ee00402d 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-4-18 R.Mainz E.Simsek Sanli H.Stange D.Azulay S.Brunken D.Greiner S.Hajaj M. D.Heinemann C. A.Kaufmann M.Klaus Q. M.Ramasse H.Rodriguez-Alvarez A.Weber I.Balberg O.Millo P. A.van Aken D.Abou-Ras article Proceedings of the 2016 Asia-Pacific Symposium on Electromagnetic Compatibility (APEMC) Shenzhen, China 2016 N.A. N.A. IND60: EMC: Improved EMC test methods in industrial environments 279-282 electromagnetic compatibility; time-domain measurement; spectrogram; power mains noise and interference EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Piscataway, NJ

30 Unknown 1 59 No, EURAMET is never allowed to make the publication publicly available. I.Setiawan C.H.Keyer M.Azpurua F.Silva F.B.J.Leferink article Journal of Coatings Technology and Research 2016 13 6 IND52: XD Reflect: Multidimensional reflectometry for industry 941-951 Specular gloss, Gloss meter, Interinstrument agreement http://link.springer.com/article/10.1007/s11998-016-9813-5 EMRP A169: Call 2012 Metrology for Industry (II) American Coatings Association

Washington, DC20001

30 1935-3804 1547-0091 10.1007/s11998-016-9813-5 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2017-12-1 F. B.Leloup J.Audenaert G.Obein G.Ged P.Hanselaer proceedings 11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances 2016 11th 2016 SIB64: METefnet: Metrology for moisture in materials 297 dielectric permittivity, capacitive cell, coaxial cell, moisture measurement http://www.isema2016.org/ EMRP A169: Call 2012 SI Broader scope (II) Edifir-Edizioni

Firenze

Firenze (Italy) 11th International Conference on Electromagnetic Wave Interaction with Water and Moist Substances 23-05-2016 to 27-05-2016 30 978-88-7970-800-5 59 No, EURAMET is never allowed to make the publication publicly available. MWBen Ayoub EGeorgin J FRochas SHubert PAchard LNeves PSabouroux article AlacaOLHWT2016 922 Journal of Nanomaterials 2016 2016 14IND03: Strength-ABLE: Metrology for length-scale engineering of materials 1-6 Elastic Behavior of Silicon Nanowires https://www.hindawi.com/journals/jnm/2016/4905838/ EMPIR 2014: Industry Hindawi Limited 30 1687-4110, 1687-4129 10.1155/2016/4905838 NA N.Wollschläger Z.Tasdemir I.Häusler Y.Leblebici W.Österle B.E.Alaca proceedings LiDHRVAR2016 80 IEEE XPlore 2016 14IND02: PlanarCal: Microwave measurements for planar circuits and components Standards, Calibration, Impedance, Nanoscale devices, Impedance measurement, Probes, Transmission line measurements, extreme impedance measurement, Calibration, on-wafer measurement, nano-scale, co-planar waveguide, RF nanotechnology http://epubs.surrey.ac.uk/813783/1/Votsi_88th_ARFTG_Paper_Summary%20%28002%29.pdf EMPIR 2014: Industry IEEE

USA & Canada

Austin, TX, USA Microwave Measurement Conference (ARFTG) 08-12-2016 to 09-12-2016 30 10.1109/ARFTG.2016.7839719 NA H.Votsi I.Roch-Jeune K.Haddadi C.Li G.Dambrine P.H.Aaen N.Ridler article EkinsDaukesA2016_2 IEEE Journal of Photovoltaics 2016 6 4 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells 1004-1011 Semiconductors, multi-junction solar cells, photoluminescence, SPICE http://www.riverpublishers.com/journal_read_html_article.php?j=JGE/5/4/3 EMRP A169: Call 2013 Energy II Institute of Electrical and Electronics Engineers (IEEE) 30 1904-4720 10.13052/jge1904-4720.5343 NA N.Ekins-Daukes D.Alonso-Alvarez article Metrologia 2015 12 16 53 1 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 1-9 inverse problem, Bayesian framework, Metropolis–Hastings, measurement uncertainty, prior distributions, thermal diffusivity MAT - EMRP A169: Call 2011 Metrology for New Technologies BIPM

Sèvres

30 - 10.1088/0026-1394/53/1/S1 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Allard N.Fischer G.Ebrard B.Hay P.Harris L.Wright D.Rochals J.Mattout article IET Circuits, Devices & Systems 2015 12 3 9 6 NEW08: MetNEMS: Metrology with/for NEMS 420 - 427 thermal properties, atomic force microscopy, chemical vapour deposition, copper, foils, graphene, mechanical properties, micromechanical resonators, monolayers, scanning electron microscopy http://ieeexplore.ieee.org/document/7339736/ EMRP A169: Call 2011 Metrology for New Technologies IEEE

New York CIty

30 1751-858X 10.1049/iet-cds.2015.0149 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-12-3 SGoniszewski JGallop MAdabi KGajewski EShaforost NKlein ASierakowski JChen TGotszalk YChen LHao article SterrHDAL2015 Physical Review A 2015 12 92 6 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 063814 time and frequency metrology, optical lattice clock, ultra-stable laser, stability https://journals.aps.org/pra/abstract/10.1103/PhysRevA.92.063814 EMRP A169: Call 2012 Open excellence call American Physical Society (APS) 30 1050-2947, 1094-1622 10.1103/PhysRevA.92.063814 NA U.Sterr S.Häfner S.Dörscher A.Al-Masoudi C.Lisdat article IEEE Transactions on Electromagnetic Compatibility 2015 12 57 6 IND60: EMC: Improved EMC test methods in industrial environments 1374-1381 Electromagnetic compatibility, electromagnetic interference (EMI), electromagnetic measurements, statistical signal processing, time-domain analysis. http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7169567&isnumber=7353235 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

New York

30 0018-9375 10.1109/TEMC.2015.2456983 1 59 No, EURAMET is never allowed to make the publication publicly available. 15677166 Marco A.Azpúrua MarcPous FerranSilva article IEEE Transactions on Electromagnetic Compatibility 2015 12 57 6 IND60: EMC: Improved EMC test methods in industrial environments 1382-1390 Amplitude probability distribution (APD), electromagnetic transients interferences, GSM, impulsive noise, timedomain measurements. http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7247681&isnumber=7353235 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

New York

30 0018-9375 10.1109/TEMC.2015.2472983 1 59 No, EURAMET is never allowed to make the publication publicly available. 15677194 MarcPous Marco A.Azpúrua FerranSilva article KralikBAVSS2015 Radiation Protection Dosimetry 2015 12 172 4 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 341-345 Secondary neutrons, proton therapy, Bonner Sphere Spectrometer EMRP A169: Call 2011 Metrology for Health Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncv504 NA M.Králík H.Bártová M.Andrlík Z.Vykydal J.Solc J.Solc article BallesterNebotAFRRG2015 Journal of Chromatography A 2015 12 1425 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 265-272 EU Water Framework Directive, GC–MS/MS, Isotope Dilution Mass Spectrometry, Tributyltin EMRP A169: Call 2010 Environment Elsevier BV 30 0021-9673 10.1016/j.chroma.2015.11.031 NA S.Ballester Nebot J.L.Aranda Mares N.Font Cardona P.Rodríguez-González A.Rodríguez-Cea J.I.García Alonso article SmerziSHAEPLKLPK2015 Nature Communications 2015 11 27 6 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 8984 quantum mechanics, entanglement, heisenberg limit EMRP A169: Call 2012 Open excellence call Springer Nature

New York

30 2041-1723 10.1038/ncomms9984 NA A.Smerzi L.Santos K.Hammerer J.Arlt W.Ertmer L.Pezzè B.Lücke I.Kruse K.Lange J.Peise C.Klempt article Nature Communication 2015 11 24 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks arxiv.org/abs/1511.07735 EMRP A169: Call 2011 SI Broader Scope 30 1 59 No, EURAMET is never allowed to make the publication publicly available. C.Lisdat G.Grosche N.Quintin C.Shi S.M.F.Raupach C.Grebing D.Nicolodi F.Stefani A.Al-Masoudi S.Dörscher S.Häfner J.-L.Robyr N.Chiodo S.Bilicki E.Bookjans A.Koczwara S.Koke A.Kuhl F.Wiotte F.Meynadier E.Camisard M.Abgrall M.Lours T.Legero H.Schnatz U.Sterr H.Denker C.Chardonnet Y.Le Coq G.Santarelli article Int. J. Metrol. Qual. Eng. 2015 11 23 6 3 SIB10: NOTED: Novel techniques for traceable temperature dissemination 303 Au/Pt thermocouple, reference function, temperature scale http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html EMRP A169: Call 2011 SI Broader Scope Dr. A. CHARKI

EDP Sciences - France 17, Avenue du Hoggar Parc d'Activité de Courtabœuf BP 112 91944 Les Ulis Cedex A France

30 10.1051/ijmqe/2015016 1 59 No, EURAMET is never allowed to make the publication publicly available. http://www.metrology-journal.org/articles/ijmqe/abs/2015/03/ijmqe150016/ijmqe150016.html F.Edler N.Arifovic G.Atance C.Dinu C. J.Elliott C. G.Izquierdo N.Hodzic S.Kalisz J.V.Pearce S.Simic R.Strnad D.Taubert article Physics in Medicine and Biology 2015 11 12 60 23 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 9145 –9156 Geant4-DNA, nanodosimetry, proton therapy http://iopscience.iop.org/article/10.1088/0031-9155/60/23/9145 EMRP A169: Call 2011 SI Broader Scope IOP Publishing

Bristol, UK

30 0031-9155 10.1088/0031-9155/60/23/9145 1 59 No, EURAMET is never allowed to make the publication publicly available. FAlexander CVillagrasa HRabus J JWilkens proceedings 2015 11 4 HLT10: BiOrigin : Metrology for biomolecular origin of disease Microflow, uncertainty, drug delivery devices, calibration EMRP A169: Call 2011 Metrology for Health St. Petersburg AMCTM2014 September 2014 30 59 No, EURAMET is never allowed to make the publication publicly available. ElsaBatista EduardaFilipe NelsonAlmeida IsabelGodinho techreport CDDIS: NASA's Archive of Space Geodesy Data 2015 11 1 Revision 2 Draft 3.4 SIB60: Surveying: Metrology for long distance surveying GNSS, SLR, DORIS, VLBI, global network http://cddis.gsfc.nasa.gov/docs/2015/SiteRecDoc_Rev2_D3.4.pdf EMRP A169: Call 2012 SI Broader scope (II) NASA Goddard Space Flight Center

Greenbelt

30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. G.Appleby D.Behrend S.Bergstrand H.Donovan C.Emerson J.Esper H.Hase J.Long C.Ma D.McCormick C.Noll E.Pavlis P.Ferrage M.Pearlman J.Saunier D.Stowers S.Wetzel article PHYSICAL REVIEW LETTERS 2015 11 115 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 223603 Lasing Artificial atom Decoherence Three-level atom Harmonic oscillator http://journals.aps.org/prl/pdf/10.1103/PhysRevLett.115.223603 EMRP A169: Call 2012 Open excellence call PHYSICAL REVIEW LETTERS 30 10.1103/PhysRevLett.115.223603 1 59 No option selected Z. H.Peng Yu-xiLiu J. T.Peltonen T.Yamamoto J.S.Tsai O.V.Astafiev article OliveroGSGMEDBBAMTF2015 563 Scientific Reports 2015 10 29 5 1 14IND05: MIQC2: Optical metrology for quantum enhanced secure telecommunication 15901 Single Photon Sources, NV centers https://www.nature.com/articles/srep15901 EMPIR 2014: Industry Springer Nature 30 2045-2322 10.1038/srep15901 NA J.Forneris P.Traina D.G.Monticone G.Amato L.Boarino G.Brida I.P.Degiovanni E.Enrico E.Moreva V.Grilj N.Skukan M.Jakšić M.Genovese P.Olivero article Electronics Letters 2015 10 22 51 22 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 1767 - 1769 atomic clocks, Ramsey scheme, pulsed interrogation, optical detection http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7308180&filter%3DAND%28p_IS_Number%3A7308095%29%26rowsPerPage%3D75 EMRP A169: Call 2012 Metrology for Industry (II) The Institution of Engineering and Technology (IET)

Stevenage & London, UK

30 0013-5194 10.1049/el.2015.1902 1 59 No, EURAMET is never allowed to make the publication publicly available. http://ietdl.org/t/Uofr0b S.Kang M.Gharavipour C.Affolderbach G.Mileti article Applied Physics Letters 2015 10 14 107 15 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 152103 Stacking faults, Cu(In,Ga)Se2, thin films, solar cells, XRD, GIXRD, GDOES, grain growth, optical pump terahertz probe spectroscopy EMRP A169: Call 2013 Energy II AIP Publishing LLC

College Park

30 0003-6951 10.1063/1.4933305 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. H.Stange S.Brunken H.Hempel H.Rodriguez-Alvarez N.Schäfer D.Greiner A.Scheu J.Lauche C. A.Kaufmann T.Unold D.Abou-Ras R.Mainz article Measurement 2015 10 9 78 ENG01: GAS: Characterisation of Energy Gases 168-179 High temperature measurement High temperature fixed points (HTFPs) Industrial process control Radiation thermometry Thermocouples Reference functions http://www.sciencedirect.com/science/article/pii/S026322411500500X EMRP A169: Call 2009 Energy ELSEVIER

Amsterdam

30 0263-2241 10.1016/j.measurement.2015.09.033 1 59 No option selected GMachiin KAnhalt MBattuello FBourson PDekker ADiril FEdler C.J.Elliott FGirard AGreenen LKnazovická DLowe PPavlasek J.V.Pearce MSadli RStrnad MSeifert E.M.Vuelban article Applied Materials and Interfaces 2015 10 6 7 42 SIB61: CRYSTAL: Crystalline surfaces, self assembled structures, and nano-origami as length standard in (nano)metrology 23615-23622 PS-b-PMMA, self-assembly, trench, thin film, rapid thermal annealing, graphoepitaxy EMRP A169: Call 2012 SI Broader scope (II) ACS Publications

Washington

30 10.1021/acsami.5b07127 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Lupi G.Aprile T.Giammaria G.Seguini G.Zuccheri N.De Leo L.Boarino M.Perego article The European Physical Journal D 2015 10 69 237 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 1-9 DNA, impact ionization, fragmentation, cross-sections http://link.springer.com/article/10.1140%2Fepjd%2Fe2015-60204-7 EMRP A169: Call 2011 SI Broader Scope Springer

Berlin

30 1434-6079 (print) ; 1434-6079 (online) 10.1140/epjd/e2015-60204-7 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. B.Rudek A.Arndt D.Bennett M.Wang H.Rabus proceedings International Congress of Metrology 2015 9 21 17 15001 SIB01: InK: Implementing the new kelvin 1-5 http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15001/metrology_metr2015_15001.html EMRP A169: Call 2011 SI Broader Scope EDP Sciences

London/Parc d'Activité de Courtabœuf

Paris 17th International Congress of Metrology September 2015 30 10.1051/metrology/201515001 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MSadli KAnhalt FBourson SBriaudeau Ddel Campo ADiril DLowe GMachin JManuel Mantilla Amor M.JMartin HMcEvoy MOjanen OPehlivan BRougie S.G.RSalim article 17th International Congress of Metrology 2015 9 21 17th 2015 SIB64: METefnet: Metrology for moisture in materials 15003 Development - Moisture in materials http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15003/metrology_metr2015_15003.html EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences

London

30 NA 10.1051/metrology/20150015003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. SBell AAro FArpino SAytekin GCortellessa MDell’Isola ZFerenčíková VFernicola RGavioso EGeorgin MHeinonen DHudoklin LJalukse NKaraböce ILeito AMäkynen PMiao JNielsen INicolescu MRudolfová MOjanen-Saloranta PÖsterberg PØstergaard MRujan MSega RStrnad TVachova article 17th International Congress of Metrology 2015 9 21 17th 2015 SIB64: METefnet: Metrology for moisture in materials 15008 Moisture, high frequencies, micro-waves, metrology, transfer standard. http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_15008/metrology_metr2015_15008.html EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences

London

30 NA 10.1051/metrology/20150015008 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. EGeorgin JFRochas PAchard SHubert MWBen Ayoub PSabouroux article Wear 2015 9 15 338–339 IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces 95–104 Profile measurements, Chromatic confocal probe, Twin-disc tests, Wear, Friction http://www.sciencedirect.com/science/article/pii/S004316481500318X EMRP A169: Call 2010 Industry Elsevier  30 0043-1648 10.1016/j.wear.2015.05.011 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BHHemming PAAndersson article Microscopy and Microanalysis 2015 9 14 21 6 ENG53: ThinErgy: Traceable characterisation of thin-film materials for energy applications 1644-1648 elemental distributions, thin films, laser-induced breakdown spectroscopy, grazing-incidence X-ray fluorescence analysis, comparison http://journals.cambridge.org/action/displayAbstract?fromPage=online&aid=10063275&fulltextType=RA&fileId=S1431927615015093 EMRP A169: Call 2013 Energy II Cambridge University Press (CUP) 30 1431-9276 10.1017/S1431927615015093 1 59 No, EURAMET is never allowed to make the publication publicly available. DARAbou-Ras RCCaballero CSStreeck BBBeckhoff JHIIn SJJeong proceedings Proceedings of International Conference on Innovative Technologies IN-TECH2015 2015 9 12 1 1 IND62: TIM: Traceable in-process dimensional measurement 104-107 Design, traceability, measurement standard, machine tool http://www.in-tech.info EMRP A169: Call 2012 Metrology for Industry (II) Faculty of Engineering, University of Rijeka

Rijeka, Croatia

Dubrovnik, Croatia International Conference on Innovative Technologies IN-TECH2015 08-09-2015 to 12-09-2015 30 977-000-001-849-7 1849-0662 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://www.in-tech.info M.Acko R.Klobucar M.Milfelner article Physical Review A 2015 9 8 92 SIB01: InK: Implementing the new kelvin 032506 EMRP A169: Call 2011 SI Broader Scope APS

New York

30 10.1103/PhysRevA.92.032506 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. PasqualeAmodio Maria DomenicaDe Vizia LuigiMoretti LivioGianfrani proceedings 17th International Congress of Metrology 2015 9 2015 2015 SIB62: HFCircuits: Metrology for new electrical measurement quantities in high-frequency circuits 12006 - http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/contents/contents.html EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences

London

Paris International Congress of Metrology 21-09-2015 to 24-09-2015 37 - - 10.1051/metrology/20150012006 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. DAllal BHall PVincent ALitwin FZiadé DjamelAllal article ViefhausNSRHAHPYY2015 Review of Scientific Instruments 2015 9 86 9 SIB58: Angles: Angle metrology 093109 synchrotron optics; X-ray optics; metrology for synchrotron optics; slope measurement; NOM; multilayer; focusing mirrors EMRP A169: Call 2012 SI Broader scope (II) AIP Publishing 30 0034-6748, 1089-7623 10.1063/1.4930968 NA J.Viefhaus J.Nordgren F.Siewert R.Reininger A.Hage M.Agåker U.Hahn H. B.Peters Z.Yin TanferYandayan proceedings Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque (2015) 2015 8 30 22 1 SIB63: Force: Force traceability within the meganewton range 4 Hysteresis, Reversibility, Transducer, Maxwell-Slip, Calibration http://www.imeko.org/publications/wc-2015/IMEKO-WC-2015-TC3-073.pdf EMRP A169: Call 2012 SI Broader scope (II) IMEKO

Budapest

30 1 59 No option selected T.Rabault P.Averlant F.Boineau article KimNHLAHLHMLHJBCPYKSPPHK2015 ACS Nano 2015 8 25 9 8 SIB51: GraphOhm: Quantum resistance metrology based on graphene 8352-8360 amorphous carbon, bottom-up growth, graphene, graphene growth from polymer, graphene-based heterostructure EMRP A169: Call 2012 SI Broader scope (II) American Chemical Society (ACS)

Washington, USA

30 1936-0851, 1936-086X 10.1021/acsnano.5b03037 NA Kwang S.Kim Konstantin S.Novoselov ChanyongHwang ZonghoonLee Jong-HyunAhn Sang WooHan Tae GeolLee SeungHyun ArtemMishchenko Seoung-KiLee SungHuh GumhyeJeon JinseokByun Dong-HunChae Hyo JuPark Seong UkYu Yong-JinKim Jin GyeongSon JaesungPark BeomjinPark Byung HeeHong Jin KonKim proceedings 2015 8 24 NEW07: THz Security: Microwave and terahertz metrology for homeland security THz, mm-wave, Skin Phantom, Thermal Imaging EMRP A169: Call 2011 Metrology for New Technologies Hong Kong 40th International Conference on Infrared, Millimeter and Terahertz Waves (IRMMW-THz 2015) 2015-08-23 until 2015-08-28 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Kazemipour M.Charles D.Allal M.Borsero L.Zilberti O.Bottauscio M.Chiampi proceedings 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 2015 8 22 2015 2015 IND60: EMC: Improved EMC test methods in industrial environments 1254-1259 3D electromagnetic simulations, LISN calibration, input impedance, conductive immunity http://ieeexplore.ieee.org/document/7256350/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

Dresden 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 16-08-2015 to 22-08-2015 30 978-1-4799-6616-5 2158-1118 10.1109/ISEMC.2015.7256350 1 59 No, EURAMET is never allowed to make the publication publicly available. FrancoisZiade MohamedOuameur DenisBélières AndréPoletaeff DjamelAllal MihaKokalj BorutPinter proceedings 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 2015 8 22 2015 2015 IND60: EMC: Improved EMC test methods in industrial environments 1260 - 1265 Alternative, Current Probe, CDN, Conducted Immunity, EMC, High Current, Industry, Mains Impedance http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=7256351&tag=1 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

USA

Dresden 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 16-08-2015 to 22-08-2015 30 - 2158-110X 10.1109/ISEMC.2015.7256351 1 59 No, EURAMET is never allowed to make the publication publicly available. SoydanÇakır OsmanŞen SavaşACAK MustafaÇetintaş proceedings CetintasACS2015 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 2015 8 22 2015 2015 IND60: EMC: Improved EMC test methods in industrial environments 1243-1247 Alternative; Voltage; Probe; Conducted Emission; EMC; Industry; In-Situ; LISN; Mains Impedance; On-Site EMRP A169: Call 2012 Metrology for Industry (II) IEEE Dresden 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC Europe 2015) 16-08-2015 to 22-08-2015 30 10.1109/ISEMC.2015.7256348 NA M.Çetintaş S.Acak S.Çakır O.Şen article Operation of graphene quantum Hall resistance standard in a cryogen-free table-top system 2015 8 19 2 3 SIB51: GraphOhm: Quantum resistance metrology based on graphene 035015 graphene, Quantum Hall, cryogen-free, measurement http://iopscience.iop.org/2053-1583/2/3/035015/video/abstract EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing Ltd 30 2053-1583 10.1088/2053-1583/2/3/035015 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.J.B.M.Janssen S.Rozhko I.Antonov A.Tzalenchuk J. M.Williams Z.Melhem H.He S.Lara-Avila S.Kubatkin R.Yakimova article IEEE Electromagnetic Compatibility Magazine 2015 8 17 4 Quarter 2 IND60: EMC: Improved EMC test methods in industrial environments 82-91 Digital Signal Processing, Electromagnetic compatibility, Electromagnetic interference, Electromagnetic measurements, Time-domain analysis. http://ieeexplore.ieee.org/document/7204056/ EMRP A169: Call 2012 Metrology for Industry (II) IEEE

-

30 2162-2272 10.1109/MEMC.2015.7204056 1 No, EURAMET is never allowed to make the publication publicly available. 2162-2264 MarcoAzpúrua MarcPous SoydanÇakir MustafaÇETİNTAŞ FerranSilva article New Journal of Physics 2015 8 13 17 1 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 083027 quantum Fisher information, quantum metrology, quantum entanglement, Dicke states http://arxiv.org/abs/1412.3426 EMRP A169: Call 2012 Open excellence call IOP Publishing

Bristol BS1 6HG UK

30 1367-2630 10.1088/1367-2630/17/8/083027 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://iopscience.iop.org/1367-2630/17/8/083027 IApellaniz BLücke JPeise CKlempt GTóth proceedings InterNoise 2015 2015 8 9 44 SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound 11 sound power level determination, measurement errors,tracebility http://ince.publisher.ingentaconnect.com/content/ince/incecp/2015/00000250/00000004 EMRP A169: Call 2012 SI Broader scope (II) INTERNOISE

Washington, D.C.

San Francisco InterNoise 2015 09.08.2015-12.08.2015 30 0736-2935 59 No, EURAMET is never allowed to make the publication publicly available. I.Arendt P.Kurtz proceedings InterNoise 2015 2015 8 9 44. SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound 4684-4692 sound power level determination, systematic differences, tracebility http://ince.publisher.ingentaconnect.com/content/ince/incecp/2015/00000250/00000002 EMRP A169: Call 2012 SI Broader scope (II) INTERNOISE

Washington, D.C.

San Francisco InterNoise 2015 9.-12. August 2015 30 0736-2935 59 No, EURAMET is never allowed to make the publication publicly available. I.Arendt P.Kurtz proceedings 135 IAG 150 Years - Proceedings of the 2013 IAG Scientific Assembly 2015 8 1 143 2015 SIB60: Surveying: Metrology for long distance surveying calibration · EDM · GNSS · local ties · reference baseline · long distance http://link.springer.com/chapter/10.1007%2F1345_2015_154 EMRP A169: Call 2012 SI Broader scope (II) Springer International Publishing

Berlin Heidelberg

Potsdam, Germany International Association of Geodesy (IAG) Scientific Assembly 2013 September 1-6, 2013 30 0939-9585 10.1007/1345_2015_154 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Pollinger M.Astru A.Bauch S.Bergstrand B.Görres J.Jokela U.Kallio H.Koivula H.Kuhlmann V.Kupko K.Meiners-Hagen M.Merimaa W.Niemeier P.Neyezhmakov M.Poutanen F.Saraiva S.Schön S.A.van den Berg J.-P.Wallerand M.Zucco techreport - 2015 7 30 - - NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation - - MAT https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf EMRP A169: Call 2011 Metrology for New Technologies PTB

Brunswick & Berlin

- 30 - - 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. https://www.ptb.de/emrp/resources/documents/nmasatue/NEW04/Papers/BPGWP1.pdf C.Elster K.Klauenberg M.Walzel G.Wuebbeler P.Harris M.Cox C.Matthews I.Smith L.Wright A.Allard N.Fischer S.Cowen S.Ellison P.Wilson F.Pennecchi G.Kok A.Van der Veen L.R.Pendrill article Journal of Physical Chemistry (B) 2015 7 23 119 33 NEW01: TReND: Traceable characterisation of nanostructured devices 10784–10797 http://pubs.acs.org/doi/abs/10.1021/acs.jpcb.5b05625 EMRP A169: Call 2011 Metrology for New Technologies ACS

Washington DC

30 10.1021/acs.jpcb.5b05625 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-6 A.Shard R.Havelund S.Spencer I.Gilmore M.R.Alexander T.B.Angerer S.Aoyagi J.P.Barnes A.Benayad A.Bernasik G.Ceccone J.D.PCounsell C.Deeks J.S.Fletcher D.J.Graham C.Heuser T.G.Lee C.Marie M.M.Marzec G.Mishra D.Rading O.Renault D.JScurr H.K.Shon V.Spampinato H.Tian F.Wang N.Winograd K.Wu A.Wucher article Biomed. Eng.-Biomed. 2015 7 10 60 4 HLT07: MeDD: Metrology for drug delivery 301-316 dynamic gravimetric calibration; intercomparison; liquid; metrology for drug delivery; microflow; primary standard; validation. EMRP A169: Call 2011 Metrology for Health 30 10.1515/bmt-2014-0145 1 59 No, EURAMET is never allowed to make the publication publicly available. H.Bissig H.T.Petter P.Lucas E.Batista E.Fillipe N.Almeida L.F.Ribeiro J.Gala R.Martins B.Savanier F.Ogheard A.K.Niemann J.Lötters W.Sparreboom article J. Opt. Soc. Am. A 2015 7 2 32 8 SIB08: subnano: Traceability of sub-nm length measurements 1403-1424 Diffraction theory; Wave dressing of rays, Propagation methods; Metrology https://www.osapublishing.org/josaa/abstract.cfm?uri=josaa-32-8-1403 EMRP A169: Call 2011 SI Broader Scope 30 10.1364/JOSAA.32.001403 59 No, EURAMET is never allowed to make the publication publicly available. B.Andreas G.Mana G.Mana article Nuclear Instruments and Methods in Physics Research, Section A 2015 7 1 797 not available IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry 271-277 High Purity Germanium; Minimum detectable activity; Monte Carlo; Spectrometer; Standardisation; Steel factories http://www.sciencedirect.com/science/article/pii/S0168900215008220 EMRP A169: Call 2010 Industry ELSEVIER

Amsterdam

30 0168-9002 10.1016/j.nima.2015.07.002 1 59 No, EURAMET is never allowed to make the publication publicly available. AndreaPetrucci DirkArnold OleksiyBurda PierinoDe Felice EduardoGarcía-Toraño MarcoMejuto VirginiaPeyrés JaroslavŠolc BrankoVodenik article Meas. Sci. Technol. 2015 7 26 (8) SIB60: Surveying: Metrology for long distance surveying laser diode, photodetection, amplitude modulation, phase measurement, amplitude-to-phase coupling, optical telemetry, absolute distance meter EMRP A169: Call 2012 SI Broader scope (II) 30 10.1088/0957-0233/26/8/084006 59 No, EURAMET is never allowed to make the publication publicly available. JGuillory JGarcía-Márquez CAlexandre J-PWallerand DTruong article IEEE Transactions on Instrumentation and Measurement 2015 6 30 64 12 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 3629-3637 Atomic clocks, diode lasers, microwave measurements, microwave resonators, microwave spectroscopy, optical pumping http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=7140794 EMRP A169: Call 2012 Metrology for Industry (II) The Institute of Electrical and Electronics Engineers (IEEE)

New York, NY, USA

30 0018-9456 10.1109/TIM.2015.2444261 1 59 No, EURAMET is never allowed to make the publication publicly available. http://arxiv.org/abs/1505.07739 C.Affolderbach G.-X.Du T.Bandi A.Horsley P.Treutlein G.Mileti article Biomed. Eng.-Biomed. Tech. 2015 6 26 60 4 HLT07: MeDD: Metrology for drug delivery 317-335 calibration; comparison; implanted infusion; pumps; micro and nano liquid flow rates; primary standard; uncertainty; validation; volumetric expansion EMRP A169: Call 2011 Metrology for Health 30 10.1515/bmt-2014-0132 1 59 No, EURAMET is never allowed to make the publication publicly available. P.Lucas M.Ahrens J.Geršl W.Sparreboom J.Lötters proceedings Proceedings of the 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 2015 2015 6 15 n/a n/a ENG52: SmartGrid II: Measurement tools for Smart Grid stability and quality 1-5 phasor measurement units, smart grids, renewable energy sources http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf EMRP A169: Call 2013 Energy II n/a

n/a

Lyon, France 23rd International Conference and Exhibition on Electricity Distribution (CIRED) 14-06-15 to 15-06-15 30 n/a n/a 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://cired.net/publications/cired2015/papers/CIRED2015_1046_final.pdf GRietveld AJongepier Jvan Seters MVisser PLiu MAcanski DHoogenboom H. E.van den Brom article Biomed. Eng.-Biomed. Tech. 2015 6 10 60 4 HLT07: MeDD: Metrology for drug delivery 337-345 calibration; metrology; microflow; nanoflow; traceability; uncertainty. EMRP A169: Call 2011 Metrology for Health 30 10.1515/bmt-2014-0153 1 59 No, EURAMET is never allowed to make the publication publicly available. M.Ahrens B.Nestler S.Klein P.Lucas H.T.Petter C.Damiani article Acta Imeko 2015 6 4 2 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 39-44 model parameter identification; dynamic torque calibration; dynamic measurement; mechanical model https://acta.imeko.org/index.php/acta-imeko/article/view/IMEKO-ACTA-04%20%282015%29-02-07 EMRP A169: Call 2010 Industry Imeko

Budapest

30 ISSN 2221-870X 10.21014/acta_imeko.v4i2.211 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. L.Klaus B.Arendacká M.Kobusch T.Bruns article International Journal of Simulation Modelling 2015 6 14 2 NEW06: TraCIM: Traceability for computationally-intensive metrology 227-237 Interlaboratory Comparison, Validation Software, Performance Metrics, Verification, Simulation MAT http://www.ijsimm.com/Full_Papers/Fulltext2015/text14-2_227-237.pdf EMRP A169: Call 2011 Metrology for New Technologies DAAAM International Vienna 

Vienna

30 1726-4529 10.2507/IJSIMM14(2)4.288 1 59 No, EURAMET is never allowed to make the publication publicly available. BAAcko SBBrezovnik LCLCrepinsek-Lipus RKKlobucar proceedings 2015 5 19 SIB64: METefnet: Metrology for moisture in materials http://www.asmeatiuit2015.com/public/index.php EMRP A169: Call 2012 SI Broader scope (II) Villa Doria D'Angri, Napoli ASME ATI UIT 2015 17-20 June, 2015 30 59 No, EURAMET is never allowed to make the publication publicly available. F.Arpino G.Cortellessa M.Dell'Isola G.Ficco A.Carotenuto N.Massarotti article The International Journal of Advanced Manufacturing Technology 2015 5 14 81 5 IND59: Microparts: Multi-sensor metrology for microparts in innovative industrial products 795-810 Coarse registration, Fine registration, Discrete curvatures, Hough transform, Moving least squares surface, Computational tomography, Measurement errors, Dimensional metrology http://link.springer.com/article/10.1007/s00170-015-7131-1 EMRP A169: Call 2012 Metrology for Industry (II) Springer

London

30 0268-3768 10.1007/s00170-015-7131-1 1 59 No, EURAMET is never allowed to make the publication publicly available. R.Rantoson H.Nouira N.Anwer C.Mehdi-Souzani article SuranKBAMSHTLT2015 Radiation Protection Dosimetry 2015 5 13 168 3 ENV09: MetroRWM: Metrology for Radioactive Waste Management 293-299 reference materials, calibration, ionizing radiation, free release measurement http://rpd.oxfordjournals.org EMRP A169: Call 2010 Environment Oxford University Press (OUP) 30 0144-8420, 1742-3406 10.1093/rpd/ncv309 NA J.Šuráň P.Kovář O.Burda D.Arnold G.Marissens H.Stroh M.Hult F.Tzika A.Listkowska Z.Tyminski proceedings Fortschritte der Akustik - DAGA 2015 2015 5 11 41. Jahrestagung für Akustik SIB56: SoundPwr: Realisation, dissemination and application of the unit watt in airborne sound sound power level determination, sound intensity, systematic differences http://daga2015.de/de/ EMRP A169: Call 2012 SI Broader scope (II) Deutsche Gesellschaft für Akustik e.V. (DEGA)

Berlin

Nürnberg Fortschritte der Akustik - DAGA 2015 16. bis 19. März 2015 43 978-3-939296-08-9 59 No, EURAMET is never allowed to make the publication publicly available. I.Arendt A.Berger article Comptes Rendus Physique 2015 5 8 16 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 531–539 Time and frequency metrology Optical links Frequency stabilized lasers Fibre optics www.sciencedirect.com EMRP A169: Call 2011 SI Broader Scope 30 10.1016/j.crhy.2015.04.005 1 59 No, EURAMET is never allowed to make the publication publicly available. O.Lopez F.Kéfélian H.Jiang A.Haboucha A.Bercy F.Stefani B.Chanteau A.Kanj D.Rovera J.Achkar CChardonnet P.-O.Pottie A.Amy-Klein G.Santarelli article Disorder induced Dirac-point physics in epitaxial graphene from temperature-dependent magneto-transport measurements 2015 5 SIB51: GraphOhm: Quantum resistance metrology based on graphene Dirac-point physics, epitaxial graphene, magneto-transport, measurement, graphene, hall effect, electron-hole puddles, http://arxiv.org/abs/1505.03747 EMRP A169: Call 2012 SI Broader scope (II) arXiv.org 30 10.1103/PhysRevB.92.075407 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Huang J.A.Alexander-Webber A.M.R.Baker T.J.B.M.Janssen A.Tzalenchuk V.Antonov T.Yager S.Lara-Avila S.Kubatkin R.Yakimova R.J.Nicholas article Phys. Rev. X 2015 4 27 5 2 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 021011 Atomic and Molecular Physics, Quantum Physics http://arxiv.org/abs/1501.03709 EMRP A169: Call 2012 Open excellence call American Physical Society

College Park, MD

30 2160-3308 10.1103/PhysRevX.5.021011 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. RKohlhaas ABertoldi ECantin AAspect ALandragin PBouyer article ChemComm 2015 4 24 51 45 NEW02: Raman: Metrology for Raman Spectroscopy 9366-9369 N/A http://pubs.rsc.org/en/Content/ArticleLanding/2015/CC/c5cc02675j#!divAbstract EMRP A169: Call 2011 Metrology for New Technologies Royal Society of Chemistry

Picadilly UK

30 N/A 10.1039/c5cc02675j 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 N.Rubio L.M.Hirvonen E.Z.Chong J.T.W.Wang M.Bourgognon H.Kafa H.A.F.M.Hassan W.T.Al-Jamal D.McCarthy C.Hogstrand F.Festy K.T.Al-Jamal article Epitaxial graphene on SiC: modification of structural and electron transport properties by substrate pretreatment 2015 4 20 27 18 SIB51: GraphOhm: Quantum resistance metrology based on graphene 185303 Epitaxial graphene, step bunching, graphene buffer layer, graphene bilayer, resistance anisotropy, quantum Hall resistance, hydrogen, argon, pretreatment, transport properties, SiC substrate, annealing, shallowly stepped http://iopscience.iop.org/article/10.1088/0953-8984/27/18/185303/meta EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing Ltd 30 0953-8984 10.1088/0953-8984/27/18/185303 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M.Kruskopf K.Pierz S.Wundrack R.Stosch T.Dziomba C.C.Kalmbach A.Müller F.J.Ahlers H.W.Schumacher J.Baringhaus C.Tegenkamp article Nature Communications 2015 4 14 6 1 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 6811 Physical sciences Atomic and molecular physics http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html#affil-auth EMRP A169: Call 2012 Open excellence call Macmillan Publishers Limited

Basingstoke, Hampshire RG21 6XS, United Kingdom

30 2041-1723 10.1038/ncomms7811 1 59 No, EURAMET is never allowed to make the publication publicly available. http://www.nature.com/ncomms/2015/150414/ncomms7811/full/ncomms7811.html#affil-auth JPeise BLücke LPezze FDeuretzbacher WErtmer JArlt ASmerzi LSantos CKlempt article J. Opt. Soc. Am. B 2015 4 9 32 5 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 787 - 797 EMRP A169: Call 2011 SI Broader Scope 30 10.1364/JOSAB.32.000787 59 No, EURAMET is never allowed to make the publication publicly available. F.Stefani O.Lopez A.Bercy W.-K.Lee C.Chardonnet G.Santarelli P.-E.Pottie A.Amy-Klein article Opt. Lett. 2015 4 8 40 8 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 1705 (120.5790) Sagnac effect; (140.3370) Laser gyroscopes; (140.3560) Lasers, ring. https://www.osapublishing.org/ol/abstract.cfm?uri=ol-40-8-1705 EMRP A169: Call 2012 Open excellence call Optical Society of America

Washington, DC, USA

30 1539-4794 10.1364/OL.40.001705 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. USchreiber RThirkettle RHurst DFollman GCole MAspelmeyer J-PWells article Int J Thermophys 2015 4 5 36 8 SIB01: InK: Implementing the new kelvin 1834-1847 High-temperature fixed points · Metal-carbon eutectics · Radiation thermometry · Temperature standards · Thermodynamic temperature http://link.springer.com/article/10.1007/s10765-015-1860-0 EMRP A169: Call 2011 SI Broader Scope Springer Link

Europe/Asia/Africa

30 NA 10.1007/s10765-015-1860-0 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. YYamada KAnhalt MBattuello PBloembergen BKhlevnoy GMachin MMatveyev MSadli ATodd TWang article Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms 2015 4 1 348 8 EXL02: SIQUTE: Single-photon sources for quantum technologies 187-190 Diamond; Electroluminescence; Graphite; Ion beam micro-machining http://www.sciencedirect.com/science/journal/0168583X EMRP A169: Call 2012 Open excellence call Elsevier

London

30 0168-583X 10.1016/j.nimb.2014.12.036 1 59 No, EURAMET is never allowed to make the publication publicly available. J.Forneris A.Battiato D.Gatto Monticone F.Picollo G.Amato L.Boarino G.Brida I.P.Degiovanni E.Enrico M.Genovese E.Moreva P.Traina C.Verona G.Verona Rinati P.Olivero article OPTICS LETTERS 2015 4 1 40 7 EXL02: SIQUTE: Single-photon sources for quantum technologies 1548-1551 Quantum optics, Quantum detectors, Quantum information and processing. https://www.osapublishing.org/ol/home.cfm EMRP A169: Call 2012 Open excellence call Optical Society of America

Washington

30 0146-9592 10.1364/OL.40.001548 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-4-1 F.Piacentini M. P.Levi A.Avella M.López S.Kück S. V.Polyakov I. P.Degiovanni G.Brida M.Genovese article MeylanGGVBOABBG2015 Radiotherapy and Oncology 2015 4 115 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy S106-S107 BioQuaRT, track structure, ion beam therapy, microdosimetry, nanodosimetry, multi-scale model, reactive species EMRP A169: Call 2011 SI Broader Scope Elsevier BV

Suite 800, 230 Park Avenue, New York, NY 10169, United States

30 0167-8140 10.1016/S0167-8140(15)40209-9 59 NA S.Meylan G.Gruel G.Gonon C.Villagrasa M.U.Bug SandraOtto A.Arndt W.Y.Baek M.Bueno U.Giesen article AlexanderRVW2015 Radiotherapy and Oncology 2015 4 115 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy S796 BioQuaRT, track structure, ion beam therapy, nanodosimetry, treatment planning EMRP A169: Call 2011 SI Broader Scope Elsevier BV

Suite 800, 230 Park Avenue, New York, NY 10169 United States

30 0167-8140 10.1016/S0167-8140(15)41460-4 59 NA F.Alexander H.Rabus C.Villagrasa J.J.Wilkens article Precision Engineering 2015 3 31 41 1 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies 119 Ion beam figuring Form error correction Silicon sphere Avogadro project EMRP A169: Call 2011 SI Broader Scope Elsevier

Philadelphia

30 0141-6359 10.1016/j.precisioneng.2015.03.009 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Th.Arnold F.Pietag article Biomed. Eng.-Biomed. Tech. 2015 3 30 60 4 HLT07: MeDD: Metrology for drug delivery 347-357 compliance; drug delivery; infusion; metrology; pump; standards EMRP A169: Call 2011 Metrology for Health 30 10.1515/bmt-2014-0138 1 59 No, EURAMET is never allowed to make the publication publicly available. E.Batista N.Almeida E.Fillipe L.Sousa R.Martins P.Lucas H.T.Petter R.ASnijder A.M.D.E.Timmerman article AzumaBBBBBCDFFHKKKMMMMNNPRRSSVWWZ Metrologia 2015 3 25 52 2 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies fundamental constants, Avogadro constant, kilogram A169 EMRP A169: Call 2011 SI Broader Scope 30 0957-0233 10.1088/0026-1394/52/2/360 1 59 NA YAzuma PBarat GBartl HBettin MBorys IBusch LCibik GD’Agostino KFujii HFujimoto AHioki MKrumrey UKuetgens NKuramoto GMana EMassa RMeeß SMizushima TNarukawa ANicolaus APramann S ARabb ORienitz CSasso MStock R DVocke Jr AWaseda SWundrack SZakel article IEEE Transaction on Instrumentation and Measurement 2015 3 19 64 6 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies 1650-1656 Avogadro constant, diameter measurement, optical interferometer, silicon crystal, spectroscopic ellipsometer, volume measurement. http://ieeexplore.ieee.org/xpl/abstractCitations.jsp?arnumber=7063918&refinements%3D4294557292%26filter%3DAND%28p_IS_Number%3A7104190%29 EMRP A169: Call 2011 SI Broader Scope Institution of Electrical and Electrical Engineering (IEEE)

Piscataway

30 0018-9456 10.1109/TIM.2015.2401212 1 59 No, EURAMET is never allowed to make the publication publicly available. INSPEC 15111473 N.K.Kuramoto Y. AAzuma H. I.Inaba F-L. H.Hong K. FFujii article Wear 2015 3 15 326-327 IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces 58-67 Surface roughness, Angle-resolved scattering, Wear, Isotropy https://www.researchgate.net/publication/270344579_Angle_resolved_scattering_as_a_tribological_investigation_tool_for_surface_characterization EMRP A169: Call 2010 Industry Elsevier 30 0043-1648 10.1016/j.wear.2014.12.040 1 59 No, EURAMET is never allowed to make the publication publicly available. SAAzouigui ZSSilvestri CZZerrouki MPPlimmer DSSpaltmann AKKovalev MWWoydt PPPinot article KangGAGM2015 Journal of Applied Physics 2015 3 12 117 10 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications atomic clock, microwave cavity, optical pumping, POP http://scitation.aip.org/content/aip/journal/jap/117/10/10.1063/1.4914493 A169 EMRP A169: Call 2012 Metrology for Industry (II) English 0021-8979 10.1063/1.4914493 1 59 NA S.Kang M.Gharavipour C.Affolderbach F.Gruet G.Mileti article Proceedings of SPIE 2015 3 3 9398 Measuring, Modeling, and Reproducing Material Appearance 2015 IND52: XD Reflect: Multidimensional reflectometry for industry Bidirectional reflectance transmission function ; Metrology ; Optical design ; Reflection ; Specular reflections ; Equipment and services ; Measurement devices http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=2208024 EMRP A169: Call 2012 Metrology for Industry (II) SPIE

Bellingham, WA, USA

30 10.1117/OL.12.2082518 1 59 No, EURAMET is never allowed to make the publication publicly available. G.Obein J.Audenaert G.Ged F.Leloup article PhilippFRAFFYD2015 Talanta 2015 3 134 ENV08: WFDtraceability: Traceable measurements for monitoring critical pollutants under the European Water Framework Directive (WFD-2000/60/EC) 576-586 experimental design, isotope dilution, organotin compounds, solid-phase extraction, tributyltin, water framework directive EMRP A169: Call 2010 Environment Elsevier BV 30 0039-9140 10.1016/j.talanta.2014.11.064 NA R.Philipp P.Fisicaro J.Richter E.Alasonati B.Fabbri I.Fettig C.Yardin M.E.Del Castillo Busto article Optical Engineering 2015 2 26 54 2 SIB08: subnano: Traceability of sub-nm length measurements 024110 Shear interferometry, Wave field sensing, Digital holography, Phase contrast imaging http://opticalengineering.spiedigitallibrary.org/article.aspx?articleid=2174776 EMRP A169: Call 2011 SI Broader Scope SPIE

Bellingham

30 1.OE.54.2.024110 10.1117/1.OE.54.2.024110 1 59 No, EURAMET is never allowed to make the publication publicly available. C.Falldorf M.Agour R. B.Bergmann article Procedia Engineering 2015 2 24 100 - IND62: TIM: Traceable in-process dimensional measurement 376-383 Traceability; production process; calibration; measurement standard; machine-tool capability http://www.sciencedirect.com/science/article/pii/S1877705815004087 EMRP A169: Call 2012 Metrology for Industry (II) Elsevier

Amsterdam

30 1877-7058 10.1016/j.proeng.2015.01.381 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BojanAcko RokKlobucar MaticAcko article Journal of Biomolecular NMR 2015 2 21 62 1 HLT10: BiOrigin : Metrology for biomolecular origin of disease 17-23 7 trans-membrane proteins Poorly available proteins Fast magic angle spinning Heteronuclear detection 13C-detection Low sample volumes http://link.springer.com/article/10.1007%2Fs10858-015-9911-1 EMRP A169: Call 2011 Metrology for Health Springer

Berlin

30 10.1007/s10858-015-9911-1 1 59 No, EURAMET is never allowed to make the publication publicly available. AnthonyWatts Peter J.Judge LubicaAsilmovska Marc PhilippPfeil Victoria A.Higman KrisztinaVarga Garrick F.Taylor Hugh R WDannatt article Metrologia 2015 2 5 52 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 195-200 single electron pump, quantum current standard, QD electron pump http://m.iopscience.iop.org/0026-1394/52/2/195 EMRP A169: Call 2011 SI Broader Scope 30 10.1088/0026-1394/52/2/195 59 No, EURAMET is never allowed to make the publication publicly available. M.-H.Bae Y.-H.Ahn M.Seo Y.Chung J. D.Fletcher S. P.Giblin M.Kataoka N.Kim article ZikmundRKHA IEEE Transactions on Magnetics 2015 2 2 51 1 IND08: MetMags: Metrology for Advanced Industrial Magnetics A169 EMRP A169: Call 2010 Industry 30 0018-9464 10.1109/TMAG.2014.2357783 1 59 NA A.Zikmund P.Ripka R.Ketzler H.Harcken M.Albrecht article IEEE Transaction on Instrumentation and Measurement 2015 2 2 64 6 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies 1509-1513 Chemical analysis, silicon, surface contamination, thickness measurement, X-ray spectroscopy http://ieeexplore.ieee.org/xpl/abstractAuthors.jsp?arnumber=7029043&refinements%3D4294557292%26filter%3DAND%28p_IS_Number%3A7104190%29 EMRP A169: Call 2011 SI Broader Scope Institution of Electrical and Electrical Engineering (IEEE)

Piscataway

30 0018-9456 10.1109/TIM.2015.2389352 1 59 No, EURAMET is never allowed to make the publication publicly available. INSPEC Accession Number: 15111454 L. Z.Zhang Y. A.Azuma A. K.Kurokawa N. K.Kuramoto K. F.Fujii techreport CCRI(I) working documents 2015 2 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy EMRP A169: Call 2011 SI Broader Scope 30 59 No, EURAMET is never allowed to make the publication publicly available. A.Arndt W. Y.Baek D.Bennett M. U.Bug T.Buhr G.Hilgers H.Nettelbeck T.Pflüger H.Rabus J.Rahm X.Ren B.Rudek S.Sellner H.Szymanowski M.Wang M.Weyland article Plasma Sources Science and Technology 2015 1 27 24 2 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies 025002 plasma jet machining, plasma etching, surface roughness EMRP A169: Call 2011 SI Broader Scope IOP Publishing

Bristol

30 10.1088/0963-0252/24/2/025002 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. H.Paetzelt G.Böhm Th.Arnold article VerbeystABF2015 Measurement Science and Technology 2015 1 20 26 2 IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications 025203 electro-optic sampling, pulse generator, waveform metrology EMRP A169: Call 2010 Industry IOP Publishing 30 0957-0233, 1361-6501 10.1088/0957-0233/26/2/025203 NA F.Verbeyst S.Ahmed M.Bieler H.Füser article Journal of Applied Physics 2015 1 9 117 n/a NEW08: MetNEMS: Metrology with/for NEMS 024501 graphene, dielectic thin films, quartz, electrical resistivity, microwaves http://scitation.aip.org/content/aip/journal/jap/117/2/10.1063/1.4903820 EMRP A169: Call 2011 Metrology for New Technologies AIP Publishing

Melville

30 n/a 10.1063/1.4903820 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. OShaforost KWang SGoniszewski MAdabi ZGuo SHanham JGallop LHao NKlein article GarciaToranoPCRABLD2015 Journal of Radioanalytical and Nuclear Chemistry 2015 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry Metal radioactivity; HPGe detectors; MDA; metallurgy; steel works http://www.springer.com/chemistry/journal/10967 A169 EMRP A169: Call 2010 Industry English 10.1007/s10967-014-3901-8 1 59 NA E.García-Toraño V.Peyres B.Caro M.Roteta D.Arnold O.Burda M-R.Loan P.De Felice article Rev. Sci. Instrum. 2015 86 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere EMRP A169: Call 2011 SI Broader Scope 30 10.1063/1.4907358 59 No, EURAMET is never allowed to make the publication publicly available. D.Drung C.Krause U.Becker H.Scherer F. J.Ahlers proceedings 2015 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 800-803 Rb clock; POP; frequency stability; magnetron-type cavity. http://www.eftf.org/previousmeetings.php EMRP A169: Call 2012 Metrology for Industry (II) Denver CO, USA 2015 JOINT CONFERENCE OF THE IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM & European Frequency and Time Forum 13-17 April 2015 30 59 No, EURAMET is never allowed to make the publication publicly available. S.Kang M.Gharavipour F.Gruet C.Affolderbach G.Mileti proceedings 2015 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 21-24 Atomic clocks, Magnetic field measurement, Microwave resonators, Microwave spectroscopy, Optical pumping. http://www.eftf.org/previousmeetings.php EMRP A169: Call 2012 Metrology for Industry (II) Denver CO, USA 2015 JOINT CONFERENCE OF THE IEEE INTERNATIONAL FREQUENCY CONTROL SYMPOSIUM & European Frequency and Time Forum 13-17 April 2015 30 10.1109/FCS.2015.7138785 59 No, EURAMET is never allowed to make the publication publicly available. C.Affolderbach G.-X.Du T.Bandi A.Horsley P.Treutlein G.Mileti proceedings Proceedings of the 2013 International Conference on Electromagnetics in Advanced Applications (ICEAA) 2015 NEW07: THz Security: Microwave and terahertz metrology for homeland security 895 - 898 EMRP A169: Call 2011 Metrology for New Technologies Torino, Italy 2013 International Conference on Electromagnetics in Advanced Applications (ICEAA) 9-13 September 2013 30 59 No, EURAMET is never allowed to make the publication publicly available. L.Zilberti A.Arduino O.Bottauscio M.Chiampi article Metrologia Tech. Suppl. 2015 52 ENV09: MetroRWM: Metrology for Radioactive Waste Management 06017 Activity measurements; I-129; International comparisons http://iopscience.iop.org/0026-1394 EMRP A169: Call 2010 Environment Institute of Physcis Science

Bristol, UK

30 1681-7575 10.1088/0026-1394/52/1A/06017 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-8-1 E.Garcia-Toraño T.Altzitzoglou P.Pavel Auerbach M.M.Bé V.Lourenco C.Bobin P.Cassette R.Dersch K.Kossert O.Nähle V.Peyrés S.Pommé A.Rozkov A.Sanchez-Cabezudo J.Sochorová proceedings 17 International Congress of Metrology 2015 ENG54: Biogas: Metrology for biogas Biogas EnG http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2015/01/metrology_metr2015_08006.pdf EMRP A169: Call 2013 Energy II EDP Sciences Paris 17 International Congress of Metrology 21 September 2015 30 10.1051/metrology/201508006 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Adriaan M. H.van der Veen Andrew S.Brown MarttiHeinonen ArulMurugan FrederiqueHaloua KarineArrhenius JianrongLi proceedings 2015 HLT07: MeDD: Metrology for drug delivery Flow. uncertainty, measurement EMRP A169: Call 2011 Metrology for Health Coimbra/Portugal 5th National meeting of the Portuguese Society of Metrology November 2012 92 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. ElsaBatista JoãoGala LuisRibeiro NelsonAlmeida EduardaFilipe RuiMartins proceedings 2015 HLT07: MeDD: Metrology for drug delivery Viscosity, density, infusion medical devices EMRP A169: Call 2011 Metrology for Health Funchal/Portugal IMEKO TC13 September 2014 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. ElsaBatista NelsonAlmeida SaraMoura RuiMartins AndreiaFurtado LuisSousa EduardaFilipe article Measurement Science Review 2015 14 4 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 10.2478, p 213-218 laser spectroscopy, metrology, molecular iodine, absorption cells, frequency doubling, interferometry http://www.degruyter.com/view/j/msr.2014.14.issue-4/msr-2014-0029/msr-2014-0029.xml EMRP A169: Call 2012 Metrology for Industry (II) De Gruyter Open Sp. z o.o.

Berlin

30 10.2748/msr-2014-0029 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Hrabina O.Acef F.du Burck N.Chiodo Y.Candela M.Sarbort M.Hola J.Lazar proceedings Proc. of SPIE 2015 Vol. 8987 IND17: Scatterometry: Metrology of small structures for the manufacturing of electronic and optical devices ZnO, Ellipsometry, Scatterometry, Material Structure http://spiedigitallibrary.org/ EMRP A169: Call 2010 Industry 30 10.1117/12.2042181 59 No option selected P.Petrik N.Kumar E.Agocs B.Fodor S. F.Pereira T.Lohner M.Fried H. P.Urbach proceedings 17 International Congress of Metrology 2015 2015 SIB60: Surveying: Metrology for long distance surveying 13014 / 4 pages coordinate measurement, long distance, laser beam, traceability http://cfmetrologie.edpsciences.org/articles/metrology/abs/2015/01/metrology_metr2015_13014/metrology_metr2015_13014.html EMRP A169: Call 2012 SI Broader scope (II) EDP Sciences Paris, France 17 International Congress of Metrology September 21-24, 2015 37 10.1051/metrology/20150013014 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. M.Zucco M.Pisani M.Astrua article Journal of Microelectronics and Electronic Packaging (2015) 12, 189-204 Copyright © International Microelectronics Assembly and Packaging Society ISSN: 1551-4897 2015 Volume 12 , Issue 4 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 189-204 Packaging and interconnection, cryogenic operation, superconductive circuit, photodetector, photodiode, optical fiber, Josephson junction, single-quantum flux electronics http://www.imapsource.org/doi/abs/10.4071/imaps.485 EMRP A169: Call 2012 SI Broader scope (II) International Microelectronics Assembly and Packaging Society

Research Triangle Park

30 1551-4897 10.4071/imaps.485 1 59 No, EURAMET is never allowed to make the publication publicly available. EivindBardalen Muhammed NadeemAkram HelgeMalmbekk PerOhlckers article Metrologia 2015 52 6 SIB10: NOTED: Novel techniques for traceable temperature dissemination 827-834 water triple point, thermometry, oxygen isotopes, isotope correction. http://iopscience.iop.org/article/10.1088/0026-1394/52/6/827/meta EMRP A169: Call 2011 SI Broader Scope IOP Publishing, Bureau International des Poids et Mesures

Berlin

30 ISSN 0026-1394 10.1088/0026-1394/52/6/827 1 59 No, EURAMET is never allowed to make the publication publicly available. V.Faghihi M.Kozick A.TAerts-Bijma H. G.Jansen J.J.Spriensma A.Peruzzi H.A.J.Meijer article The European Physical Journal D 2015 69 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy 216 track structure; particle beams; radiotherapy http://link.springer.com/article/10.1140%2Fepjd%2Fe2015-60206-5 EMRP A169: Call 2011 SI Broader Scope Springer

Cham, Switzerland

30 1434-6079 10.1140/epjd/e2015-60206-5 1 59 No, EURAMET is never allowed to make the publication publicly available. FAlexander CVillagrasa HRabus J JWilkens article 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC) 2015 1 1 IND60: EMC: Improved EMC test methods in industrial environments 1189-1194 Time domain measurements, electromagnetic interference, radiated emissions, spectral estimation, electromagnetic compatibility http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7256338&isnumber=7256113 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Dresden

30 978-1-4799-6615-8 2158-110X 10.1109/ISEMC.2015.7256338 1 59 No, EURAMET is never allowed to make the publication publicly available. M.A.AAzpúrua M.P.Pous F.S.Silva MarcPous article 2015 IEEE International Symposium on Electromagnetic Compatibility (EMC) 2015 1 1 IND60: EMC: Improved EMC test methods in industrial environments 456-461 APD, transient interferences, impulsive noise, radiated emissions, time-domain measurement http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=7256205&isnumber=7256113 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Dresden

30 978-1-4799-6615-8 2158-110X 10.1109/ISEMC.2015.7256205 1 59 No, EURAMET is never allowed to make the publication publicly available. MarcPous Marco A.Azpúrua FerranSilva article PHYSICAL REVIEW A 2014 12 22 90 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks EMRP A169: Call 2011 SI Broader Scope 30 10.1103/PhysRevA.90.061802 59 No, EURAMET is never allowed to make the publication publicly available. A.Bercy F.Stefani O.Lopez C.Chardonnet P.-E.Pottie A.Amy-Klein article Numerical Heat Transfer, Part A 2014 12 10 67 not available SIB64: METefnet: Metrology for moisture in materials 605–631 Benchmark solutions, Finite element method, Stability analysis, Laminar free convection, Time-periodic oscillating flow field, Heat transfer coefficient calculation. EMRP A169: Call 2011 Metrology for New Technologies Taylor & Francis

London

30 1040-7782 print=1521-0634 online 10.1080/10407782.2014.949133 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Arpino G.Cortellessa A.Mauro article International Journal of Quantum Information 2014 12 10 12 07n08 EXL02: SIQUTE: Single-photon sources for quantum technologies 1560011 Diamond; single-photon emitters; color centers. http://www.worldscientific.com/worldscinet/ijqi EMRP A169: Call 2012 Open excellence call worldscientific

Singapore

30 0219-7499 10.1142/S0219749915600114 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. D.Gatto Monticone J.Forneris M.Levi F.Picollo P.Olivero P.Traina E.E. Moreva E.Enrico G.Brida I. P.Degiovanni M.Genovese G.Amato L.Boarino article RastelloDSKCPSMIKSHKTBMPTACMKV2014 Metrologia 2014 11 20 51 6 IND06: MIQC: Metrology for Industrial Quantum Communications 10 Metrology, quantum cryptography, quantum communication http://iopscience.iop.org/0026-1394/ A169 EMRP A169: Call 2010 Industry English 0026-1394 10.1088/0026-1394/51/6/S267 1 59 NA M LRastello I PDegiovanni A GSinclair SKück C JChunnilall GPorrovecchio MSmid FManoocheri EIkonen TKubarsepp DStucki K SHong S KKim ATosi GBrida AMeda FPiacentini PTraina AAl Natsheh J YCheung IMüller RKlein AVaigu article ChunnilallLAHS2014 Metrologia 2014 11 20 51 6 IND06: MIQC: Metrology for Industrial Quantum Communications 10 Metrology, quantum key distribution, single-photon http://iopscience.iop.org/0026-1394/ A169 EMRP A169: Call 2010 Industry English 0026-1394 10.1088/0026-1394/51/6/S258 1 59 NA C JChunnilall GLepert J JAllerton C JHart A GSinclair article Metrologia 2014 11 20 51 6 SIB57: NEWSTAR: New primary standards and traceability for radiometry 197-202 candela photometry radiometry http://iopscience.iop.org/journal/0026-1394 EMRP A169: Call 2012 SI Broader scope (II) IOP Publishing

Bristol

30 0195-928X 10.1088/0026-1394/51/6/S276 1 59 No, EURAMET is never allowed to make the publication publicly available. T.Timo Dönsberg T.Tomi Pulli T.Tuomas Poikonen H.Hans Baumgartner A.Anna Vaskuri M.Meelis Sildoja F.Farshid Manoocheri P.Petri Kärhä E.Erkki Ikonen article MaringerSKCPGCDVHRMSJDTAHM2014 Applied Radiation and Isotopes 2014 11 81 ENV09: MetroRWM: Metrology for Radioactive Waste Management Radioactive waste management, Exemption levels, Clearance levels, Acceptance criteria, European radiation protection directive, Radioactive waste disposal http://www.sciencedirect.com/ A169 EMRP A169: Call 2010 Environment English 0969-8043 10.1016/j.apradiso.2013.03.046 1 59 NA F.J.Maringer J.Šuráň P.Kovář B.Chauvenet V.Peyres E.García-Toraño M.L.Cozzella P.De Felice B.Vodenik M.Hult U.Rosengård M.Merimaa L.Szücs C.Jeffery J.C.J.Dean Z.Tymińsk D.Arnold R.Hincam G.Mirescu article CorteLeonKSMAK2014 IEEE 2014 11 50 11 EXL04: SpinCal: Spintronics and spin-caloritronics in magnetic nanosystems Magnetic domain walls (DWs), magnetic sensors, micromagnetics, nanostructures, numerical simulations http://ieeexplore.ieee.org/stamp/stamp.jsp?arnumber=6971343 A169 EMRP A169: Call 2012 Open excellence call English 0018-9464 10.1109/TMAG.2014.2327803 1 59 NA H.Corte-León P.Krzysteczko H. W.Schumacher A.Manzin V.Antonov O.Kazakova proceedings KangAGGCM2014 2014 10 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 545-547 atomic clock, microwave cavity, optical pumping, POP http://www.eftf.org/previousmeetings.php A169 EMRP A169: Call 2012 Metrology for Industry (II) Neuchatel, Switzerland 28th European Frequency and Time Forum (EFTF) 22-26 June 2014 English 1 59 NA S.Kang C.Affolderbach F.Gruet M.Gharavipour C. E.Calosso G.Mileti proceedings IvanovBDHATMS2014 2014 10 IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 208-211 atomic clock, microwave cavity, field imaging, optical pumping. http://www.eftf.org/previousmeetings.php A169 EMRP A169: Call 2012 Metrology for Industry (II) Neuchatel, Switzerland 28th European Frequency and Time Forum (EFTF) 22-26 June 2014 English 1 59 NA A.Ivanov T.Bandi G.-X.Du A.Horsley C.Affolderbach P.Treutlein G.Mileti A. K.Skrivervik article Hot carrier relaxation of Dirac fermions in bilayer epitaxial graphene 2014 9 SIB51: GraphOhm: Quantum resistance metrology based on graphene hot carriers, bilayer graphene, energy loss rate, magnetotransport http://arxiv.org/abs/1409.6267v1 EMRP A169: Call 2012 SI Broader scope (II) arXiv.org 30 10.1088/0953-8984/27/16/164202 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. J.Huang J.A.Alexander-Webber T.J.B.M.Janssen A.Tzalenchuk T.Yager S.Lara Avila S.Kubatkin R. L.Myers-Ward D. K.Gaskill R.J.Nicholas proceedings Precision Electromagnetic Measurements (CPEM 2014), 2014 Conference on 2014 8 24 29 1 NEW07: THz Security: Microwave and terahertz metrology for homeland security 180 - 181 Refractive index, Absorption coefficient, Terahertz, Spectrometry, Uncertainty, Thin layers, Metrology. http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=&arnumber=6898318 EMRP A169: Call 2011 Metrology for New Technologies IEEE

Piscataway

Rio de Janeiro, Brazil Conference on Precision Electromagnetic Measurements 24-29/08/2014 30 978-1-4799-5205-2 0589-1485 10.1109/CPEM.2014.6898318 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 M.Charles D.Allal DjamelAllal article KalmbachSAMNLS2014 Applied Physics Letters 2014 8 21 105 073511 (2014) SIB51: GraphOhm: Quantum resistance metrology based on graphene A169 EMRP A169: Call 2012 SI Broader scope (II) English 10.1063/1.4893940 1 59 NA C.-C.Kalmbach J.Schurr F. J.Ahlers A.Müller S.Novikov N.Lebedeva A.Satrapinski article Physical Review A 2014 8 11 90 SIB01: InK: Implementing the new kelvin 022503 EMRP A169: Call 2011 SI Broader Scope APS

New York

30 10.1103/PhysRevA.90.022503 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. Maria DomenicaDe Vizia AntonioCastrillo EugenioFasci PasqualeAmodio LuigiMoretti LivioGianfrani proceedings MeesonPPGLMKLZLKEKMA2014 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 2014 8 EXL03: MICROPHOTON: Measurement and control of single-photon microwave radiation on a chip 324-325 Cryoelectronics, electromagnetic shielding, microwave photons, microwave sensors, microwave sources, nanoelectronics, single-electron devices, superconducting microwave devices, superconducting qubits EMRP A169: Call 2012 Open excellence call IEEE Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 24-08-2014 to 29-08-2014 30 10.1109/CPEM.2014.6898390 NA A.J.Manninen A.Kemppinen E.Enrico M.Kataoka T.Lindstrom A.B.Zorin S.V.Lotkhov M.Khabipov M.Möttönen R.E.Lake J.Govenius J.P.Pekola Yu.A.Pashkin P.J.Meeson O.V.Astafiev proceedings RodriguezPLKKKHGCBABSUWW2014 29th Conference on Precision Electromagnetic Measurements (CPEM 2014) 2014 8 ENG51: SolCell: Metrology for III-V materials based high efficiency multi-junction solar cells Nanoscale electrical measurement Multijunction solar cells standards high conversion efficiency III-V materials characterization EMRP A169: Call 2013 Energy II IEEE Rio de Janeiro Conference on Precision Electromagnetic Measurements 25-08-2014 to 29-08-2014 30 978-1-4799-2478-3 no ISSN 10.1109/CPEM.2014.6898387 NA T. G.Rodriguez B.Pollakowski D.Lackner J.Krupka F.Kienberger R.Kern J.Hoffmann N.Gambacorti A.Cuenat H.Baumgartner G.Almuneau A.Bounouh F.Sametoglu L.Usydus S.Winter F.Witt article FalkeLGLWGHHAHVSL2014 New Journal of Physics 2014 7 16 SIB55: ITOC: International timescales with optical clocks 073023 http://iopscience.iop.org/1367-2630/16/7/073023 A169 EMRP A169: Call 2012 SI Broader scope (II) 10.1088/1367-2630/16/7/073023 1 59 NA SFalke NLemke CGrebing BLipphardt SWeyers VGerginov NHuntemann CHagemann AAl-Masoudi SHaefner SVogt USterr CLisdat article Bioelectromagnetics 2014 7 35 5 NEW07: THz Security: Microwave and terahertz metrology for homeland security 314-323 human exposure to electromagnetic fields; Pennes bioheat equation; terahertz EMRP A169: Call 2011 Metrology for New Technologies 30 59 No, EURAMET is never allowed to make the publication publicly available. L.Zilberti A.Arduino O.Bottauscio M.Chiampi article Numerical Heat Transfer, Part A 2014 6 25 66 not available SIB64: METefnet: Metrology for moisture in materials 839–862 Matrix-inversion free CBS, Benchmark problem, Finite element method, tall cavity, unsteady oscillations, Real time http://www.tandfonline.com/doi/abs/10.1080/10407782.2014.892389 EMRP A169: Call 2012 Metrology for Industry (II) Taylor & Francis

London

30 1040-7782 print=1521-0634 online 10.1080/10407782.2014.892389 1 59 No, EURAMET is never allowed to make the publication publicly available. F.Arpino G.Cortellessa M.Dell'Isola N.Massarotti A.Mauro article ElHayekNAGD2014 Precision Engineering 2014 6 19 38 4 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 13 Aspherical surface fitting, Form metrology, Large data, Limited memory BFGS. A169 EMRP A169: Call 2010 Industry 10.1016/j.precisioneng.2014.06.004 1 59 NA NEl-Hayek HNouira NAnwer OGibaru MDamak article Journal of Materials Chemistry C 2014 6 7 2 32 NEW01: TReND: Traceable characterisation of nanostructured devices 6655-6664 http://pubs.rsc.org/en/Content/ArticleLanding/2014/TC/c4tc00756e#!divAbstract EMRP A169: Call 2011 Metrology for New Technologies Royal Society of Chemistry

London UK

30 0003-2654 10.1039/c4tc00756e 1 59 No option selected M.Perego F.F.Lupi M.Ceresoli T.J.Giammaria G.Seguini E.Enrico L.Boarino D.Antoniol V.Gianotti K.Sparnacci M.Laus proceedings not available 2014 6 4 not available not available SIB64: METefnet: Metrology for moisture in materials 357-360 Finite element method, Time-periodic oscillating flow field, Heat transfer coefficient calculation. http://www.thermacomp.com/uploads/Proceedings_ThermaComp2014_website.pdf EMRP A169: Call 2012 Metrology for Industry (II) Giannini Editore

Napoli

Lake Bled, Slovenia 3rd International Conference on Computational Methods for Thermal Problems June 2-4, 2014 30 978-88-7431-727-1 not available 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Arpino G.Cortellessa N.Massarotti A.Mauro article Organic Electronics 2014 6 15 6 IND07: Thin Films: Metrology for the manufacturing of thin films 1263-1272 Mobility, Space-charge limited current, Injection-limited current, Charge-carrier mobility, Mobility benchmark http://www.sciencedirect.com/science/article/pii/S1566119914000469 EMRP A169: Call 2010 Industry Elsevier 30 1566-1199 10.1016/j.orgel.2014.02.008 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. JCBBlakesley FACCastro WKKylberg GFADDibb RVValaskib WCCremona CAArantes JSKKim JSKKim article Metrologia 2014 5 28 51 3 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 1-22 Traceability, dynamic measurement, pressure sensor calibration, shock tube, drop-weight system http://iopscience.iop.org/article/10.1088/0026-1394/51/3/326/meta EMRP A169: Call 2010 Industry IOP Publishing Ltd

Bristol

30 0026-1394 10.1088/0026-1394/51/3/326 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CMMatthews FPPennecchi SEEichstadt AMMalengo TEEsward ISSmith CEElster AKKnott FAArrhén ALLakka article WoszczynaWGWWSWAT2014 Wiley Online Library- Advanced Materials 2014 5 23 26 28 SIB51: GraphOhm: Quantum resistance metrology based on graphene 1521-4095 graphene heterostructures,electric and electromagnetic transport, carbon nanomembrane, chemical functionalization,field-effect devices, molecular self-assembly, graphene-based nanosensors A169 EMRP A169: Call 2012 SI Broader scope (II) English 10.1002/adma.201400948 1 59 NA M.Woszczyna A.Winter M.Grothe A.Willunat S.Wundrack R.Stosch T.Weimann F.Ahlers A.Turchanin article SchurrAP2014 Metrologica (BIPM & IOP Publishing Ltd) 2014 5 13 51 3 SIB51: GraphOhm: Quantum resistance metrology based on graphene magnetocapacitance, quantum Hall effect, loss factor A169 EMRP A169: Call 2012 SI Broader scope (II) English 10.1088/0026-1394/51/3/235 1 59 NA JSchurr FAhlers KPierz proceedings GattoMonticoneTMFLBDABOG2014 Proc. SPIE 9136, Nonlinear Optics and Its Applications VIII; and Quantum Optics III 2014 5 1 9136 8 IND06: MIQC: Metrology for Industrial Quantum Communications http://spie.org A169 EMRP A169: Call 2010 Industry Brussels, Belgium Nonlinear Optics and Its Applications VIII; and Quantum Optics III April 14, 2014 English 10.1117/12.2051714 1 59 NA DGatto Monticone PTraina EMoreva JForneris MLevi GBrida I. PDegiovanni GAmato LBoarino POlivero MGenovese article GattoMonticoneTMFODTGBAG2014 New Journal of Physics 2014 5 1 16 5 EXL02: SIQUTE: Single-photon sources for quantum technologies diamond, photoluminescence, single defects, single photon sources, confocal microscopy http://iopscience.iop.org/1367-2630 A169 EMRP A169: Call 2012 Open excellence call English 1367-2630 10.1088/1367-2630/16/5/053005 1 59 NA D.Gatto Monticone P.Traina E.Moreva J.Forneris P.Olivero I. P.Degiovanni F.Taccetti L.Giuntini G.Brida G.Amato M.Genovese inbook StuerwaldAS2014 2014 5 1 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 115-127 optical testing, holograms http://www.shaker.eu/Online-Gesamtkatalog-Download/2015.03.28-23.14.28-89.244.96.77-rad71B15.tmp/3-8440-2124-8_INH.PDF A169 EMRP A169: Call 2010 Industry 17 German 1 59 NA StephanStuerwald Jean-MichelAsfour RobertSchmitt article ElHayekNADG2014 International Journal of Precision Engineering and Manufacturing 2014 5 15 5 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 821 to 829 Aspherical surface, chromatic confocal probe, form metrology, L-BFGS method, profilometer, tactile probe http://link.springer.com/article/10.1007/s12541-014-0405-y A169 EMRP A169: Call 2010 Industry English 2005-4602 10.1007/s12541-014-0405-y 1 59 NA NadimEl-Hayek HichemNouira NabilAnwer MohamedDamak OlivierGibaru article Phys. Rev. Lett. 2014 4 17 112 15 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 155304 67.85.−d, 03.67.Bg, 03.67.Mn, 03.75.Mn http://arxiv.org/abs/1403.4542v2 EMRP A169: Call 2012 Open excellence call American Physical Society

College Park, MD

30 1079-7114 10.1103/PhysRevLett.112.155304 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BLücke JPeise GVitagliano JArlt LSantos GTóth CKlempt article Nanotechnology 2014 4 15 25 27 NEW01: TReND: Traceable characterisation of nanostructured devices 10 PP block copolymers, thermal stability, self-assembly, polystyrene-b-poly(methylmethacrylate), ordering http://iopscience.iop.org/article/10.1088/0957-4484/25/27/275601/meta EMRP A169: Call 2011 Metrology for New Technologies IOP

Bristol, UK

30 10.1088/0957-4484/25/27/275601 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 M.Ceresoli F.F.Lupi G.Seguini K.Sparnacci V.Gianotti D.Antonioli M.Laus L.Boarino M.Perego article REVIEW OF SCIENTIFIC INSTRUMENTS 85, 045111 (2014) 2014 4 14 85 85 SIB05: NewKILO: Developing a practical means of disseminating the new kilogram 045111 Thermal, desorption, mass spectrometer, mass metrology http://scitation.aip.org/docserver/fulltext/aip/journal/rsi/85/4/1.4870921.pdf?expires=1460456419&id=id&accname=2118383&checksum=AC3FCE73DE77059689EE889598D57A63 EMRP A169: Call 2011 SI Broader Scope AIP Publishing

Melville

30 10.1063/1.4870921 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. ZSilvestri SAzouigui SBouhtiyya SMacé M DPlimmer PPinot FTayeb-Chandoul RHannachi article ElHayekNDGA2014 Journal of Physics: Conference Series 483 (2014) 012003 2014 4 7 483 IND10: Form metrology: Optical and tactile metrology for absolute form characterization http://iopscience.iop.org/1742-6596/483/1/012003 A169 EMRP A169: Call 2010 Industry English Online ISSN: 1742-6596 10.1088/1742-6596/483/1/012003 1 59 NA NEl-Hayek HNouira MDamak OGibaru NAnwer article Surface and Interface Analysis 2014 4 2 46 10-11 HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices 689-692 biosensor; binding; 1FC2; antibody; association constant and Brownian's dynamics http://onlinelibrary.wiley.com/doi/10.1002/sia.5500/abstract EMRP A169: Call 2011 Metrology for Health Wiley

New Yotk

30 10.1002/sia.5500 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-4-2 PAnsalone article Journal of Physics D: Applied Physics 2014 3 27 47 15 HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices 24 vacuum, surface, plasma, interface, nanoscience http://iopscience.iop.org/article/10.1088/0022-3727/47/15/153001 EMRP A169: Call 2011 Metrology for Health IOP Publishing

Bristol

30 0022-3727 10.1088/0022-3727/47/15/153001 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-3-27 MMozetič KOstrikov D.NRuzic DCurreli UCvelbar ATagliaferro O.Conde A.JSilvestre J.Giapintzakis M.Buljan N.Radić G.Dražić S.Bernstorff H.Biederman O.Kylián J.Hanuš S.Miloševič A.Galtayries P.Dietrich W.Unger V.Sedlarik K.Stana-Kleinschek A.Drmota-Petrič J.JPireaux J.,.WRogers M.Anderle article Surface and Interface Analysis 2014 3 21 46 10-11 HLT04: BioSurf: Metrology for the characterisation of biomolecular interfaces for diagnostic devices 693-697 boundary element method; linearized Poisson–Boltzmann equation; collagen; integrins; electrostatic complementarity; cell adhesion http://onlinelibrary.wiley.com/doi/10.1002/sia.5431/abstract EMRP A169: Call 2011 Metrology for Health Wiley

New York

30 10.1002/sia.5431 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2015-3-21 P.Ansalone O.O. Bottauscio A.Manzin thesis 2014 3 18 IND52: XD Reflect: Multidimensional reflectometry for industry Gonio-spectrophotometer, BRDF, retroreflexion, diffuse reflectance standards, special effect coatings, absolute measurement, low-uncertainty, PCA http://zaguan.unizar.es/record/15614 EMRP A169: Call 2012 Metrology for Industry (II) Tesis de la Universidad de Zaragoza

Zaragoza

Universidad de Zaragoza 112 2254-7606 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. http://zaguan.unizar.es/record/15614 RabalAna Maria article Journal of Low Temperature Physics 2014 3 18 175 5-6 SIB01: InK: Implementing the new kelvin 764-775 Johnson noise, Fixed point device, Precision, SQUID http://link.springer.com/article/10.1007/s10909-014-1147-z EMRP A169: Call 2011 SI Broader Scope Springer US

New York

30 1573-7357 10.1007/s10909-014-1147-z 1 59 No, EURAMET is never allowed to make the publication publicly available. ACasey FArnold L VLevitin C PLusher JNyeki JSaunders AShibahara Hvan der Vliet BYager DDrung ThSchurig GBatey M NCuthbert A JMatthews article Advances in Production Engineering & Management 2014 3 12 9 1 NEW06: TraCIM: Traceability for computationally-intensive metrology 44-52 Interlaboratory comparisons, Data generator, Software validation MAT http://apem-journal.org/Archives/2014/Abstract-APEM9-1_044-052.html EMRP A169: Call 2011 Metrology for New Technologies Production Engineering Institute (PEI), University of Maribor

Maribor

30 1854-6250 10.14743/apem2014.1.175 59 No, EURAMET is never allowed to make the publication publicly available. BAAcko BSSluban TTTasic SBBrezovnik article NouiraSEDDA2014 Measurement Science and Technology 2014 3 5 25 IND10: Form metrology: Optical and tactile metrology for absolute form characterization profilometer, atomic force microscopy, confocal chromatic probe, tactile/inductive probe, error sources, dimensional and mechanical metrology, evaluation http://iopscience.iop.org/0957-0233/25/4/044011/article?fromSearchPage=true A169 EMRP A169: Call 2010 Industry English Online ISSN: 1742-6596 10.1088/0957-0233/25/4/044011 1 59 NA HNouira J-ASalgado NEl-Hayek SDucourtieux ADelvallée NAnwer article Measurement Science and Technology 2014 3 5 25 4 IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials 044010 http://iopscience.iop.org/article/10.1088/0957-0233/25/4/044010?fromSearchPage=true EMRP A169: Call 2010 Industry IOP Publishing

London, UK

30 0957-0233 10.1088/0957-0233/25/4/044010 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. ZLLi UBBrand TAAhbe article PottieLSCSGBA2014 Journal of the Optical Society of America B 2014 3 31 4 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 678 optical frequency transfer, optical fiber https://www.osapublishing.org/josab/fulltext.cfm?uri=josab-31-4-678&id=281177 EMRP A169: Call 2011 SI Broader Scope The Optical Society 30 0740-3224, 1520-8540 10.1364/JOSAB.31.000678 NA P.E.Pottie O.Lopez G.Santarelli C.Chardonnet F.Stefani S.Guellati-Khelifa A.Bercy A.Amy-Klein proceedings PROCEEDINGS OF SPIE VOLUME 9018: Measuring, Modeling, and Reproducing Material Appearance 2014 2 24 9018 NA IND52: XD Reflect: Multidimensional reflectometry for industry 8 pages / Article no. 901803 bidirectional reflectance distribution function, near-field goniophotometry, optical metrology, material appearance characterization http://proceedings.spiedigitallibrary.org/proceeding.aspx?articleid=1835519 EMRP A169: Call 2012 Metrology for Industry (II) SPIE

Bellingham

San Francisco Measuring, Modeling, and Reproducing Material Appearance 2 February 2014 30 NA NA 10.1117/12.2035958 1 59 No, EURAMET is never allowed to make the publication publicly available. F.B.Leloup W.De Ketelaere J.Audenaert P.Hanselaer article Physical Review A 2014 2 19 89 2 IND07: Thin Films: Metrology for the manufacturing of thin films 1-8 http://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.023834 EMRP A169: Call 2010 Industry American Physical Society (APS)

Maryland

30 1050-2947 10.1103/PhysRevA.89.023834 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. OEGEl Gawhary AAAdam HPUUrbach article AvellaGSBCG2014 PHYSICAL REVIEW A 2014 2 7 89 IND06: MIQC: Metrology for Industrial Quantum Communications 023808 [1-8] http://journals.aps.org/pra/abstract/10.1103/PhysRevA.89.023808 A169 EMRP A169: Call 2010 Industry English 1050-2947 10.1103/PhysRevA.89.023808 1 59 NA A.Avella M.Gramegna A.Shurupov G.Brida M.Chekhova M.Genovese article WanGWSALHLHS2014 Nature Communications 2014 1 30 5 3096 SIB04: Ion Clock: High-accuracy optical clocks with trapped ions Physical sciences, atomic and molecular physics, optical physics http://www.nature.com/ncomms/2014/140130/ncomms4096/full/ncomms4096.html http://arxiv.org/abs/1309.7033 A169 EMRP A169: Call 2011 SI Broader Scope 10.1038/ncomms4096 1 1 59 NA YWan FGebert J.BWübbena NScharnhorst SAmairi I.DLeroux BHemmerling NLörch KHammerer P.OSchmidt article J . Chem. Phys 2014 1 24 140 SIB01: InK: Implementing the new kelvin EMRP A169: Call 2011 SI Broader Scope 30 10.1063/1.4862482 59 No, EURAMET is never allowed to make the publication publicly available. PasqualeAmodio LuigiMoretti AntonioCastrillo LivioGianfrani article Journal of Raman Spectroscopy 2014 1 9 45 1 NEW02: Raman: Metrology for Raman Spectroscopy 22-31 tip-enhanced Raman spectroscopy, interlaboratory comparison study, thiophenol self- assembled monolayer, spectra interpretation, metrology http://onlinelibrary.wiley.com/doi/10.1002/jrs.4423/abstract EMRP A169: Call 2011 Metrology for New Technologies Wiley Online

Hoboken

30 0377-0486 10.1002/jrs.4423 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2016-1-1 C.Blum L.Opilik J.M.Atkin K.Braun S.BKammer V.Kravtsov N.Kumar S.Lemeshko J.FLi K.Luszcz T.Makeki A.J.Meixner S.Minne M.B.Raschke B.Ren J.Rogalski D.Roy B.Stephanidis X.Wang D.Zhang J.H.Zhong R.Zenobi article MonteGAKEOH2014 Atmos. Meas. Tech 2014 7 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate Radiation Thermometry, Radiance, Remote Sensing, Vacuum, Emissivity http://www.atmos-meas-tech.net/7/13/2014/amt-7-13-2014.html A169 EMRP A169: Call 2010 Environment English 10.5194/amt-7-13-2014 1 59 NA C.Monte B.Gutschwager A.Adibekyan M.Kehrt A.Ebersoldt F.Olschewski J.Hollandt article PaetzeltABPS2014 Plasma Processes and Polymers 2014 10 5 SIB03: kNOW Realisation of the awaited definition of the kilogram - resolving the discrepancies plasma jet, silicon oxides; surface modification; thin films http://onlinelibrary.wiley.com/journal/10.1002/(ISSN)1612-8869 http://onlinelibrary.wiley.com/doi/10.1002/ppap.201200099/abstract EMRP A169: Call 2011 SI Broader Scope English 1612-8869 10.1002/ppap.201200099 1 59 NA H.Paetzelt T.Arnold G.Böhm F.Pietag A.Schindler proceedings Margolis2014 Proceedings of European Frequency and Time Forum & International Frequency Control Symposium (EFTF/IFC) 2014 SIB55: ITOC: International timescales with optical clocks 908-911 geodesy, international timescales, optical clock, redefinition of the second, time and frequency transfer http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6702183 EMRP A169: Call 2012 SI Broader scope (II) Prague, Czech Republic European Frequency and Time Forum & International Frequency Control Symposium (EFTF/IFC) 21 - 25 July 2013 English 10.1109/EFTF-IFC.2013.6702183 1 59 NA H.Margolis R.Godun P.Gill L.Johnson L.Shemar P.Whibberley D.Calonico F.Levi L.Lorini M.Pizzocaro P.Delva S.Bize J.Achkar H.Denker L.Timmen C.Voigt S.Falke D.Piester C.Lisdat U.Sterr S.Vogt S.Weyers J.Gersl T.Lindvall M.Merimaa proceedings KummeTRBGA2014 Proceedings of the 22nd Conference on the Measurement of Force, Mass and Torque 2014 SIB63: Force: Force traceability within the meganewton range 2 Force, Build-up Systems, Mega Newton http://www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-027.pdf A169 EMRP A169: Call 2012 SI Broader scope (II) Cape Town, Republic of South Africa IMEKO 22nd TC3, 15th TC5 and 3rd TC22 International Conferences 3 to 5 February English 1 59 NA R.Kumme F.Tegtmeier D.Röske A.Barthel A.Germak P.Averlant article SvecCSAWCMPBTGdT2014_2 International Journal of Metrology and Quality Engineering 2014 5 3 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry 301 Ionising radiation measurements / interlaboratory comparisons / EURAMET / EMRP EMRP A169: Call 2010 Industry EDP Sciences 30 2107-6839, 2107-6847 10.1051/ijmqe/2014010 NA A.Svec P.Carconi V.Sochor D.Arnold U.Wätjen T.Crespo M.Mejuto V.Peyres O.Burda F.Tzika E.García-Toraño P.De Felice J.Tecl proceedings AckoM2014 Journal of Trends in the Development of Machinery and Associated Technology 2014 18 1 IND62: TIM: Traceable in-process dimensional measurement 191 to 194 In-process measurement, traceability, standard of measurement http://www.tmt.unze.ba/journal2014.php A169 EMRP A169: Call 2012 Metrology for Industry (II) Budapest, Hungary ”Trends in the Development of Machinery and Associated Technology” TMT 2014 10 - 12 September 2014 English ISSN 2303-4009 (online) ISSN 1840-4944 1 59 NA BojanAcko MatjazMilfelner proceedings Conference on Precision Electromagnetic Measurements (CPEM) Digest 2014, IEEE Catalog Number: CFP14PEM-CDR 2014 SIB07: Qu-Ampere: Quantum ampere: Realisation of the new SI ampere 656-657 Ammeters, calibration, current measurement, measurement uncertainty, precision measurements EMRP A169: Call 2011 SI Broader Scope Rio de Janeiro Conference on Precision Electromagnetic Measurements 24-29 August 2014 30 978-1-4799-2478-3 59 No, EURAMET is never allowed to make the publication publicly available. D.Drung Ch.Krause U.Becker H.Scherer F. J.Ahlers proceedings OzturkKKMBCATA2014 CPEM 2014 Digest 2014 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements 734 - 735 analog to digital converter, error analysis, Josephson voltage standards, sampling techniques http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=&arnumber=6898595&refinements%3D4270696875%26queryText%3DCPEM+2014 A169 EMRP A169: Call 2012 SI Broader scope (II) Rio de Janeiro, Brazil 29th Conference on Precision Electromagnetic Measurements 24 - 29 August 2014 English 0589-1485 10.1109/CPEM.2014.6898595 1 59 NA T. C.Öztürk J.Kohlmann O.Kieler T.Möhring R.Behr H.Çaycı M.Arifoviç S.Turhan L.D.Ata article Applied Optics 2014 53 31 IND58: 6DoF: Metrology for movement and positioning in six degrees of freedom 7435-7441 spectroscopy, absorbtion, laser stabilisation, metrological instrumentation EMRP A169: Call 2012 Metrology for Industry (II) 30 10.1364/AO.53.007435 59 No, EURAMET is never allowed to make the publication publicly available. JanHrabina MartinŠarbort OualiAcef FrédéricDu Burck NicolaChiodo MiroslavaHolá OndřejČíp JosefLazar proceedings EU PVSEC Proceedings 2014 2014 ENG55: PhotoClass: Towards an energy-based parameter for photovoltaic classification 3214-3218 light attenuation, uncalibrated filters, meshes, IEC 61853 EMRP A169: Call 2013 Energy II Amsterdam 29th European PV Solar Energy Conference and Exhibition 22.-26.9.2014 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Adrián SantamaríaLancia GiorgioBardizza HaraldMüllejans manual 2014 IND13: Thermal design and dimensional drift: Thermal design and time-dependent dimensional drift behaviour of sensors, materials and structures nanoindentation indenter geometry frame compliance http://projects.npl.co.uk/T3D/publications.html EMRP A169: Call 2010 Industry 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. A.Maxwell L.M.Alvarez proceedings The EMRP Project GraphOhm - Towards Quantum Resistance Metrology Based on Graphene 2014 SIB51: GraphOhm: Quantum resistance metrology based on graphene 548-549 Measurement standards, resistance, quantum hall effect, graphene, C, Calibration, EMRP project GraphOhm, Electrical resistance measurement, Hall effect devices, JRP, Materials, Metrology, Resistance, Standards, electric resistance measurement, electrical measurement, intrinsically referenced resistance standard disse, joint research project, quantum resistance metrology standard, semiconductor quantum Hall device http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898502 EMRP A169: Call 2012 SI Broader scope (II) IEEE Rio de Janeiro 24-29 Aug. 2014 30 978-1-4799-2479-0 0589-1485 10.1109/CPEM.2014.6898502 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Ahlers J.Kučera W.Poirier B.Jeanneret A.Satrapinski A.Tzalenchuk P.Vrabček T.Bergsten C.Hwang R.Yakimova S.Kubatkin proceedings Breakdown of the quantum Hall effect in epitaxial graphene 2014 SIB51: GraphOhm: Quantum resistance metrology based on graphene 40-41 Current measurement,Electric breakdown,Electrical resistance measurement,Graphene,Hall effect,Hall effect devices,Resistance,SiC-C,Silicon carbide,carrier density,current density,electric breakdown,graphene,magnetic field,magnetic fields,measurement standards,phase space,polymer gated epitaxial graphene,polymers,quantum Hall effect,quantum Hall effect breakdown,quantum resistance standard,silicon compounds,wide band gap semiconductors http://ieeexplore.ieee.org/lpdocs/epic03/wrapper.htm?arnumber=6898248 EMRP A169: Call 2012 SI Broader scope (II) IEEE Rio de Janeiro CPEM2014 24-29 Aug. 2014 30 978-1-4799-2479-0 0589-1485 10.1109/CPEM.2014.6898248 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. T.J.B.M.Janssen S.Rozhko A.Tzalenchuk J.A.Alexander-Webber R.J.Nicholas article Review of Scientific Intruments 2014 86 -- IND55: Mclocks: Compact and high-performing microwave clocks for industrial applications 094707 syntheis chain, vapor cell atomic clocks, Dick effect http://scitation.aip.org/content/aip/journal/rsi/86/9/10.1063/1.4929384 EMRP A169: Call 2012 Metrology for Industry (II) America Institue of Physics

--

30 -- 10.1063/1.4929384 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BFrancois C ECalosso MAbdel Hafiz SMicalizio RBoudot article Measurement Science Review 2014 14 2 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 52-61 linear mixed models, uncertainty, GUM, ANOVA, random effects EMRP A169: Call 2010 Industry De Gruyter 30 10.2478/msr-2014-0009 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BArendacká ATäubner SEichstädt ThBruns CElster proceedings 2014 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities model parameter identification dynamic torque calibration dynamic measurement mechanical model www.imeko.org/publications/tc3-2014/IMEKO-TC3-2014-018.pdf EMRP A169: Call 2010 Industry International Measurement Conferderation

Budapest

Cape Town, Republic of South Africa Joint IMEKO Conference TC3, TC5 & TC22 03-05, February, 2014 30 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. L.Klaus B.Arendacká M.Kobusch Th.Bruns proceedings 2014 International Symposium on Electromagnetic Compatibility 2014 1 1 IND60: EMC: Improved EMC test methods in industrial environments 833-837 electromagnetic interference; conducted emissions, time-domain measurement; discret fast Fourier transform (DFFT). http://ieeexplore.ieee.org/stamp/stamp.jsp?tp=&arnumber=6931019&isnumber=6930855 EMRP A169: Call 2012 Metrology for Industry (II) IEEE

Gothenburg

Gothenburg 2014 International Symposium on Electromagnetic Compatibility 01-09-2014 to 04-09-2014 30 14696796 2325-0356 10.1109/EMCEurope.2014.6931019 1 59 No, EURAMET is never allowed to make the publication publicly available. 14696796 GerardCosta MarcPous AndreuAtienza FerranSilva article Measurement Science and Technology 2013 12 13 25 HLT07: MeDD: Metrology for drug delivery 1-9 microfluidics, micro-flow, flow measurement, front tracking, meniscus, uncertainty, calibration EMRP A169: Call 2011 Metrology for Health 30 10.1088/0957-0233/25/1/015301 1 59 No, EURAMET is never allowed to make the publication publicly available. M.Ahrens S.Klein B.Nestler C.Damiani article Phys. Rev. A 2013 11 19 88 5 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 053624 67.85.Fg, 03.75.Lm, 03.75.Mn, 11.30.Qc http://arxiv.org/abs/1309.0424 EMRP A169: Call 2012 Open excellence call American Physical Society

College Park, MD

30 1094-1622 10.1103/PhysRevA.88.053624 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. MScherer BLücke JPeise OTopic GGebreyesus FDeuretzbacher WErtmer LSantos CKlempt J JArlt article Physical Review A 2013 11 14 88 032702 SIB06: BioQuaRT: Biologically weighted quantities in radiotherapy Electron scattering cross sections, DNA constituents EMRP A169: Call 2011 SI Broader Scope 30 1050-2947 10.1103/PhysRevA.88.032702 59 No, EURAMET is never allowed to make the publication publicly available. W. Y.Baek A.Arndt M. U.Bug H.Rabus M.Wang proceedings Proceedings of the 16th International Congress of Metrology 2013 10 7 2013 IND11: MADES: Metrology to Assess the Durability and Function of Engineered Surfaces 08001 http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_08001.pdf EMRP A169: Call 2010 Industry EDP Sciences

Paris

Paris, France 16th International Congress of Metrology 07-10-2013 to 10-10-2013 30 10.1051/metrology/201308001 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. ZSSilvestri SAAzouigui PPPinot MGGee proceedings 16th International Congress of Metrology 2013 10 7 - 2013 NEW04: Uncertainty: Novel mathematical and statistical approaches to uncertainty evaluation 04003 - MAT http://cfmetrologie.edpsciences.org/articles/metrology/pdf/2013/01/metrology_metr2013_04003.pdf EMRP A169: Call 2011 Metrology for New Technologies EDP Sciences

Les Ulis & London

Paris 16th International Congress of Metrology 07-10-2013 to 10-10-2013 30 - - 10.1051/metrology/201304003 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. CElster KKlauenberg MBär AAllard NFischer GKok Avan der Veen PHarris MCox ISmith SCowen PWilson SEllison article AIP Conf. Proc. 1552 2013 9 11 8 958 ENG01: GAS: Characterisation of Energy Gases 958-963 Industrial high temperature measurement, radiation thermometry, high temperature thermocouples, high temperature fixed points http://www.npl.co.uk/content/ConPublication/5950 EMRP A169: Call 2009 Energy AIP Publishing LLC

1305 Walt Whitman Rd Suite 300, Melville, NY 11747, United States

30 978-0-7354-1178-4 10.1063/1.4821414 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2018-12-31 GMachin KAnhalt FEdler JPearce MSadli RStrnad EVeulban article Thin Solid Films 2013 8 31 541 Current Trends in Optical and X-Ray Metrology of Advanced Materials for Nanoscale Devices III IND07: Thin Films: Metrology for the manufacturing of thin films 131-135 Spectroscopic ellipsometry, X-ray reflectometry, VUV reflectometry, Atomic layer deposition, Ultra-thin layer http://www.sciencedirect.com/science/article/pii/S0040609013000175 EMRP A169: Call 2010 Industry Elsevier

Amsterdam, Netherlands

30 0040-6090 10.1016/j.tsf.2012.12.091 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. PPPetrik TGGumprecht ANNutsch GRRoeder MLLemberger GJJuhasz OPPolgar CMMajor PKKozma MJJanosov BFFodor EAAgocs MFFried proceedings Proceedings of Microwaves, Millimeter and Submillimeter Waves 2013 8 13 NEW08: MetNEMS: Metrology with/for NEMS 427-429 graphene, dielectrics, resonators, microwave, Substrates, Microwave theory and techniques, Resistance, Apertures, Electric fields http://ieeexplore.ieee.org/document/6622095/?arnumber=6622095 EMRP A169: Call 2011 Metrology for New Technologies IEEE

Melville

Kharkov, Ukraine International Kharkov Symposium on Physics and Engineering of Microwaves, Millimeter and Submillimeter Waves 23-06-2013 to 28-06-2013 30 978-1-4799-1068-7 10.1109/MSMW.2013.6622095 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. OShaforost KWang MAdabi ZhGuo LHao JGallop NKlein article PanchalILYAK2013 IEEE TRANSACTIONS ON MAGNETICS 2013 7 49 7 IND08: MetMags: Metrology for Advanced Industrial Magnetics Epitaxial graphene, Hall sensor, Kelvin probe force microscopy (KPFM), magnetic probe calibration http://ieeexplore.ieee.org/xpl/articleDetails.jsp?arnumber=6558904 A169 EMRP A169: Call 2010 Industry 0018-9464 10.1109/TMAG.2013.2243127 1 59 NA VishalPanchal ÓscarIglesias-Freire ArseniyLartsev RositzaYakimova AgustinaAsenjo OlgaKazakova article GeorgJCESPBHVA2013 Radiotherapy and Oncology 2013 7 108 1 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 99-106 Alanine; Audit; Carbon ions; Dosimetry; Protons EMRP A169: Call 2011 Metrology for Health Elsevier BV 30 0167-8140 10.1016/j.radonc.2013.04.029 NA D.Georg O.Jäkel N.Chaudhri S.Ecker P.Sharpe H.Palmans N.Bassler R.Herrmann S.Vatnitsky A.Ableitinger article TrainaGACCDBG2013 Quantum Matter 2013 6 1 2 3 IND06: MIQC: Metrology for Industrial Quantum Communications 153-166 http://www.ingentaconnect.com/content/asp/qm/2013/00000002/00000003/art00001 A169 EMRP A169: Call 2010 Industry English 2164-7615 10.1166/qm.2013.1041 1 59 NA P.Traina M.Gramegna A.Avella A.Cavanna D.Carpentras I.Degiovanni G.Brida M.Genovese article Phys. Rev. Lett. 2013 5 23 110 21 EXL01: QESOCAS: Quantum engineered states for optical clocks and atomic sensors 210503 03.67.-a, 03.65.Yz, 37.30.+i http://arxiv.org/abs/1207.3203 EMRP A169: Call 2012 Open excellence call American Physical Society

College Park, MD

30 1079-7114 10.1103/PhysRevLett.110.210503 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. TVanderbruggen RKohlhaas ABertoldi SBernon AAspect ALandragin PBouyer article Applied Physics B 2013 5 18 113 2013 SIB04: Ion Clock: High-accuracy optical clocks with trapped ions 233-242 http://download.springer.com/static/pdf/221/art%253A10.1007%252Fs00340-013-5464-8.pdf?auth66=1386329855_1ff0f343cbf51cf62e1a31453bdb0df2&ext=.pdf EMRP A169: Call 2011 SI Broader Scope 30 10.1007/s00340-013-5464-8 1 59 No, EURAMET is never allowed to make the publication publicly available. S.Amairi T.Legero T.Kessler U.Sterr J.Wübbena O.Mandel O.Schmidt proceedings 2013 5 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 39-42 random effects, ANOVA, type A uncertainty http://www.measurement.sk/M2013/doc/proceedings/039_Arendacka-1.pdf EMRP A169: Call 2010 Industry Institute of Measurement Science

Bratislava

Smolenice, Slovakia 9th International Conference on Measurement 27-05-2013 to 30-05-2013 30 978-80-969-672-5-4 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. BArendacká A.Täubner S.Eichstädt T.Bruns C.Elster article AcerbiDTZ2013 Quantum Electronics, IEEE Journal of 2013 4 30 49 7 IND06: MIQC: Metrology for Industrial Quantum Communications 563-569 Afterpulsing, avalanche photodiode, avalanche charge, optical crosstalk, quenching circuit, single photon, singlephoton avalanche diode http://ieeexplore.ieee.org/xpls/abs_all.jsp?arnumber=6510432 A169 EMRP A169: Call 2010 Industry English 0018-9197 10.1109/JQE.2013.2260726 1 59 NA F.Acerbi A.Della Frera A.Tosi F.Zappa article RossommeDMBLSAAPTK2013 Physics in Medicine and Biology 2013 4 30 58 10 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 3481-3499 graphite calorimetry, monte carlo, fluence correction, proton beam EMRP A169: Call 2011 Metrology for Health IOP Publishing 30 0031-9155, 1361-6560 10.1088/0031-9155/58/10/3481 NA SRossomme JDobrovodský JMartinkovič NBassler ALühr DShipley PAndreo LAl-Sulaiti HPalmans R A SThomas AKacperek article AntonKKVGZM2013 Physics in Medicine and Biology 2013 3 24 58 (2013) 10 HLT09: MetrExtRT: Metrology for radiotherapy using complex radiation fields 3259 - 3282 EPR, alanine, response, dosimetry, absorbed dose to water, megavoltage x-rays, high energy electrons A169 EMRP A169: Call 2011 Metrology for Health English 0031-9155 (print) ; 1361-6560 (online) 10.1088/0031-9155/58/10/3259 1 59 NA MathiasAnton Ralf-PeterKapsch AchimKrauss Philip vonVoigts-Rhetz GiessenGiessen-Friedberg KlemensZink MalcolmMcEwen article Journal of Raman Spectroscopy 2013 2 1 44 2 NEW02: Raman: Metrology for Raman Spectroscopy 283–289 soil science; Terra Preta de Índio; carbon http://onlinelibrary.wiley.com/doi/10.1002/jrs.4191/abstract EMRP A169: Call 2011 Metrology for New Technologies Wiley

Hobeken

30 0377-0486 10.1002/jrs.4191 1 59 Yes, EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website after an embargo period. The embargo period ends on 2014-2-28 j.Ribeiro-Soares L.GCançado N.P.SFalcãob E.HMartins Ferreirac; C.AAchetec AJorio article GutschwagerTMARFH2013 Measurement Science and Technology 2013 24 6 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate 065002 (9pp) radiation thermometry, infrared, radiometer, blackbody, low temperature, http://m.iopscience.iop.org/0957-0233/24/6/065002/pdf/0957-0233_24_6_065002.pdf EMRP A169: Call 2010 Environment English 0957-0233/13/065002+09$33.00 10.1088/0957-0233/24/6/065002 1 59 NA B.Gutschwager E.Theocharous C.Monte A.Adibekyan M.Reiniger N.Fox J.Hollandt proceedings SeifertABBB2013_2 Proceedings Fachtagung Temperatur 2013 2013 IND01: HiTeMS: High temperature metrology for industrial applications (>1000 °C) laser heat treatment, fixed point, calibration, steel, temperature control EMRP A169: Call 2010 Industry Berlin, Germany Fachtagung Temperatur 2013 5 - 6 June 2013 German 3-9810021-8-0 1 59 NA M.Seifert K.Anhalt C.Baltruschat S.Bonss B.Brenner proceedings AlexandrescuV2013 Proceedings of The 9th International Conference on Measurement 2013 ENG04: SmartGrid: Metrology for Smart Electrical Grids Power Quality, Photovoltaic System, Distribution Network Grid, Harmonics, Voltage Unbalance EMRP A169: Call 2009 Energy Smolenice, Slovakia The 9th International Conference on Measurement 27 - 30 May 2013 English 59 NA D.Alexandrescu P.Vrabcek proceedings MerloneLABBBdDDEGGHHJKKMMMdSSSSSV2013 AIP Conference Proceedings 2013 8 1552 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere 1030-1035 air humidity, air pressure, air temperature, air speed and direction, historical temperature data series, meteorological instruments calibration, traceable climate measurements http://scitation.aip.org/content/aip/proceeding/aipcp/10.1063/1.4821419 EMRP A169: Call 2010 Environment Los Angeles (USA) 9th International Temperature Symposium 19-23 March 2012 10.1063/1.4821419 1 59 NA A.Merlone G.Lopardo I.Antonsen S.Bell RBenyon N.Boese D.del Campo M.Dobre J.Drnovsek A.Elkatmis E.Georgin E.Grudniewicz M.Heinonen C.Holstein-Rathlou J.Johansson P.Klason R.Knorova C.Melvad J.Merrison K.Migaa M.de Podesta H.Saathoff D.Smorgon F.Sparasci R.Strnad A.Szmyrka-Grzebyk E.Vuillermoz proceedings KovarSSA2013 NENE2013 2013 ENV09: MetroRWM: Metrology for Radioactive Waste Management 902.1 to 902.8 Free release measurement, activity measurement, gamma-ray spectrometry, low-background shield, reference materials, Monte Carlo simulations. http://www.nss.si/nene2013/Contents.htm#3912 A169 EMRP A169: Call 2010 Environment Bled NENE 2013 9 to12 September 2013 978-961-6207-36-2 1 59 NA PetrKovar JiriSuran JaroslavSolc DirkArnold proceedings AndreasMMP2013 SPIE Proceedings 2013 8789 SIB08: subnano: Traceability of sub-nm length measurements Interferometry, optics simulation, metrology, measurement uncertainty, diffraction. http://spie.org/Publications/Proceedings/Paper/10.1117/12.2020282 A169 EMRP A169: Call 2011 SI Broader Scope Munich SPIE Optical Metrology 13 to 14 May 2013 0277-786X 10.1117/12.2020282 1 59 NA BirkAndreas GiovanniMana EnricoMassa CarloPalmisano proceedings SahagiaLALTG2014 2013 IND04: MetroMetal: Ionizing Radiation Metrology for Metallurgical Industry EURAMET.EMRP-JRP IND04, metallurgical samples, natural radioactivity measurement http://www.infim.ro/rrp A169 EMRP A169: Call 2010 Industry Brasov, Romania 4th International Proficiency Testing Conference 18-20th September 2013 English 1221-1451 43 822 on line 1841-8759 1 59 NA M.Sahagia A.Luca A.Antohe R.Loan M.Tanase E.Garcia Torano proceedings DiazdeAguilarASCSN2013 5th Congreso Español de Metrologia 2013 SIB59: Q-WAVE: A quantum standard for sampled electrical measurements SI, convertidores digitales, EMRP, convertidores analógico-digitales, muestreo digital. A169 EMRP A169: Call 2012 SI Broader scope (II) Madrid, Spain 5th Congreso Español de Metrología 12 - 14 June 2013 Spanish 1 59 NA JavierDíaz de Aguilar MónicaAnguas Yolanda A.Sanmamed RaúlCaballero KurtSchweiger MiguelNeira proceedings EPJ Web of Conferences 2013 77 00003 [open access] IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities 1-8 dynamic measurement, uncertainty, Monte Carlo, digital filter, signal processing EMRP A169: Call 2010 Industry EDP Sciences

Les Ulis

Paris, France International Congress of Metrology 07-10-2013 to 10-10-2013 30 ISSN: 2100-014X 10.1051/epjconf/20147700003 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. https://cfmetrologie.edpsciences.org/index.php?option=com_toc&url=/articles/metrology/abs/2013/01/contents/contents.html S.Eichstädt B.Arendacká A.Link C.Elster proceedings 2013 HLT03: DUTy: Dosimetry for ultrasound therapy 695-698 ultrasound, tissue mimicking materials, attenuation measurement EMRP A169: Call 2011 Metrology for Health Merano AIA-DAGA 2013 Merano 30 59 No, EURAMET is never allowed to make the publication publicly available. CMusacchio RCuccaro PAlbo SLago A.Troia proceedings AvellaBCCDGGT2012 Proc. SPIE 8542, Electro-Optical Remote Sensing, Photonic Technologies, and Applications VI 2012 11 19 8542 IND06: MIQC: Metrology for Industrial Quantum Communications 13 http://spie.org A169 EMRP A169: Call 2010 Industry Edinburgh, United Kingdom Electro-Optical Remote Sensing, Photonic Technologies, and Applications VI September 24, 2012 English 10.1117/12.974608 1 59 NA AAvella GBrida DCarpentras ACavanna I. PDegiovanni MGenovese MGramegna PTraina article Optics Express 2012 10 8 20 21 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks 23518 - 23526 https://www.osapublishing.org/oe/abstract.cfm?uri=oe-20-21-23518 EMRP A169: Call 2011 SI Broader Scope 30 10.1364/OE.20.023518 1 59 No, EURAMET is never allowed to make the publication publicly available. O.Lopez A.Haboucha B.Chanteau C.Chardonnet A.Amy-Klein G.Santarelli article Applied Physics B 2012 10 4 Lasers and Optics 110 1 (2013) 3-6 SIB02: NEAT-FT: Accurate time/frequency comparison and dissemination through optical telecommunication networks http://arxiv.org/abs/1209.4715 EMRP A169: Call 2011 SI Broader Scope 30 10.1007/s00340-012-5241-0 1 59 No, EURAMET is never allowed to make the publication publicly available. O.Lopez A.Kanj P.-E.Pottie D.Rovera J.Achkar C.Chardonnet A.Amy-Klein G.Santarelli proceedings AkmalH2012 2012 Conference on Precision electromagnetic Measurements 2012 7 IND16: Ultrafast: Metrology for ultrafast electronics and high-speed communications Sampling oscilloscope, timebase correction, large-signal measurements EMRP A169: Call 2010 Industry IEEE Washington, DC, USA Conference on Precision Electromagnetic Measurements 01-07-2013 to 06-07-2012 30 10.1109/CPEM.2012.6251032 NA M.Akmal D.Humphreys proceedings Proceedings of the 12th euspen International Conference 2012 6 1 International Conference European Society for Precision Engineering and Nanotechnology 12th IND05: MeProVisc: Dynamic Mechanical Properties and Long-term Deformation Behaviour of Viscous Materials 179-182 http://training.euspen.eu/content/News-and-events/euspen-events/Stockholm%202012/proceedings/VolumePro1/VolumePro1/HTML/files/assets/basic-html/page179.html EMRP A169: Call 2010 Industry Euspen conference proceedings 

Leuven, Belgium

Nacka Strandsmässan, Stockholm, Sweden 12th International Conference European Society for Precision Engineering and Nanotechnology 04-06-2012 to 08-06-2012 30 1 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. ZLLi TAAhbe SGGao UBBrand article GorenADKMY2012 Natural Product Research 2012 26 ENG09: Biofuels: Metrology for Biofuels 84-90 EnG EMRP A169: Call 2009 Energy 1 59 NA A. C.Gören E.Akçicek T.Dirmenci T.Kilic E.Mozioglu H.Yilmaz article PollingerHVDAMM2012 Measurement Science and Technology 2012 23 2 T3.J3.1: Long distance: Absolute long distance measurement in air 025502-025503 http://stacks.iop.org/MST/23/025503 iMERA-Plus: Call 2007 Length English 1 59 NA F.Pollinger T.Hieta M.Vainio N. R.Doloca A.Abou-Zeid K.Meiners-Hagen M.Merimaa article PollingerMBDSNJHAM2012 Measurement Science and Technology 2012 23 9 T3.J3.1: Long distance: Absolute long distance measurement in air 094018 geodetic baseline, long distance measurement, refractivity compensation, calibration, measurement uncertainty, length measurement, femtosecond laser-based time-of-flight distance meter http://stacks.iop.org/MST/23/094018 iMERA-Plus: Call 2007 Length English 0957-0233 10.1088/0957-0233/23/9/094018 1 59 NA F.Pollinger T.Meyer J.Beyer N.Doloca W.Schellin W.Niemeier J.Jokela P.Häkli A.Abou-Zeid K.Meiners-Hagen article ArseneSKH2012 Journal of Mass Spectrometry 2012 47 12 T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine 1554–1560 quantitative proteomics; derivatization; tandem mass spectrometry; acromegaly; glucose tolerance tests http://arxiv.org/pdf/1205.4981.pdf iMERA-Plus: Call 2007 Health 1 59 NA C.Arsene D.Schulze J.Kratzsch A.Henrion article AckoMHB2012 Measurement Science and Technology 2012 23 9 T3.J2.2: NIMTech: Metrology for New Industrial Measurement Technologies traceability, coordinate measuring machine, freeform, 3D artefact, performance test, gear standard http://iopscience.iop.org/0957-0233 iMERA-Plus: Call 2007 Length English 957-0233 10.1088/0957-0233/23/9/094013 1 59 NA B.Acko M.McCarthy F.Haertig B.Buchmeister proceedings BouhourasMAL2012 Proceedings of the 9th International Conference on the European Energy Market (EEM) 2012 ENG04: SmartGrid: Metrology for Smart Electrical Grids http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=&arnumber=6254662&queryText%3Dbouhouras EMRP A169: Call 2009 Energy Florence, Italy 2012 9th International Conference on the European Energy Market (EEM) 8 - 10 May 2012 English 10.1109/EEM.2012.6254662 1 59 NA A.Bouhouras A.Milioudis G.Andreou D.Labridis proceedings BouhourasAML2012 Proceedings of the IEEE International Conference on Industrial Technology (ICIT) 2012 ENG04: SmartGrid: Metrology for Smart Electrical Grids http://ieeexplore.ieee.org/xpl/articleDetails.jsp?tp=&arnumber=6209919&queryText%3Dbouhouras EMRP A169: Call 2009 Energy Athens, Greece IEEE International Conference on Industrial Technology (ICIT) 19 - 21 March 2012 English 10.1109/ICIT.2012.6209919 1 59 NA A.Bouhouras G.Andreou A.Milioudis D.Labridis proceedings MonteGAKOH2012 AIP Conference Proceedings 2012 8 1552 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate Radiation Thermometry, Radiance, Remote Sensing, Vacuum, Emissivity EMRP A169: Call 2010 Environment Anaheim, USA Temperature: Its Measurement and Control in Science and Industry 19 - 23 March 2012 English 10.1063/1.4819631 1 59 NA C.Monte B.Gutschwager A.Adibekyan M.Kehrt F.Olschewski J.Hollandt article ZibordiRAMKIR2012 Ocean Science 2012 8 ENV04: MetEOC: Towards a European Metrology Centre for Earth Observation and Climate 567-586 EMRP A169: Call 2010 Environment English 10.5194/os-8-567-2012 1 59 NA G.Zibordi K.Ruddick I.Ansko G.Moore S.Kratzer J.Icely A.Reinart proceedings GalindoSantosAMCC2012 Proceedings of SPIE: Nonlinear Optics and Applications VI 2012 8434 IND14: Frequency: New generation of frequency standards for industry Optical frequency combs, Brillouin scattering amplification, metrology EMRP A169: Call 2010 Industry Brussels, Belgium Nonlinear Optics and Applications VI 16 - 18 April 2012 English 10.1117/12.922392 1 59 NA J.Galindo-Santos M.Alcon-Camas S.Martin-Lopez A.Carrasco-Sanz P.Corredera article CorrederaGMAC2012 e-medida 2012 2 IND14: Frequency: New generation of frequency standards for industry http://www.e-medida.es/documentos/Numero-2/desarrollo_de_patrones_de_frecuencia_opticos_para_comunicaciones_opticas EMRP A169: Call 2010 Industry Spanish 1 59 NA P.Corredera J.Galindo-Santos S.Martin-Lopez M.Alcon-Camas A.Carrasco-Sanz article GalindoSantosACMC2012 Óptica Pura y Aplicada 2012 45 2 IND14: Frequency: New generation of frequency standards for industry 221-231 Optical Frequency Comb, Stable Laser, Frequency Standards http://www.sedoptica.es/Menu_Volumenes/Pdfs/OPA45-2-221.pdf EMRP A169: Call 2010 Industry Spanish 10.7149/OPA.45.2.221 1 59 NA J.Galindo-Santos M.Alcon-Camas A.Carrasco-Sanz S.Martin-Lopez P.Corredero inbook 2012 IND14: Frequency: New generation of frequency standards for industry 277 - 284 http://www.cenam.mx/sm_2012 EMRP A169: Call 2010 Industry 112 978-607-96162-0-5 59 No, EURAMET is never allowed to make the publication publicly available. J.Galindo-Santos M.Alcon-Camas S.Martin-Lopez A.Carrasco-Sanz P.Corredera article AndreasFKM2012_2 Metrologia 2012 49 4 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram spatial dimensions, interferometry, fundamental constants, volume standards http://m.iopscience.iop.org/0026-1394/49/4/479 iMERA-Plus iMERA-Plus: Call 2007 SI and Fundamental Metrology English 0026-1394 10.1088/0026-1394/49/4/479 1 59 NA BAndreas KFujii NKuramoto GMana proceedings DawidLindelGWDSFRAFSNI Proc. Intl. Soc. Mag. Reson. Med. 2012 20 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI http://www.ismrm.org/12/ A169 EMRP A169: Call 2011 Metrology for Health Melbourne, Australia ISMRM 20th Annual Meeting and Exhibition 5-11 May 2012 1 59 NA TomaszDawid Lindel AndreasGreiser PatrickWaxmann MartinDietterle FrankSeifert UlrichFontius WolfgangRenz MatthiasAlexander Dieringer TobiasFrauenrath JeanetteSchulz-Menger ThoralfNiendorf BerndIttermann proceedings AlexanderDieringerdHHNS Proc. Intl. Soc. Mag. Reson. Med. 2012 20 HLT06: MRI safety: Metrology for next-generation safety standards and equipment in MRI http://www.ismrm.org/12/ A169 EMRP A169: Call 2011 Metrology for Health Melbourne, Australia ISMRM 20th Annual Meeting and Exhibition 5-11 May 2012 1 59 NA MatthiasAlexander Dieringer Thiagode Quadros JanHentschel WernerHoffmann ThoralfNiendorf JeanetteSchulz-Menger thesis 2012 ENV07: MeteoMet: Metrology for pressure, temperature, humidity and airspeed in the atmosphere centraline automatiche, PT100, datalogger EMRP A169: Call 2010 Environment Politecnico di Torino 59 not applicable 59 No, EURAMET is never allowed to make the publication publicly available. MikhailAsiatici proceedings 2012 IND09: Dynamic: Traceable Dynamic Measurement of Mechanical Quantities vacuum gauge dynamic pressure about 20ms www.imeko.org/publications/wc-2012/IMEKO-WC-2012-TC16-O8.pdf EMRP A169: Call 2010 Industry International Measurement Conferderation

Budapest

Busan, Republic of Korea XX IMEKO World Congress: Metrology for Green Growth 09-14, September, 2012 30 978-89-9500005-2 59 Yes, the publication is open access and EURAMET is permitted to upload an author's version (post-print) of the publication to the Repository on its website. F.Arrhén article ArslanovSNCLPBH2011 Applied Physics B 2011 9 25 103 1 T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection 223-228 iMERA-Plus: Call 2007 Health English 1 59 NA D.D.Arslanov M.Spunei A.K.Y.Ngai S.M.Cristescu I.D.Lindsay S.T.Persijn K.J.Boller F.J. M.Harren article MeinersHagenKA20110 VDI-Berichte 2011 9 2156 125 T3.J3.1: Long distance: Absolute long distance measurement in air Interferometry, refractive index of air iMERA-Plus: Call 2007 Length English 1 59 NA K.Meiners-Hagen P.Köchert A.Abou-Zeid article AndrieuxZCRZ2011 Optics Letters 2011 4 1 36 7 T2.J02: Breath analysis: Breath analysis as a diagnostic tool for early disease detection 1212-1214 iMERA-Plus: Call 2007 Health English 1 59 NA E.Andrieux ThomasZanon MaloCadoret AbdallahRihan Jean-JacquesZondy article AndreasABBBBBFFFKKKMNPPRSVWZ2011 Metrologia 2011 3 22 48 2 T1.J1.1: e-Mass: The watt balance route towards a new definition of the kilogram Avogadro constant, kilogram redefinition, silicon, XRCD method iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0026-1394/48/2/S01 1 59 NA B.Andreas Y.Azuma G.Bartl P.Becker H.Bettin M.Borys I.Busch P.Fuchs K.Fujii H.Fujimoto E.Kessler M.Krumrey U.Kuetgens N.Mizushima A.Nicolaus A.Picard A.Pramann O.Rienitz D.Schiel S.Valkiers A.Waseda S.Zakel article AndreasFFKM2011 Metrologia 2011 3 22 48 2 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram Phase corrections, Fizeau cavity, Gouy phase iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0026-1394/48/2/S13 1 59 NA B.Andreas L.Ferroglio K.Fujii N.Kuramoto G.Mana article BuschABCFFKKKM2011 Metrologia 2011 3 22 48 2 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram surface layer, XPS measurements, XRF measurements. iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1088/0026-1394/48/2/S10 1 59 NA I.Busch Y.Azuma H.Bettin L.Cibik P.Fuchs K.Fujii M.Krumrey U.Kutegens N.Kuramoto S.Mizushima article HaoAGCRKJDS2011 Applied Physics Letters 2011 2 28 98 9 T4.J02: NanoSpin: Nanomagnetism and Spintronics No pdf received iMERA-Plus: Call 2007 Electricity and Magnetism English 10.1063/1.3561743 1 59 NA L.Hao C.Assmann J. C.Gallop D.Cox F.Ruede O.Kazakova P.Josephs-Franks D.Drung Th.Schurig article AndreasABBBBBGFFFKKKKMMMMNPPRSVW2011 Physical Review Letters 2011 1 21 106 3 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram Avogadro constant, kilogram redefinition, silicon, XRCD method iMERA-Plus: Call 2007 SI and Fundamental Metrology English 1 59 NA B.Andreas Y.Azuma G.Bartl P.Becker H.Bettin M.Borys I.Busch M.Gray P.Fuchs K.Fujii H.Fujimoto E.Kessler M.Krumrey U.Kuetgens N.Kuramoto G.Mana P.Manson E.Massa S.Mizushima A.Nicolaus A.Picard A.Pramann O.Rienitz D.Schiel S.Valkiers A.Waseda article LacquanitiDFSAB2011 Applied Superconductivity Conference 2011 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications iMERA-Plus: Call 2007 Electricity and Magnetism English 59 NA VincenzoLacquaniti NatasciaDe Leo MatteoFretto AndreaSosso D.Andreone M.Belogolovskii proceedings PollingerMDA2011 Proceedings of the 56th International Scientific Colloquium: "Innovation in mechanical engineering-shaping the future 2011 T3.J3.1: Long distance: Absolute long distance measurement in air 7pp. tunable diode laser absorption spectroscopy, humidity, air refractive index, length metrology, long distance iMERA-Plus: Call 2007 Length Ilmenau, Germany 56th International Scientific Colloquium: "Innovation in mechanical engineering-shaping the future 12 - 16 September 2011 English 1 59 NA F.Pollinger K.Meiners-Hagen N. R.Doloca A.Abou-Zeid proceedings RossiSRAI2011 Proceedings of the 15th International Congress of Metrology 2011 ENG05: Lighting: Metrology for Solid State Lighting EMRP A169: Call 2009 Energy Paris, France 15th International Congress of Metrology 3 - 6 October 2011 English 1 59 NA L.Rossi A.Schiavi G.Rossi A.Astolfi P.Iacomussi article FerreroAMNv2010 2794 Sensors 2010 5 22 22 10 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept 3610 thermal therapies, electromagnetic hyperthermia, RF applicator, TEM mode, coaxial cable, electromagnetic modelling, thermal modelling, temperature measurements, phantoms https://www.mdpi.com/1424-8220/22/10/3610 EMPIR 2018: Health MDPI 30 10.3390/s22103610 NA R.Ferrero I.Androulakis L.Martino R.Nadar G.C.van Rhoon article ArseneHDMB2010_2 Analytcial Biochemistry 2010 3 10 401 2 T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine 228-235 Growth hormone (GH); Somatotropin; Serum; Quantification; Standardization; Reference measurement; LC–MS/MS; Isotope dilution mass spectrometry (IDMS) http://precedings.nature.com/documents/4050/version/1 iMERA-Plus: Call 2007 Health 1 59 NA C. G.Arsene A.Henrion N.Diekmann J.Manolopoulou M.Bidlingmaier proceedings PalmansAATSMK2010 Proceedings IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry 2010 T2.J07: EBCT: External Beam Cancer Therapy 107 iMERA-Plus: Call 2007 Health Vienna, Austria IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry 09-12 November 2010 English 1 59 NA H.Palmans L.Al-Sulaiti P.Andreo R. A. S.Thomas D. R.Shipley J.Martinkovic A.Kacperek proceedings AntonKKH2010 Proceedings IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry 2010 T2.J07: EBCT: External Beam Cancer Therapy 2267-2274 iMERA-Plus: Call 2007 Health Vienna, Austria IAEA International Symposium on Standards, Applications and Quality Assurance in Medical Radiation Dosimetry 09-12 November 2010 English 1 59 NA M.Anton A.Krauss R.-P.Kapsch T.Hackel article AlSualitiSTKRP2010 Nuclear Instruments and Methods 2010 A 619 T2.J07: EBCT: External Beam Cancer Therapy 344-347 iMERA-Plus: Call 2007 Health English 1 59 NA L.Al-Sulaiti D.Shipley R.Thomas A.Kacperek P.Regan H.Palmans article LemarchandDDLACBBD2010 International Journal of Thermophysics 2010 31 7 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin 1347-1359 iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1007/s10765-010-0755- 1 59 NA C.Lemarchand K.Djerroud B.Darquié O.Lopez A.Amy-Klein C.Chardonnet C.Bordé S.Briaudeau C.Daussy article DolocaMWPA2010 Measurement Science and Technology 2010 21 T3.J3.1: Long distance: Absolute long distance measurement in air 115302 (7pp) absolute distance measurement, femtosecond laser, time-of-flight iMERA-Plus: Call 2007 Length English 10.1088/0957-0233/21/11/115302 1 59 NA N. R.Doloca K.Meiner-Hagen M.Wedde F.Pollinger A.Abou-Zeid article DolocaWMA2010 PTB-Mitteilungen 2010 120 2 T3.J3.1: Long distance: Absolute long distance measurement in air 120-123 iMERA-Plus: Call 2007 Length German 1 59 NA N. R.Doloca M.Wedde K.Meiners-Hagen A.Abou-Zeid article MeinersHagenPA2010 PTB-Mitteilungen 2010 120 2 T3.J3.1: Long distance: Absolute long distance measurement in air 110-114 iMERA-Plus: Call 2007 Length German 1 59 NA K.Meiners-Hagen F.Pollinger A.Abou-Zeid proceedings PollingerDWMA2010 Proceedings of SPIE: 7544 2010 T3.J3.1: Long distance: Absolute long distance measurement in air iMERA-Plus: Call 2007 Length Hangzhou ISPEMI 2010, 6th International Symposium on Precision Engineering Measurements and Instrumentation 08-11 August 2010 English 978-0-8194-7940-2 1 59 NA F.Pollinger N. R.Doloca M.Wedde K.Meiners-Hagen A.Abou-Zeid article WunderliA2010 METinfo 2010 2 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 15-19 iMERA-Plus: Call 2007 Health German-French 1 59 NA SamuelWunderli SamuelWunderli H.Andres proceedings SchraderSKLAA2010 2010 Asia-Pacific International Symposium on Electromagnetic Compatibility : proceedings of tutorials & workshops 2010 T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive 564-567 http://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?punumber=5470270 iMERA-Plus: Call 2007 Electricity and Magnetism Bejing, China 2010 Asia-Pacific International Symposium on Electromagnetic Compatibility 12 - 16 April 2010 English 1 59 NA T.Schrader M.Salhi T.Kleine-Ostmann B.Loader D.Adamson D.Allal article DjerroudLGDBDLACB2009 Comptes Rendus Physique 2009 11 10 9 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin 883-893 Fundamental constants; Laser spectroscopy; Absorption line shape iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1016/j.crhy.2009.10.020 1 59 NA K.Djerroud C.Lemarchand A.Gauguet C.Daussy S.Briaudeau B.Darquié O.Lopez A.Amy-Klein C.Chardonnet C.Bordé article KemppinenKPTAP2010 Applied Physics Letters 2009 94 172108 T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere 1-3 iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1063/1.3127229 1 59 NA A.Kemppinen S.Kafanov Yu. A.Pashkin J. S.Tsai D. V.Averin J. P.Pekola article LacquanitiADFSB2009 IEEE Transactions on Applied Superconductivity 2009 19 3 T4.J03: JOSY: Next generation of quantum voltage systems for wide range applications 234-237 Josephson junctions; superconducting devices; voltage standard iMERA-Plus: Call 2007 Electricity and Magnetism English 1051-8223 1 59 NA V.Lacquaniti D.Andreone N.DeLeo M.Fretto A.Sosso M.Belogolovskii article AlleviABBGGTOPZ2009 Physical Review A 2009 80 022114 T1.J2.3: qu-Candela: Candela: towards quantum-based photon standards iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1103/PhysRevA.80.022114 1 59 NA A.Allevi A.Andreoni M.Bondani G.Brida M.Genovese M.Gramegna P.Traina S.Olivares M. G. A.Paris G.Zambra article TrincheroSLGFdABTBV2009 IEEE Antennas and Wireless Propagation Letters 2009 8 T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive 224-227 iMERA-Plus: Call 2007 Electricity and Magnetism English 1 59 NA D.Trinchero R.Stefanelli F.Longobardi A.Galardini B.Fiorelli G.d'Amore L.Anglesio A.Benedetto S.Trinchero M.Borsero G.Vizio article TrincheroSLGFdABTBV2009_2 IEEE Antennas and Wireless Propagation Letters 2009 8 T4.J07: EMF and SAR: Traceable measurement of field strength and SAR for the Physical Agents Directive 494-497 iMERA-Plus: Call 2007 Electricity and Magnetism English 1 59 NA D.Trinchero R.Stefanelli F.Longobardi A.Galardini B.Fiorelli G.d'Amore L.Anglesio A.Benedetto S.Trinchero M.Borsero G.Vizio article BerdatAW2009 Chimia 2009 63 10 T2.J10: TRACEBIOACTIVITY: Traceable measurements for biospecies and ion activity in clinical chemistry 670-677 Clinical chemistry, electrolyte, ion-selective electrode, Pitzer activity, potentiometry iMERA-Plus: Call 2007 Health English 10.2533/chimia.2009.670 1 59 NA D.Berdat H.Andres S.Wunderli article ApolloniMPZ2008 Acta Crystallographica Section A 2008 7 10 A64 T1.J1.2: NAH: Avogadro and molar Planck constants for the redefinition of the kilogram 549-559 X-ray optics; X-ray interferometry; instrumentation, measurement, and metrology; interferometry iMERA-Plus: Call 2007 SI and Fundamental Metrology English 1 59 NA A.Apolloni G.Mana C.Palmisano G.Zosi article ArseneOBPHOBG2008_2 Analytical Chemistry 2008 4 30 80 11 T2.J.11: CLINBIOTRACE: Traceability of Complex Biomolecules and Biomarkers in Diagnostics - Effecting Measurement Comparability in Clinical Medicine 4154-4160 http://pubs.acs.org/doi/abs/10.1021/ac7024738 iMERA-Plus: Call 2007 Health English 10.1021/ac7024738 1 59 NA C. G.Arsene R.Ohlendorf W. I.Burkitt C.Pritchard A.Henrion G.O'Connor D. M.Bunk B.Guettler article WrightBGTPJHAJNR20100 Physical Review Letters B 2008 78 233311 T1.J1.3: REUNIAM: Redefinition of the SI base unit ampere 1-4 iMERA-Plus: Call 2007 SI and Fundamental Metrology English 10.1103/PhysRevB.78.233311 1 59 NA S. J.Wright M. D.Blumenthal GodfreyGumbs A. L.Thorn M.Pepper T. J. B. M.Janssen S. N.Holmes D.Anderson G. A. C.Jones C. A.Nicoll D. A.Ritchie article AlfonsoACSKKMPRSUV2008 Medical Physics 2008 35 T2.J07: EBCT: External Beam Cancer Therapy 5179-5186 iMERA-Plus: Call 2007 Health English 10.1118/1.3005481 1 59 NA R.Alfonso P.Andreo R.Capote M.Saiful Huq W.Kilby P.Kjäll T. R.Mackie H.Palmans K.Rosser J.Seuntjens W.Ullrich S.Vatnitsky article DaussyGADHBBC2007 Physical Review Letters 2007 98 250801 T1.J1.4: Boltzmann constant: Determination of the Boltzmann constant for the redefinition of the kelvin iMERA-Plus: Call 2007 SI and Fundamental Metrology English 1 59 NA C.Daussy M.Guinet A.Amy-Klein K.Djerroud Y.Hermier S.Briaudeau C.Bordé C.Chardonnet article NouiraEYAS201 Journal of Physics: Conference Series 201 4 7 483 IND10: Form metrology: Optical and tactile metrology for absolute form characterization 12 http://iopscience.iop.org/1742-6596/483/1/012015 A169 EMRP A169: Call 2010 Industry 1742-6596 10.1088/1742-6596/483/1/012015 1 59 NA HNouira NEl-Hayek XYuan NAnwer JSalgado article AkcadagS0008 2804 International Journal of Metrology and Quality Engineering 8 6 22 13 Int. J. Me 17RPT02: rhoLiq: Establishing traceability for liquid density measurements 1-6 liquid density reference liquids / hydrostatic weighing https://www.metrology-journal.org/articles/ijmqe/abs/2022/01/contents/contents.html EMPIR 2017: Research Potential EDP Sciences 30 2107-6847 10.1051/ijmqe/2022006 NA U.Yu.Akcadag G.S.Sariyerli miscellaneous PottieAQLCRWKKG 2291 Zenodo 18SIB06: TiFOON: Advanced time/frequency comparison and dissemination through optical telecommunication networks 4046057 frequency transfer, optical fiber link, optical atomic clocks https://doi.org/10.5281/zenodo.4046057 EMPIR 2018: SI Broader Scope Zenodo NA https://doi.org/10.5281/zenodo.4046057 P-E.Pottie A.Amy-Klein N.Quintin O.Lopez E.Cantin S.M.F.Raupach T.Waterholter A.Kuhl S.Koke G.Grosche miscellaneous HutzschenreuterSLSKAH 2337 17IND02: SmartCom: Communication and validation of smart data in IoT-networks Digital-SI (D-SI), data communication, IoT-communication, IoT-networking, metrology data, SmartCom, digital exchange format, XML, EMPIR, Horizon 2020 EMPIR 2017: Industry Zenodo NA https://zenodo.org/record/4709001 D.Hutzschenreuter L.Shan J.H.Loewe A.Scheibner R.Klobucar B.Acko L.Heindorf miscellaneous ManaraUAAS 2548 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Spectral emissivity, High temperature, Isotropic graphite EMPIR 2017: Industry ZENODO NA https://zenodo.org/record/6033315 J.Manara D.Urban K.Anhalt M.Arduini T.Stark miscellaneous AnhaltUMASPP 2550 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Spectral emissivity, High temperature, Tungsten EMPIR 2017: Industry ZENODO NA https://zenodo.org/record/6033061 K.Anhalt D.Urban J.Manara M.Arduini T.Stark P.Pichler G.Pottlacher miscellaneous AnhaltUMASPP_2 2549 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Spectral emissivity, High temperature, Molybdenum EMPIR 2017: Industry ZENODO NA https://zenodo.org/record/6033246 K.Anhalt D.Urban J.Manara M.Arduini T.Stark P.Pichler G.Pottlacher miscellaneous VidiMRHAUPPM 2562 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Specific heat, High temperature, Tungsten EMPIR 2017: Industry ZENODO NA https://zenodo.org/record/6091579 S.Vidi J.Manara R.Razouk B.Hay K.Anhalt D.Urban P.Pichler G.Pottlacher N.Milosevic miscellaneous VidiMRHAUPPM_2 2561 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Specific heat, High temperature, Molybdenum EMPIR 2017: Industry ZENODO NA https://zenodo.org/record/6091492 S.Vidi J.Manara R.Razouk B.Hay K.Anhalt D.Urban P.Pichler G.Pottlacher N.Milosevic miscellaneous RazoukHAUM 2560 17IND11: Hi-TRACE: Industrial process optimisation through improved metrology of thermophysical properties Specific heat, High temperature, Isotropic graphite EMPIR 2017: Industry ZENODO NA https://zenodo.org/record/6091274 R.Razouk B.Hay K.Anhalt D.Urban N.Milosevic miscellaneous NaydenovDAEBGJSMTDFJO 1463 17FUN06: SIQUST: Single-photon sources as new quantum standards Crystal defectsQuantum Information with hybrid SystemsQuantum sensingelemantal semiconductorsNitrogen vacancy centers in Diamondwide band gap Systemsoptically detected magnetic resonance https://zenodo.org/record/3711403#.Xnh5L0BFz8d EMPIR 2017: Fundamental 30 NA B.Naydenov I.P.Degiovanni G.Amato E.Enrico F.Bosia V.Grilj M.Jakšić N.Skukan E.Moreva P.Traina T.Ditalia J.Forneris F.Jelezko P.Olivero proceedings ElHayekANGDB This paper will be published in Procedia CIRP IND10: Form metrology: Optical and tactile metrology for absolute form characterization Aspheric surface; form characterization; high precision metrology; non linear least-squares method; computational metrology. A169 EMRP A169: Call 2010 Industry 13th CIRP Conference on Computer Aided Tolerancing English 1 59 NA N.El-Hayek N.Anwer H.Nouira O.Gibaru M.Damak P.Bourdet miscellaneous SchwarzDABLSWRLL 1715 18SIB05: ROCIT: Robust Optical Clocks for International Timescales Optical clocks ; Primary frequency standards ; Absolute frequency measurement ; Clock stability https://oar.ptb.de/resources/show/10.7795/720.20201113 EMPIR 2018: SI Broader Scope 10.7795/720.20201113 NA R.Schwarz S.Dörscher A.Al-Masoudi E.Benklöer T.Legero U.Sterr S.Weyers J.Rahm B.Lipphardt C.Lisdat miscellaneous BottauscioABCZ 1395 Zenodo 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations Dosimetry, Magnetic Resonance Imaging (MRI), MR Safety, Gradient Coils, Medical Implants, Prostheses, Numerical Simulation EMPIR 2017: Industry 1 NA https://doi.org/10.5281/zenodo.3625218 O.Bottauscio A.Arduino R.Brühl M.Chiampi L.Zilberti miscellaneous ChiampiBZHZAB 2159 Zenodo 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations Dosimetry, Magnetic Resonance Imaging (MRI), MR Safety, Medical Implants, Prostheses, Numerical Simulation EMPIR 2017: Industry 10.5281/zenodo.4049839 NA M.Chiampi R.Brühl L.Zilberti J.Hand U.Zanovello A.Arduino O.Bottauscio miscellaneous WooldridgeAZZCB 2162 Zenodo 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations MRI, implant heating https://zenodo.org/record/4926767#.YUHysbgzbIU EMPIR 2017: Industry 10.5281/zenodo.4926767 NA J.Wooldridge A.Arduino L.Zilberti U.Zanovello M.Chiampi O.Bottauscio miscellaneous ClementiZAABBCZB 2161 Zenodo 17IND01: MIMAS: Procedures allowing medical implant manufacturers to demonstrate compliance with MRI safety regulations MRI heating risk, MRI safety, Orthopaedic implants, Radiofrequency heating, Gradient coil heating https://zenodo.org/record/4388310#.YUHxNbgzbIU EMPIR 2017: Industry 10.5281/zenodo.4388310 NA V.Clementi U.Zanovello A.Arduino C.Ancarani F.Baruffaldi B.Bordini M.Chiampi L.Zilberti O.Bottauscio miscellaneous EdlerBIMTAASZ 2515 International Journal of Thermophysics 42 17IND04: EMPRESS 2: Enhancing process efficiency through improved temperature measurement 2 150 Noble metal thermocouples · Reference function · Thermoelectricstability and homogeneity https://link.springer.com/content/pdf/10.1007/s10765-021-02895-w.pdf EMPIR 2017: Industry Springer 1572-9567 NA https://zenodo.org/record/5163783 F.Edler J.Bojkovski C.G.Izquierdo M.J.Martin D.Tucker N.Arifovic S.L.Andersen L.Sindelorva V.Žužek miscellaneous FischerHSPA 1518 17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty CASoftConformity assessmentRiskConformance probability MAT https://zenodo.org/record/3895759#.XuiTkEUzZPY EMPIR 2017: Support for Impact 1 10.5281/zenodo.3895759 NA N.Fischer P.Harris I.Smith L.Pendrill A.Allard miscellaneous FischerHSPA_2 1526 17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty Conformity assessmentConformance probability Specific risk Uncertainty Metrology MAT EMPIR 2017: Support for Impact 1 NA 10.5281/zenodo.3909017 N.Fischer P.Harris I.Smith L.Pendrill A.Allard miscellaneous AllardPSHF 1558 17SIP05: CASoft: Software to maximize end user uptake of conformity assessment with measurement uncertainty Conformity assessment Global risk Uncertainty MetrologyCAsoft MAT EMPIR 2017: Support for Impact 1 NA https://zenodo.org/record/3908190 A.Allard L.Pendrill I.Smith P.Harris N.Fischer miscellaneous PeinerVFMABLBXDBKDH 1495 Open Access Repository PTB 17IND05: MicroProbes: Multifunctional ultrafast microprobes for on-the-machine measurements cantilever microprobe, high-speed, contact resonance, tip wear, piezo-resistive, mechanical damping, tip-testing standard, cantilevers, micromechanical devices, surface topography measurement, shape measurement https://oar.ptb.de/resources/show/10.7795/720.20200515 EMPIR 2017: Industry Physikalisch-Technische Bundesanstalt (PTB) 1 10.7795/720.20200515 NA U.Brand M.XU L.Doering J.Langfahl-Klabes H.Behle S.Bütefisch T.Ahbe B.Mickan E.Peiner S.Völlmeke T.Frank I.Kiselev M.Drexel M.Hauptmannl proceedings KarhaAMDI 2124 Proceedings of NEWRAD 2021 19ENG01: Metro-PV: Metrology for emerging PV applications 73 - 74 Solar cell, differential spectral responsivity, LED, Halogen lamp, Lock-in amplifier EMPIR 2019: Energy Aalto University / NIST 1 NA https://zenodo.org/record/4882794 P.Kärhä J.Askola K.Maham T.Dönsberg E.Ikonen miscellaneous FurtadoPQSLMAARLBCLA 2053 ACTA IMEKO 9 17RPT02: rhoLiq: Establishing traceability for liquid density measurements 79-84 density; viscoelasticity; oscillationtype densimetry: degree of equivalence; rhoLiq EMPIR 2017: Research Potential IMEKO 2221-870X NA https://zenodo.org/record/4792271 A.Furtado J.Pereira R.Quendera M.Schiebl E.Lenard E.Malejczyk A. Alic S.Alisic J.Rauch F.Lorenz A.Bescupschii A.Ciubara B.Laky R.Amsüss miscellaneous ZuccaFLFA 1888 1 16ENG08: MICEV: Metrology for inductive charging of electric vehicles 1-2 Validation software, Wireless power transfer, Electric Vehicle EMPIR 2016: Energy CERN 0000-0000 NA https://zenodo.org/record/4476252 M.Zucca F.Freschi I.Liorni A.Fallahi P.Ankarson miscellaneous AqeelSTMMBBGPB 2456 Physical Review Letters 126 17FUN08: TOPS: Metrology for topological spin structures 017202-1 - 017202-7 Lattice dynamics, Magnetic order, Magnetism, Magnetization dynamics, Skyrmions, Spin waves, Microwave techniques EMPIR 2017: Fundamental American Physical Society 10.5281/zenodo.5793226 NA A.Aqeel J. Sahliger T.Taniguchi S.Mändl D.Mettus H.Berger A.Bauer M.Garst C.Pfleiderer C.H.Back miscellaneous RibeiroCSMLASBS 2012 17NRM05: EMUE: Advancing measurement uncertainty - comprehensive examples for key international standards Measurement uncertainty; Water Supply Networks; Volume Totalization EMPIR 2017: Pre-Co-Normative 10.5281/zenodo.4700500 NA A.S.Ribeiro M.G.Cox J.A.Sousa L.L.Martins D.Loureiro M.C.Almeida M.A.Silva R.Brito A.C.Soares miscellaneous AntonioDCM 1745 Zenodo 1 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 1 Phase measurement, digitizer, calibration, discrete Fourier transform, phasor measurement unit, synchrophasor, digital low power instrument transformer https://zenodo.org/record/4319974 EMPIR 2017: Industry Zenodo 1 10.5281/zenodo.4319974 NA D.F.Antonio G.Daniele L.Carmine L.Mario miscellaneous CrottiADDCM 1744 Zenodo 1 17IND06: FutureGrid II: Metrology for the next-generation digital substation instrumentation 1 Phase measurement, Clocks, Delay effects, Delays, Measurement uncertainty, Frequency measurement EMPIR 2017: Industry Zenodo 1 10.5281/zenodo.4319968 NA G.Crotti D.F.Antonio G.Daniele G.Domenico L.Carmine L.Mario miscellaneous FernandezScarioniBCSHALRCKS 1799 Zenodo N/A 17FUN08: TOPS: Metrology for topological spin structures N/A skyrmions, anomalous Nernst effect, topological Nernst effect https://zenodo.org/record/4322235#.X_wh1RYxlaQ EMPIR 2017: Fundamental Zenodo N/A NA https://doi.org/10.5281/zenodo.4322235 A.Fernández Scarioni C.Barton H.Corte-León S.Sievers X.Hu F.Ajejas W.Legrand N.Reyren V.Cros O.Kazakova H.W.Schumacher miscellaneous Aksulu 2050 18RPT01: ProbeTrace: Traceability for contact probe and stylus instrument measurements Random noise, sine wave EMPIR 2018: Research Potential NA https://doi.org/10.5281/zenodo.4481965 M.Aksulu miscellaneous Aksulu_2 2049 18RPT01: ProbeTrace: Traceability for contact probe and stylus instrument measurements Surface roughness measurement device, calibration, ball standard EMPIR 2018: Research Potential NA https://doi.org/10.5281/zenodo.4471347 M.Aksulu miscellaneous AssoulineJBWTJGKRPR 2631 Nature Physics 17 17FUN04: SEQUOIA: Single-electron quantum optics for quantum-enhanced measurements 1369-1374 Graphene, p-n junction, interferometer, magnons https://doi.org/10.5281/zenodo.6500310 EMPIR 2017: Fundamental Springer Science and Business Media LLC

Dordrecht, GX, Netherlands

1 1745-2473, 1745-2481 10.1038/s41567-021-01411-z NA A.Assouline M.Jo P.Brasseur K.Watanabe T.Taniguchi Th.Jolicoeur D. C.Glattli N.Kumada P.Roche F. D.Parmentier P.Roulleau miscellaneous FerreroCBVSYACMT 2164 Zenodo 18HLT06: RaCHy: Radiotherapy coupled with hyperthermia - adapting the biological equivalent dose concept nanomedicine, magnetic hyperthermia, magnetic nanoparticles, iron oxide nanocubes, chemical synthesis, magnetometry, thermometric measurements, micromagnetic simulations, thermal simulations EMPIR 2018: Health 10.5281/zenodo.5040394 NA R.Ferrero F.Celegato G.Barrera M.Vicentini H.Sözeri N.Yıldız C.Atila Dinçer M.Coïsson A.Manzin P.Tiberto miscellaneous AlKhafajiGWBV 2246 Materials 13 18HLT01: METVES II: Standardisation of concentration measurements of extracellular vesicles for medical diagnoses 3101 silica nanoparticle, size distribution, light scattering, small-angle X-ray scattering, microfluidic resistive pulse sensing EMPIR 2018: Health Multidisciplinary Digital Publishing Institute 1996-1944 10.5281/zenodo.4545822 NA M.Al-Khafaji A.Gaál A.Wacha A.Bóta Z.Varga miscellaneous RiemanAEBMSSRIF 2335 18HLT09: Neuromet2: Metrology and innovation for early diagnosis and accurate stratification of patients with neurodegenerative diseases magnetic resonance spectroscopy (MRS), 7T, Reproducibility, Repeatability, Neurochemicals https://zenodo.org/record/5500320#.YZ9eudDP1aS EMPIR 2018: Health NA https://doi.org/10.5281/zenodo.5500319 L.T.Rieman C.S.Aigner S.L.R.Ellison R.Brühl R.Mekle S.. Schmitter O.Speck G.Rose B.Itterman A.Fillmer miscellaneous ArconesOAGK 2495 2021 IEEE Electrical Insulation Conference (EIC) N/A 19ENG02: FutureEnergy: Metrology for future energy transmission 242 sensor phenomena and characterization, performance evaluation, partial discharges, insulation testing, condition monitoring SEG EMPIR 2019: Energy IEEE

N/

1 N/A NA https://zenodo.org/record/5913201 E.Arcones J.Ortego F.Alvarez F.Garnacho A.Kamlichi miscellaneous PanniAGT 2466 Zenodo 17IND12: Met4FoF: Metrology for the Factory of the Future forming, forge, sensors, uncertainty, European Union (EU), Horizon 2020, EMPIR EMPIR 2017: Industry NA https://doi.org/10.5281/zenodo.2573860 O.Panni I.Andonovic G.Gourlay C.Tachtatzis miscellaneous TachtatzisAG 2538 Zenodo 17IND12: Met4FoF: Metrology for the Factory of the Future MEMS, Calibrations, European Union (EU), Horizon 2020, EMPIR EMPIR 2017: Industry NA https://zenodo.org/record/5705521 C.Tachtatzis I.Andonovic G.Gourlay